FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26110

FusionGeneSummary for PBRM1_NT5DC2

check button Fusion gene summary
Fusion gene informationFusion gene name: PBRM1_NT5DC2
Fusion gene ID: 26110
HgeneTgene
Gene symbol

PBRM1

NT5DC2

Gene ID

55193

64943

Gene namepolybromo 15'-nucleotidase domain containing 2
SynonymsBAF180|PB1-
Cytomap

3p21.1

3p21.1

Type of geneprotein-codingprotein-coding
Descriptionprotein polybromo-1BRG1-associated factor 180polybromo-1D5'-nucleotidase domain-containing protein 2
Modification date2018052320180523
UniProtAcc

Q86U86

Q9H857

Ensembl transtripts involved in fusion geneENST00000356770, ENST00000394830, 
ENST00000296302, ENST00000337303, 
ENST00000410007, ENST00000409057, 
ENST00000409114, ENST00000409767, 
ENST00000307092, ENST00000307076, 
ENST00000422318, ENST00000459839, 
ENST00000490681, 
Fusion gene scores* DoF score9 X 6 X 9=4866 X 4 X 6=144
# samples 107
** MAII scorelog2(10/486*10)=-2.28095631383106
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/144*10)=-1.04064198449735
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PBRM1 [Title/Abstract] AND NT5DC2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDKIRCTCGA-AK-3455-01APBRM1chr3

52702514

-NT5DC2chr3

52559311

-
TCGALDLIHCTCGA-DD-A1EA-01APBRM1chr3

52702514

-NT5DC2chr3

52559311

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000356770ENST00000307092PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000356770ENST00000307076PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000356770ENST00000422318PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000356770ENST00000459839PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
5CDS-intronENST00000356770ENST00000490681PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
Frame-shiftENST00000394830ENST00000307092PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
Frame-shiftENST00000394830ENST00000307076PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
Frame-shiftENST00000394830ENST00000422318PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
Frame-shiftENST00000394830ENST00000459839PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
5CDS-intronENST00000394830ENST00000490681PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000296302ENST00000307092PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000296302ENST00000307076PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000296302ENST00000422318PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000296302ENST00000459839PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
5CDS-intronENST00000296302ENST00000490681PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000337303ENST00000307092PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000337303ENST00000307076PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000337303ENST00000422318PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000337303ENST00000459839PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
5CDS-intronENST00000337303ENST00000490681PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000410007ENST00000307092PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000410007ENST00000307076PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000410007ENST00000422318PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000410007ENST00000459839PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
5CDS-intronENST00000410007ENST00000490681PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409057ENST00000307092PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409057ENST00000307076PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409057ENST00000422318PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409057ENST00000459839PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
5CDS-intronENST00000409057ENST00000490681PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409114ENST00000307092PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409114ENST00000307076PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409114ENST00000422318PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409114ENST00000459839PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
5CDS-intronENST00000409114ENST00000490681PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409767ENST00000307092PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409767ENST00000307076PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409767ENST00000422318PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
In-frameENST00000409767ENST00000459839PBRM1chr3

52702514

-NT5DC2chr3

52559311

-
5CDS-intronENST00000409767ENST00000490681PBRM1chr3

52702514

-NT5DC2chr3

52559311

-

Top

FusionProtFeatures for PBRM1_NT5DC2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PBRM1

Q86U86

NT5DC2

Q9H857


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-3301468_15991281690Compositional biasNote=Pro-rich
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-330630_6331281690Compositional biasNote=Poly-Asp
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-3281468_15991281583Compositional biasNote=Pro-rich
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-328630_6331281583Compositional biasNote=Poly-Asp
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-3281468_15991281603Compositional biasNote=Pro-rich
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-328630_6331281603Compositional biasNote=Poly-Asp
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-4301468_15991281583Compositional biasNote=Pro-rich
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-430630_6331281583Compositional biasNote=Poly-Asp
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-3291468_15991281635Compositional biasNote=Pro-rich
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-329630_6331281635Compositional biasNote=Poly-Asp
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-3301468_15991281653Compositional biasNote=Pro-rich
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-330630_6331281653Compositional biasNote=Poly-Asp
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-3291468_15991281598Compositional biasNote=Pro-rich
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-329630_6331281598Compositional biasNote=Poly-Asp
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-3291468_15991281610Compositional biasNote=Pro-rich
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-329630_6331281610Compositional biasNote=Poly-Asp
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-3301379_14471281690DNA bindingHMG box
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-3281379_14471281583DNA bindingHMG box
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-3281379_14471281603DNA bindingHMG box
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-4301379_14471281583DNA bindingHMG box
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-3291379_14471281635DNA bindingHMG box
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-3301379_14471281653DNA bindingHMG box
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-3291379_14471281598DNA bindingHMG box
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-3291379_14471281610DNA bindingHMG box
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-3301156_12721281690DomainBAH 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-330200_2701281690DomainBromo 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-330400_4701281690DomainBromo 3
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-330538_6081281690DomainBromo 4
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-33064_1341281690DomainBromo 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-330676_7461281690DomainBromo 5
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-330792_8621281690DomainBromo 6
HgenePBRM1chr3:52702514chr3:52559311ENST00000296302-330956_10741281690DomainBAH 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-3281156_12721281583DomainBAH 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-328200_2701281583DomainBromo 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-328400_4701281583DomainBromo 3
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-328538_6081281583DomainBromo 4
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-32864_1341281583DomainBromo 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-328676_7461281583DomainBromo 5
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-328792_8621281583DomainBromo 6
HgenePBRM1chr3:52702514chr3:52559311ENST00000337303-328956_10741281583DomainBAH 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-3281156_12721281603DomainBAH 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-328200_2701281603DomainBromo 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-328400_4701281603DomainBromo 3
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-328538_6081281603DomainBromo 4
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-32864_1341281603DomainBromo 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-328676_7461281603DomainBromo 5
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-328792_8621281603DomainBromo 6
HgenePBRM1chr3:52702514chr3:52559311ENST00000356770-328956_10741281603DomainBAH 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-4301156_12721281583DomainBAH 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-430200_2701281583DomainBromo 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-430400_4701281583DomainBromo 3
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-430538_6081281583DomainBromo 4
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-43064_1341281583DomainBromo 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-430676_7461281583DomainBromo 5
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-430792_8621281583DomainBromo 6
HgenePBRM1chr3:52702514chr3:52559311ENST00000394830-430956_10741281583DomainBAH 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-3291156_12721281635DomainBAH 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-329200_2701281635DomainBromo 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-329400_4701281635DomainBromo 3
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-329538_6081281635DomainBromo 4
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-32964_1341281635DomainBromo 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-329676_7461281635DomainBromo 5
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-329792_8621281635DomainBromo 6
HgenePBRM1chr3:52702514chr3:52559311ENST00000409057-329956_10741281635DomainBAH 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-3301156_12721281653DomainBAH 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-330200_2701281653DomainBromo 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-330400_4701281653DomainBromo 3
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-330538_6081281653DomainBromo 4
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-33064_1341281653DomainBromo 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-330676_7461281653DomainBromo 5
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-330792_8621281653DomainBromo 6
HgenePBRM1chr3:52702514chr3:52559311ENST00000409114-330956_10741281653DomainBAH 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-3291156_12721281598DomainBAH 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-329200_2701281598DomainBromo 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-329400_4701281598DomainBromo 3
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-329538_6081281598DomainBromo 4
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-32964_1341281598DomainBromo 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-329676_7461281598DomainBromo 5
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-329792_8621281598DomainBromo 6
HgenePBRM1chr3:52702514chr3:52559311ENST00000409767-329956_10741281598DomainBAH 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-3291156_12721281610DomainBAH 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-329200_2701281610DomainBromo 2
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-329400_4701281610DomainBromo 3
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-329538_6081281610DomainBromo 4
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-32964_1341281610DomainBromo 1
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-329676_7461281610DomainBromo 5
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-329792_8621281610DomainBromo 6
HgenePBRM1chr3:52702514chr3:52559311ENST00000410007-329956_10741281610DomainBAH 1


Top

FusionGeneSequence for PBRM1_NT5DC2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_313aa
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQ
PIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRI
INTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_939nt
ATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAGGC
CCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACTAT
AAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTCAG
CCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTTTT
AACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGGAC
CACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCATC
ATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGGAG
TCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCATC
TTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCAAC
TACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1041nt
CCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAG
GCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACT
ATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTC
AGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTT
TTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGG
ACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCA
TCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGG
AGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCA
TCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCA
ACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCA
TGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATCC

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1024nt
CCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAG
GCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACT
ATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTC
AGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTT
TTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGG
ACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCA
TCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGG
AGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCA
TCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCA
ACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCA
TGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATCC

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1022nt
CCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAG
GCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACT
ATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTC
AGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTT
TTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGG
ACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCA
TCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGG
AGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCA
TCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCA
ACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCA
TGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATCC

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_941nt
CCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAG
GCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACT
ATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTC
AGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTT
TTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGG
ACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCA
TCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGG
AGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCA
TCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCA
ACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCA

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000356770_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1041nt
CCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAG
GCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACT
ATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTC
AGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTT
TTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGG
ACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCA
TCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGG
AGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCA
TCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCA
ACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCA
TGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATCC

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1024nt
CCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAG
GCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACT
ATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTC
AGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTT
TTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGG
ACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCA
TCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGG
AGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCA
TCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCA
ACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCA
TGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATCC

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1022nt
CCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAG
GCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACT
ATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTC
AGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTT
TTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGG
ACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCA
TCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGG
AGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCA
TCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCA
ACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCA
TGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATCC

>In-frame_PBRM1_ENST00000296302_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_941nt
CCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCAG
GCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGACT
ATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCTC
AGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTTT
TTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGGG
ACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGCA
TCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCGG
AGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGCA
TCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTCA
ACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGCA

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000337303_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000410007_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409057_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409114_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307092_chr3_52559311_-_1042nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000307076_chr3_52559311_-_1025nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000422318_chr3_52559311_-_1023nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC
ATGAAGACCCCCTTCCTTGGTGACATGGCCCACATCCGCTGAGGGCACCTTTATTGTCTGGGACAGGCCCTCAGCCCCTCCTGCCCCATC

>In-frame_PBRM1_ENST00000409767_chr3_52702514_-_NT5DC2_ENST00000459839_chr3_52559311_-_942nt
TCCATGGGTTCCAAGAGAAGAAGAGCTACCTCCCCTTCCAGCAGTGTCAGCGGGGACTTTGATGATGGGCACCATTCTGTGTCAACACCA
GGCCCAAGCAGGAAAAGGAGGAGACTTTCCAATCTTCCAACTGTAGATCCTATTGCCGTGTGCCATGAACTCTATAATACCATCCGAGAC
TATAAGGATGAACAGGGCAGACTTCTCTGTGAGCTCTTCATTAGGGCACCAAAGCGAAGAAATCAACCAGACTATTATGAAGTGGTTTCT
CAGCCCATTGACTTGATGAAAATCCAACAGAAACTAAAAATGGAAGAGTATGATGATGTTAATTTGCTGACTGCTGACTTCCAGCTTCTT
TTTAACAATGCAAAGTCCTATTATAAGGGAAACCTGTTTGACTTCTTACGCTTGACGGAATGGCGTGGCCCCCGCGTGCTCTACTTCGGG
GACCACCTCTATAGTGATCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACAGGCGCCATCATCCCCGAGCTGGAGCGTGAGATCCGC
ATCATCAACACGGAGCAGTACATGCACTCGCTGACGTGGCAGCAGGCGCTCACGGGGCTGCTGGAGCGCATGCAGACCTATCAGGACGCG
GAGTCGAGGCAGGTGCTGGCTGCCTGGATGAAAGAGCGGCAGGAGCTGAGGTGCATCACCAAGGCCCTGTTCAATGCGCAGTTCGGCAGC
ATCTTCCGCACCTTCCACAACCCCACCTACTTCTCAAGGCGCCTCGTGCGCTTCTCTGACCTCTACATGGCCTCCCTCAGCTGCCTGCTC
AACTACCGCGTGGACTTCACCTTCTACCCACGCCGTACGCCGCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTCTGCACCGGCTGC


Top

FusionGenePPI for PBRM1_NT5DC2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PBRM1ARID1A, SMARCC2, SMARCC1, SMARCE1, HIST1H3A, HIST1H4A, HIST2H2BE, HIST2H2AC, CHD7, ARID2, SMARCD1, ACTL6A, SMARCB1, SMARCA4, SMARCAD1, HIST3H3, SIRT7, CALML5, APP, GTF3C5, TCHHL1, NOTCH1, MAML1, ZNF512B, HECW2, CDC20, ZDHHC17, OBSL1, EED, DPF3, NUP50, COPS3, BRD7, SCARNA22, IFI16, HIST1H3E, DPPA4, NANOG, POU5F1, TOP1, HDAC6, VHL, BCL7C, BCL7A, ZBTB48, UHRF2, BRD1NT5DC2TERF2, TOLLIP, CUL3, EGFR, NTRK1, HSPB2, TSNAX, MCM2, POU5F1, C7orf55, LYRM5, XPNPEP3, CISD3, COQ9, NME4, ATOH1, DUSP13, KLHDC9, NT5DC3, POLDIP2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PBRM1_NT5DC2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PBRM1_NT5DC2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePBRM1C0005586Bipolar Disorder3PSYGENET
HgenePBRM1C0007134Renal Cell Carcinoma2CTD_human
HgenePBRM1C0033975Psychotic Disorders1PSYGENET
HgenePBRM1C0036341Schizophrenia1PSYGENET
HgenePBRM1C0040100Thymoma1CTD_human
HgenePBRM1C0206698Cholangiocarcinoma1CTD_human
HgenePBRM1C0349204Nonorganic psychosis1PSYGENET