FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2608

FusionGeneSummary for ARID1A_HNRNPK

check button Fusion gene summary
Fusion gene informationFusion gene name: ARID1A_HNRNPK
Fusion gene ID: 2608
HgeneTgene
Gene symbol

ARID1A

HNRNPK

Gene ID

8289

3190

Gene nameAT-rich interaction domain 1Aheterogeneous nuclear ribonucleoprotein K
SynonymsB120|BAF250|BAF250a|BM029|C1orf4|CSS2|ELD|MRD14|OSA1|P270|SMARCF1|hELD|hOSA1AUKS|CSBP|HNRPK|TUNP
Cytomap

1p36.11

9q21.32

Type of geneprotein-codingprotein-coding
DescriptionAT-rich interactive domain-containing protein 1AARID domain-containing protein 1AAT rich interactive domain 1A (SWI-like)BRG1-associated factor 250aOSA1 nuclear proteinSWI-like proteinSWI/SNF complex protein p270SWI/SNF-related, matrix-associated, heterogeneous nuclear ribonucleoprotein KdC-stretch binding proteintransformation upregulated nuclear protein
Modification date2018051920180522
UniProtAcc

O14497

P61978

Ensembl transtripts involved in fusion geneENST00000324856, ENST00000457599, 
ENST00000374152, ENST00000540690, 
ENST00000376281, ENST00000376263, 
ENST00000376264, ENST00000351839, 
ENST00000360384, 
Fusion gene scores* DoF score21 X 13 X 13=35494 X 4 X 2=32
# samples 314
** MAII scorelog2(31/3549*10)=-3.51707245378671
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ARID1A [Title/Abstract] AND HNRNPK [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARID1A

GO:0006337

nucleosome disassembly

8895581

HgeneARID1A

GO:0006338

chromatin remodeling

11726552

HgeneARID1A

GO:0030520

intracellular estrogen receptor signaling pathway

12200431

HgeneARID1A

GO:0030521

androgen receptor signaling pathway

12200431

HgeneARID1A

GO:0042921

glucocorticoid receptor signaling pathway

12200431

HgeneARID1A

GO:0045893

positive regulation of transcription, DNA-templated

12200431


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-BT-A20W-01AARID1Achr1

27059283

+HNRNPKchr9

86584355

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000324856ENST00000376281ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
In-frameENST00000324856ENST00000376263ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
5CDS-intronENST00000324856ENST00000376264ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
5CDS-intronENST00000324856ENST00000351839ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
5CDS-intronENST00000324856ENST00000360384ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
Frame-shitENST00000457599ENST00000376281ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
In-frameENST00000457599ENST00000376263ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
5CDS-intronENST00000457599ENST00000376264ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
5CDS-intronENST00000457599ENST00000351839ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
5CDS-intronENST00000457599ENST00000360384ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
Frame-shitENST00000374152ENST00000376281ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
In-frameENST00000374152ENST00000376263ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
5CDS-intronENST00000374152ENST00000376264ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
5CDS-intronENST00000374152ENST00000351839ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
5CDS-intronENST00000374152ENST00000360384ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
intron-3CDSENST00000540690ENST00000376281ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
intron-3CDSENST00000540690ENST00000376263ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
intron-intronENST00000540690ENST00000376264ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
intron-intronENST00000540690ENST00000351839ARID1Achr1

27059283

+HNRNPKchr9

86584355

-
intron-intronENST00000540690ENST00000360384ARID1Achr1

27059283

+HNRNPKchr9

86584355

-

Top

FusionProtFeatures for ARID1A_HNRNPK


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARID1A

O14497

HNRNPK

P61978


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ARID1A_HNRNPK


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARID1A_ENST00000324856_chr1_27059283_+_HNRNPK_ENST00000376263_chr9_86584355_-_651aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL

>In-frame_ARID1A_ENST00000457599_chr1_27059283_+_HNRNPK_ENST00000376263_chr9_86584355_-_651aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL

>In-frame_ARID1A_ENST00000374152_chr1_27059283_+_HNRNPK_ENST00000376263_chr9_86584355_-_268aa
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARID1A_ENST00000324856_chr1_27059283_+_HNRNPK_ENST00000376263_chr9_86584355_-_1954nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG

>In-frame_ARID1A_ENST00000457599_chr1_27059283_+_HNRNPK_ENST00000376263_chr9_86584355_-_1954nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG

>In-frame_ARID1A_ENST00000374152_chr1_27059283_+_HNRNPK_ENST00000376263_chr9_86584355_-_805nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARID1A_ENST00000324856_chr1_27059283_+_HNRNPK_ENST00000376263_chr9_86584355_-_3648nt
GAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGGCAAGGGCTTGGGGGGAATGAG
CCGGGAGAGCCGGGTCCCGAGCCTACAGAGCCGGGAGCAGCTGAGCCGCCGGCGCCTCGGCCGCCGCCGCCGCCTCCTCCTCCTCCGCCG
CCGCCAGCCCGGAGCCTGAGCCGGCGGGGCGGGGGGGAGAGGAGCGAGCGCAGCGCAGCAGCGGAGCCCCGCGAGGCCCGCCCGGGCGGG
TGGGGAGGGCAGCCCGGGGGACTGGGCCCCGGGGCGGGGTGGGAGGGGGGGAGAAGACGAAGACAGGGCCGGGTCTCTCCGCGGACGAGA
CAGCGGGGATCATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAG
CCGAGCAGCAGCAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGG
AAAGCGAGGGCCCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCG
GAGCCGGCAGCGGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACC
TCACGGAGCCGCCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAG
CCTACGGCTTCGGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAAC
AAAGCCCTGGCCTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCT
TCCCCAACCACCAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTG
GCACTCCGGGCTCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCG
CTCAGCAGCGCTTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACC
AACTGCTCACGTCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCA
AGGGCCCGGCGGACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGA
GCCACCACGCGCCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGA
TGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGT
ACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTT
ATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTC
ACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTC
AACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCC
AGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGC
AGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCT
TCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAG
ATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTTGTGAAGCAGTATGCAGATGTTGAAGGATTCTAATGCAAGATATTTTTT
CTTTTTTATAGTGTGAAGCAGTATTCTGGAAAGTTTTTCTAAGACTAGTGAAGAACTGAAGGAGTCCTGCATCTTTTTTTTTTTATCTGC
TTCTGTTTAAAAAGCCAACATTCCTCTGCTTCATAGGTGTTCTGCATTTGAGGTGTAGTGAAATCTTTGCTGTTCACCAGATGTAATGTT
TTAGTTCCTTACAAACAGGGTTGGGGGGGGGAAGGGCGTGCAAAAACTAACATTGAAATTTTGAAACAGCAGCAGAGTGAGTGGATTTTA
TTTTTCGTTATTGTTGGTGGTTTAAAAAATTCCCCCCATGTAATTATTGTGAACACCTTGCTTTGTGGTCACTGTAACATTTGGGGGGTG
GGACAGGGAGGAAAAGTAACAATAGTCCACATGTCCCTGGCATCTGTTCAGAGCAGTGTGCAGAATGTAATGCTCTTTTGTAAGAAACGT
TTTATGATTTTTAAAATAAATTTAGTGAACCTATTTTTGGTGGTCATTTTTTTTTTAAGACAGTCATTTTAAAATGGTGGCTGAATTTCC
CAACCCACCCCCAAACTAAACACTAAGTTTAATTTTCAGCTCCTCTGTTGGACATATAAGTGCATCTCTTGTTGGACATAGGCAAAATAA
CTTGGCAAACTTAGTTCTGGTGATTTCTTGATGGTTTGGAAGTCTATTGCTGGGAAGAAATTCCATCATACATATTCATGCTTATAATAA
GCTGGGGATTTTTTGTTTGTTTTTGCAAATGCTTGCCCCTACTTTTCAACAATTTTCTATGTTAGTTGTGAAGAACTAAGGTGGGGAGCA
GTACTACAAGTTGAGTAATGGTATGAGTATATACCAGAATTCTGATTGGCAGCAAGTTTTATTAATCAGAATAACACTTGGTTATGGAAG
TGACTAATGCTGAAAAAATTGATTATTTTTATTAGATAATTTCTCACCTATAGACTTAAACTGTCAATTTGCTCTAGTGTCTTATTAGTT
AAACTTTGTAAAATATATATATACTTGTTTTTCCATTGTATGCAAATTGAAAGAAAAAGATGTACCATTTCTCTGTTGTATGTTGGATTA
TGTAGGAAATGTTTGTGTACAATTCAAAAAAAAAAAAGATGAAAAAAGTTCCTGTGGATGTTTTGTGTAGTATCTTGGCATTTGTATTGA
TAGTTAAAATTCACTTCCAAATAAATAAAACACCCATGATGCTAGATTTGATGTGTGCCCGATTTGAACAAGGGTTGATTGACACCTGTA

>In-frame_ARID1A_ENST00000457599_chr1_27059283_+_HNRNPK_ENST00000376263_chr9_86584355_-_3277nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTTGTGAAGCAGTATGCAGATGTTGAAGGATTCTAATGCAAGATATTTTTTCTTTTTTATAG
TGTGAAGCAGTATTCTGGAAAGTTTTTCTAAGACTAGTGAAGAACTGAAGGAGTCCTGCATCTTTTTTTTTTTATCTGCTTCTGTTTAAA
AAGCCAACATTCCTCTGCTTCATAGGTGTTCTGCATTTGAGGTGTAGTGAAATCTTTGCTGTTCACCAGATGTAATGTTTTAGTTCCTTA
CAAACAGGGTTGGGGGGGGGAAGGGCGTGCAAAAACTAACATTGAAATTTTGAAACAGCAGCAGAGTGAGTGGATTTTATTTTTCGTTAT
TGTTGGTGGTTTAAAAAATTCCCCCCATGTAATTATTGTGAACACCTTGCTTTGTGGTCACTGTAACATTTGGGGGGTGGGACAGGGAGG
AAAAGTAACAATAGTCCACATGTCCCTGGCATCTGTTCAGAGCAGTGTGCAGAATGTAATGCTCTTTTGTAAGAAACGTTTTATGATTTT
TAAAATAAATTTAGTGAACCTATTTTTGGTGGTCATTTTTTTTTTAAGACAGTCATTTTAAAATGGTGGCTGAATTTCCCAACCCACCCC
CAAACTAAACACTAAGTTTAATTTTCAGCTCCTCTGTTGGACATATAAGTGCATCTCTTGTTGGACATAGGCAAAATAACTTGGCAAACT
TAGTTCTGGTGATTTCTTGATGGTTTGGAAGTCTATTGCTGGGAAGAAATTCCATCATACATATTCATGCTTATAATAAGCTGGGGATTT
TTTGTTTGTTTTTGCAAATGCTTGCCCCTACTTTTCAACAATTTTCTATGTTAGTTGTGAAGAACTAAGGTGGGGAGCAGTACTACAAGT
TGAGTAATGGTATGAGTATATACCAGAATTCTGATTGGCAGCAAGTTTTATTAATCAGAATAACACTTGGTTATGGAAGTGACTAATGCT
GAAAAAATTGATTATTTTTATTAGATAATTTCTCACCTATAGACTTAAACTGTCAATTTGCTCTAGTGTCTTATTAGTTAAACTTTGTAA
AATATATATATACTTGTTTTTCCATTGTATGCAAATTGAAAGAAAAAGATGTACCATTTCTCTGTTGTATGTTGGATTATGTAGGAAATG
TTTGTGTACAATTCAAAAAAAAAAAAGATGAAAAAAGTTCCTGTGGATGTTTTGTGTAGTATCTTGGCATTTGTATTGATAGTTAAAATT
CACTTCCAAATAAATAAAACACCCATGATGCTAGATTTGATGTGTGCCCGATTTGAACAAGGGTTGATTGACACCTGTAAAATTTGTTGA

>In-frame_ARID1A_ENST00000374152_chr1_27059283_+_HNRNPK_ENST00000376263_chr9_86584355_-_2411nt
TGGATCTCAAGCAGTACCACAGTTACAAAGTAGTTTTTAGCTTACAAGGTGTTTTCACAAATAGGTGGTATTTTCATTTTTCAAATGACA
AAATTAGGGTTCTGAGGCGGGTCAGTTGACTTAAAGGTTACTAGGTTGGTCTCATTGCTCTTTCAAAGTAACTGTATTTCTTTATAGCAT
ACAGACTAAAAAAACCTGTGTACTTGGGTTATATATTCAGTGGCCAGAGGCCATCAAAGCTCAGGTTAATGAAATGCTCTTTATTTTGTA
GCCATCCAGTCCAATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTC
AGGACCGCAGCAAGGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCA
GAGTGCCATGGGCGGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCC
ATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTC
GTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCA
GTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCC
TTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCA
AACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGAC
CTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTTGTGAAGCAGTATGCAGATGTTGAAG
GATTCTAATGCAAGATATTTTTTCTTTTTTATAGTGTGAAGCAGTATTCTGGAAAGTTTTTCTAAGACTAGTGAAGAACTGAAGGAGTCC
TGCATCTTTTTTTTTTTATCTGCTTCTGTTTAAAAAGCCAACATTCCTCTGCTTCATAGGTGTTCTGCATTTGAGGTGTAGTGAAATCTT
TGCTGTTCACCAGATGTAATGTTTTAGTTCCTTACAAACAGGGTTGGGGGGGGGAAGGGCGTGCAAAAACTAACATTGAAATTTTGAAAC
AGCAGCAGAGTGAGTGGATTTTATTTTTCGTTATTGTTGGTGGTTTAAAAAATTCCCCCCATGTAATTATTGTGAACACCTTGCTTTGTG
GTCACTGTAACATTTGGGGGGTGGGACAGGGAGGAAAAGTAACAATAGTCCACATGTCCCTGGCATCTGTTCAGAGCAGTGTGCAGAATG
TAATGCTCTTTTGTAAGAAACGTTTTATGATTTTTAAAATAAATTTAGTGAACCTATTTTTGGTGGTCATTTTTTTTTTAAGACAGTCAT
TTTAAAATGGTGGCTGAATTTCCCAACCCACCCCCAAACTAAACACTAAGTTTAATTTTCAGCTCCTCTGTTGGACATATAAGTGCATCT
CTTGTTGGACATAGGCAAAATAACTTGGCAAACTTAGTTCTGGTGATTTCTTGATGGTTTGGAAGTCTATTGCTGGGAAGAAATTCCATC
ATACATATTCATGCTTATAATAAGCTGGGGATTTTTTGTTTGTTTTTGCAAATGCTTGCCCCTACTTTTCAACAATTTTCTATGTTAGTT
GTGAAGAACTAAGGTGGGGAGCAGTACTACAAGTTGAGTAATGGTATGAGTATATACCAGAATTCTGATTGGCAGCAAGTTTTATTAATC
AGAATAACACTTGGTTATGGAAGTGACTAATGCTGAAAAAATTGATTATTTTTATTAGATAATTTCTCACCTATAGACTTAAACTGTCAA
TTTGCTCTAGTGTCTTATTAGTTAAACTTTGTAAAATATATATATACTTGTTTTTCCATTGTATGCAAATTGAAAGAAAAAGATGTACCA
TTTCTCTGTTGTATGTTGGATTATGTAGGAAATGTTTGTGTACAATTCAAAAAAAAAAAAGATGAAAAAAGTTCCTGTGGATGTTTTGTG
TAGTATCTTGGCATTTGTATTGATAGTTAAAATTCACTTCCAAATAAATAAAACACCCATGATGCTAGATTTGATGTGTGCCCGATTTGA


Top

FusionGenePPI for ARID1A_HNRNPK


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARID1AKLF1, GATA1, SMARCB1, SMARCA4, SMARCA2, ING1, SMARCE1, PBRM1, SMARCC2, SMARCC1, PGR, BCL7C, HIC1, CUL2, ARID1B, SMAD2, SMAD3, CARM1, ADNP, RARA, SOX2, CHD7, SMARCD1, TP53, ELAVL1, SIRT7, TFAP4, CUL3, SMARCD2, ACTL6A, SMARCD3, PHF10, ECT2, YAP1, ITCH, NEDD4, SHMT2, MOV10, NXF1, EED, DPF3, DPF2, SS18, UNK, BCL7A, BCL7B, ESR1, NCOA1, RARB, RARG, EWSR1, SNW1, CDC5L, CUL1, SKP1, NFATC1, NFATC2, TOP1, CHEK1, VHL, EYA2, NR3C1, AR, ALDH2, TRIM25HNRNPKRBM41, CNNM3, GRAP2, HNRNPK, MATR3, RBM42, RBM7, NPDC1, KHDRBS3, KHDRBS2, RBMX, QKI, SORBS3, UBE2I, NCK2, DIDO1, PRMT1, DDX1, PCBP2, PTBP1, HNRNPL, CSK, VAV1, CEBPB, HMGB1, KHDRBS1, ITK, MEPCE, CDK9, HNRNPA1, HNRNPH1, TCEA2, GRB2, H3F3A, EMD, MORF4L1, MORF4L2, MRGBP, UBC, MYC, POU5F1, PABPC1, TOP1, VHL, SMARCAD1, SREK1, SIRT1, MBNL1, ITSN2, SF3A2, ARRB1, ARRB2, SH3KBP1, ISG15, TERF2IP, CBX4, MDM2, CUL3, CUL4B, CUL5, CUL2, CDK2, CUL1, COPS5, DCUN1D1, CAND1, NEDD8, EIF3F, RNA28S5, RNA18S5, GFI1B, PCBP1, LRRK1, CBLB, SF3B3, HNRNPU, YBX1, SF3B1, HNRNPR, HNRNPA3, SRSF1, HNRNPF, EFTUD2, SNRPD1, SF3A1, HNRNPM, U2AF2, NHP2L1, SNRNP70, SRSF11, ILF3, SYNCRIP, EEF1A1, HNRNPA0, SRRM2, TARDBP, DHX15, SUPT5H, RANBP2, GTF3C4, TNKS1BP1, TPM4, SART3, USP14, IDH3G, GAA, RAB7A, NXF1, HSPA4, RPS7, SPTAN1, RCC1, CAMK2A, MRPL23, ESR1, MAGOH, EIF4A3, TP53, SUMO1, PIAS3, SENP2, SMURF1, GZMK, GZMA, PPP1R10, FN1, VCAM1, SNRPA, CCAR1, RBM10, SF1, ELAVL1, SRRT, RALY, CTNNBL1, DDX17, DDX5, DHX9, CIRBP, RBM4, HNRNPD, RBFOX2, TP63, UBL4A, ITGA4, CTNNB1, CD81, IGSF8, ICAM1, LYN, ADRB2, BAG3, BTRC, SMAD3, PELI2, CDKN1A, YWHAQ, FBXO6, PARK2, TCERG1, PRPF40A, WBP4, APBB1, NEDD4, PIN1, WWOX, APEX1, EIF5, FERMT2, UBFD1, XPO1, YWHAH, NAPRT, NCL, RPA1, RPA2, RPA3, ASB2, LGR4, IVNS1ABP, STAU1, HUWE1, FUS, AQP5, DOCK2, RBM3, RBMY1A1, SPG7, TYK2, U2AF1, ABI2, PRPF31, RASD1, DALRD3, PCDHB14, MARK4, FBXL18, CCDC33, PRR3, YTHDC1, HNRNPLL, ZNF792, RBMY1F, ZFC3H1, ZNF385C, RTP5, C6orf226, ZNRF2P1, HIST3H3, CUL7, OBSL1, EED, PA2G4, SUMO2, SIRT6, RPS6KB2, CARM1, ACLY, EEF1D, ELAC2, HGS, PKM, RPS5, TUBA4A, UQCRC2, NPLOC4, PDIA3, SEPT2, VCP, XRCC6, NTRK1, SCARNA22, SRPK2, CMTM5, HIST1H3E, AHSA1, HNRNPH2, SEC16A, CRY1, CRY2, MCM2, SNW1, CDC5L, RC3H1, SRC, AURKA, CDC73, CRBN, WWP2, CDH1, EGFR, SNX33, FNBP1L, CASP2, KLHL23, TRMT1L, SNX9, PRMT8, TRMT61B, PLCG1, YARS2, CYLD, HEY1, BRCA1, LMNA, DCAF4L2, FBXW7, HDAC6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARID1A_HNRNPK


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneHNRNPKP61978DB11638ArtenimolHeterogeneous nuclear ribonucleoprotein Ksmall moleculeapproved|investigational

Top

RelatedDiseases for ARID1A_HNRNPK


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneARID1AC0038356Stomach Neoplasms3CTD_human
HgeneARID1AC2239176Liver carcinoma3CTD_human
HgeneARID1AC0001418Adenocarcinoma1CTD_human
HgeneARID1AC0005695Bladder Neoplasm1CTD_human
HgeneARID1AC0006413Burkitt Lymphoma1CTD_human
HgeneARID1AC0007138Carcinoma, Transitional Cell1CTD_human
HgeneARID1AC0010606Adenoid Cystic Carcinoma1CTD_human
HgeneARID1AC0014170Endometrial Neoplasms1CTD_human
HgeneARID1AC0027819Neuroblastoma1CTD_human
HgeneARID1AC0036920Sezary Syndrome1CTD_human
HgeneARID1AC0079772T-Cell Lymphoma1CTD_human
HgeneARID1AC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
HgeneARID1AC0206698Cholangiocarcinoma1CTD_human
HgeneARID1AC0265338Coffin-Siris syndrome1CTD_human;ORPHANET
HgeneARID1AC0279628Adenocarcinoma Of Esophagus1CTD_human
HgeneARID1AC0920269Microsatellite Instability1CTD_human
HgeneARID1AC2931822Nasopharyngeal carcinoma1CTD_human
TgeneHNRNPKC1458155Mammary Neoplasms1CTD_human