FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26067

FusionGeneSummary for PAWR_PTPRR

check button Fusion gene summary
Fusion gene informationFusion gene name: PAWR_PTPRR
Fusion gene ID: 26067
HgeneTgene
Gene symbol

PAWR

PTPRR

Gene ID

5074

5801

Gene namepro-apoptotic WT1 regulatorprotein tyrosine phosphatase, receptor type R
SynonymsPAR4|Par-4EC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQ
Cytomap

12q21.2

12q15

Type of geneprotein-codingprotein-coding
DescriptionPRKC apoptosis WT1 regulator proteinPRKC, apoptosis, WT1, regulatorWT1-interacting proteinprostate apoptosis response protein 4prostate apoptosis response protein PAR-4prostate apoptosis response-4transcriptional repressor PAR4receptor-type tyrosine-protein phosphatase RCh-1 PTPaseNC-PTPCOM1R-PTP-Rch-1PTPaseprotein tyrosine phosphatase Cr1PTPaseprotein-tyrosine phosphatase NC-PTPCOM1protein-tyrosine phosphatase PCPTP1
Modification date2018052320180519
UniProtAcc

Q96IZ0

Q15256

Ensembl transtripts involved in fusion geneENST00000328827, ENST00000547571, 
ENST00000283228, ENST00000440835, 
ENST00000537619, ENST00000378778, 
ENST00000342084, ENST00000549308, 
Fusion gene scores* DoF score4 X 1 X 3=1233 X 13 X 10=4290
# samples 431
** MAII scorelog2(4/12*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(31/4290*10)=-3.79063752711267
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PAWR [Title/Abstract] AND PTPRR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-B6-A408-01APAWRchr12

80083509

-PTPRRchr12

71092129

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000328827ENST00000283228PAWRchr12

80083509

-PTPRRchr12

71092129

-
In-frameENST00000328827ENST00000440835PAWRchr12

80083509

-PTPRRchr12

71092129

-
5CDS-intronENST00000328827ENST00000537619PAWRchr12

80083509

-PTPRRchr12

71092129

-
5CDS-intronENST00000328827ENST00000378778PAWRchr12

80083509

-PTPRRchr12

71092129

-
5CDS-intronENST00000328827ENST00000342084PAWRchr12

80083509

-PTPRRchr12

71092129

-
5CDS-intronENST00000328827ENST00000549308PAWRchr12

80083509

-PTPRRchr12

71092129

-
5UTR-3CDSENST00000547571ENST00000283228PAWRchr12

80083509

-PTPRRchr12

71092129

-
5UTR-3CDSENST00000547571ENST00000440835PAWRchr12

80083509

-PTPRRchr12

71092129

-
5UTR-intronENST00000547571ENST00000537619PAWRchr12

80083509

-PTPRRchr12

71092129

-
5UTR-intronENST00000547571ENST00000378778PAWRchr12

80083509

-PTPRRchr12

71092129

-
5UTR-intronENST00000547571ENST00000342084PAWRchr12

80083509

-PTPRRchr12

71092129

-
5UTR-intronENST00000547571ENST00000549308PAWRchr12

80083509

-PTPRRchr12

71092129

-

Top

FusionProtFeatures for PAWR_PTPRR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PAWR

Q96IZ0

PTPRR

Q15256

Pro-apoptopic protein capable of selectively inducingapoptosis in cancer cells, sensitizing the cells to diverseapoptotic stimuli and causing regression of tumors in animalmodels. Induces apoptosis in certain cancer cells by activation ofthe Fas prodeath pathway and coparallel inhibition of NF-kappa-Btranscriptional activity. Inhibits the transcriptional activationand augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction withWT1. Seems also to be a transcriptional repressor by itself. Maybe directly involved in regulating the amyloid precursor protein(APP) cleavage activity of BACE1. {ECO:0000269|PubMed:11585763}. Sequesters mitogen-activated protein kinases (MAPKs)such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactiveform. The MAPKs bind to a dephosphorylated kinase interactingmotif, phosphorylation of which by the protein kinase A complexreleases the MAPKs for activation and translocation into thenucleus (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePAWRchr12:80083509chr12:71092129ENST00000328827-2749_120172341Compositional biasNote=Ala-rich
HgenePAWRchr12:80083509chr12:71092129ENST00000328827-27145_161172341MotifNuclear localization signal
HgenePAWRchr12:80083509chr12:71092129ENST00000328827-2768_72172341MotifB30.2/SPRY domain-binding motif
TgenePTPRRchr12:80083509chr12:71092129ENST00000342084-513393_647286546DomainTyrosine-protein phosphatase
TgenePTPRRchr12:80083509chr12:71092129ENST00000378778-311393_647192452DomainTyrosine-protein phosphatase
TgenePTPRRchr12:80083509chr12:71092129ENST00000440835-210393_647153413DomainTyrosine-protein phosphatase
TgenePTPRRchr12:80083509chr12:71092129ENST00000549308-311393_647153413DomainTyrosine-protein phosphatase
TgenePTPRRchr12:80083509chr12:71092129ENST00000283228-614588_594398658RegionSubstrate binding
TgenePTPRRchr12:80083509chr12:71092129ENST00000342084-513588_594286546RegionSubstrate binding
TgenePTPRRchr12:80083509chr12:71092129ENST00000378778-311588_594192452RegionSubstrate binding
TgenePTPRRchr12:80083509chr12:71092129ENST00000440835-210588_594153413RegionSubstrate binding
TgenePTPRRchr12:80083509chr12:71092129ENST00000549308-311588_594153413RegionSubstrate binding
TgenePTPRRchr12:80083509chr12:71092129ENST00000378778-311249_657192452Topological domainCytoplasmic
TgenePTPRRchr12:80083509chr12:71092129ENST00000440835-210249_657153413Topological domainCytoplasmic
TgenePTPRRchr12:80083509chr12:71092129ENST00000549308-311249_657153413Topological domainCytoplasmic
TgenePTPRRchr12:80083509chr12:71092129ENST00000378778-311228_248192452TransmembraneHelical
TgenePTPRRchr12:80083509chr12:71092129ENST00000440835-210228_248153413TransmembraneHelical
TgenePTPRRchr12:80083509chr12:71092129ENST00000549308-311228_248153413TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePAWRchr12:80083509chr12:71092129ENST00000328827-27186_206172341Coiled coilOntology_term=ECO:0000255
HgenePAWRchr12:80083509chr12:71092129ENST00000328827-27145_203172341RegionNote=Selective for apoptosis induction in cancer cells (SAC)
HgenePAWRchr12:80083509chr12:71092129ENST00000328827-27300_340172341RegionNote=Leucine-zipper
TgenePTPRRchr12:80083509chr12:71092129ENST00000283228-614393_647398658DomainTyrosine-protein phosphatase
TgenePTPRRchr12:80083509chr12:71092129ENST00000283228-61422_227398658Topological domainExtracellular
TgenePTPRRchr12:80083509chr12:71092129ENST00000283228-614249_657398658Topological domainCytoplasmic
TgenePTPRRchr12:80083509chr12:71092129ENST00000342084-51322_227286546Topological domainExtracellular
TgenePTPRRchr12:80083509chr12:71092129ENST00000342084-513249_657286546Topological domainCytoplasmic
TgenePTPRRchr12:80083509chr12:71092129ENST00000378778-31122_227192452Topological domainExtracellular
TgenePTPRRchr12:80083509chr12:71092129ENST00000440835-21022_227153413Topological domainExtracellular
TgenePTPRRchr12:80083509chr12:71092129ENST00000549308-31122_227153413Topological domainExtracellular
TgenePTPRRchr12:80083509chr12:71092129ENST00000283228-614228_248398658TransmembraneHelical
TgenePTPRRchr12:80083509chr12:71092129ENST00000342084-513228_248286546TransmembraneHelical


Top

FusionGeneSequence for PAWR_PTPRR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PAWR_ENST00000328827_chr12_80083509_-_PTPRR_ENST00000283228_chr12_71092129_-_432aa
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVN
CAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAEEIPMNFVD
PKEIDIPRHGTKNRTKTILPNPLSRVCLRPKNVTDSLSTYINANTIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKE
KNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVV

>In-frame_PAWR_ENST00000328827_chr12_80083509_-_PTPRR_ENST00000440835_chr12_71092129_-_432aa
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVN
CAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAEEIPMNFVD
PKEIDIPRHGTKNRTKTILPNPLSRVCLRPKNVTDSLSTYINANTIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKE
KNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PAWR_ENST00000328827_chr12_80083509_-_PTPRR_ENST00000283228_chr12_71092129_-_1296nt
ATGGCGACCGGTGGCTACCGGACCAGCAGCGGCCTCGGCGGCAGCACCACAGACTTCCTGGAGGAGTGGAAGGCGAAACGCGAGAAGATG
CGCGCCAAGCAGAACCCCCCGGGCCCGGCCCCCCCGGGAGGGGGCAGCAGCGACGCCGCTGGGAAGCCCCCCGCGGGGGCTCTGGGCACC
CCGGCGGCCGCCGCTGCCAACGAGCTCAACAACAACCTCCCGGGCGGCGCGCCGGCCGCACCTGCCGTCCCCGGTCCCGGGGGCGTGAAC
TGCGCGGTCGGCTCCGCCATGCTGACGCGGGCGGCCCCCGGCCCGCGGCGGTCGGAGGACGAGCCCCCAGCCGCCTCTGCCTCGGCTGCA
CCGCCGCCCCAGCGTGACGAGGAGGAGCCGGACGGCGTCCCAGAGAAGGGCAAGAGCTCGGGCCCCAGTGCCAGGAAAGGCAAGGGGCAG
ATCGAGAAGAGGAAGCTGCGGGAGAAGCGGCGCTCCACCGGCGTGGTCAACATCCCTGCCGCAGAGGAAATACCAATGAACTTTGTGGAT
CCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCA
AAAAATGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAG
GGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAA
AAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGAT
AACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAG
ACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTC
CACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCA
CTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTG

>In-frame_PAWR_ENST00000328827_chr12_80083509_-_PTPRR_ENST00000440835_chr12_71092129_-_1296nt
ATGGCGACCGGTGGCTACCGGACCAGCAGCGGCCTCGGCGGCAGCACCACAGACTTCCTGGAGGAGTGGAAGGCGAAACGCGAGAAGATG
CGCGCCAAGCAGAACCCCCCGGGCCCGGCCCCCCCGGGAGGGGGCAGCAGCGACGCCGCTGGGAAGCCCCCCGCGGGGGCTCTGGGCACC
CCGGCGGCCGCCGCTGCCAACGAGCTCAACAACAACCTCCCGGGCGGCGCGCCGGCCGCACCTGCCGTCCCCGGTCCCGGGGGCGTGAAC
TGCGCGGTCGGCTCCGCCATGCTGACGCGGGCGGCCCCCGGCCCGCGGCGGTCGGAGGACGAGCCCCCAGCCGCCTCTGCCTCGGCTGCA
CCGCCGCCCCAGCGTGACGAGGAGGAGCCGGACGGCGTCCCAGAGAAGGGCAAGAGCTCGGGCCCCAGTGCCAGGAAAGGCAAGGGGCAG
ATCGAGAAGAGGAAGCTGCGGGAGAAGCGGCGCTCCACCGGCGTGGTCAACATCCCTGCCGCAGAGGAAATACCAATGAACTTTGTGGAT
CCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCA
AAAAATGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAG
GGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAA
AAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGAT
AACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAG
ACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTC
CACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCA
CTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PAWR_ENST00000328827_chr12_80083509_-_PTPRR_ENST00000283228_chr12_71092129_-_2771nt
TTTTCCGCTCGTGCTTCGGCGCCGCTCGGCTCCCTTCCCGCCCCTGGCTCCCTCCCTCCCTCCCTCCCTCCTTCTTCTCCCTCCCTCCTG
TCCTGGGATTGCCTGGAGCTCCGCACCGCGAGTTTGCCGCGGCACTTTCCGCGCGGCGGAAGAGCGCGCGCCAGCTTCGGCACACCTGGG
AGCCGGATCCCAGCCCTACGCCTCGTCCCCTACAAGCTCCTCCAAGCCCCGCCGGCTGCTGTGGGAGCGGCGGCCGTCCCTCTCCTGGAG
GTCGTCTCCTGGCATCCTCGGGGCCGCAGGAAGGAAGAGGAGGCAGCGGCCGGAGCCCTGGTGGGCGGCCTGAGGTGAGAGCCCGACCGG
CCCCTTTGGGAATATGGCGACCGGTGGCTACCGGACCAGCAGCGGCCTCGGCGGCAGCACCACAGACTTCCTGGAGGAGTGGAAGGCGAA
ACGCGAGAAGATGCGCGCCAAGCAGAACCCCCCGGGCCCGGCCCCCCCGGGAGGGGGCAGCAGCGACGCCGCTGGGAAGCCCCCCGCGGG
GGCTCTGGGCACCCCGGCGGCCGCCGCTGCCAACGAGCTCAACAACAACCTCCCGGGCGGCGCGCCGGCCGCACCTGCCGTCCCCGGTCC
CGGGGGCGTGAACTGCGCGGTCGGCTCCGCCATGCTGACGCGGGCGGCCCCCGGCCCGCGGCGGTCGGAGGACGAGCCCCCAGCCGCCTC
TGCCTCGGCTGCACCGCCGCCCCAGCGTGACGAGGAGGAGCCGGACGGCGTCCCAGAGAAGGGCAAGAGCTCGGGCCCCAGTGCCAGGAA
AGGCAAGGGGCAGATCGAGAAGAGGAAGCTGCGGGAGAAGCGGCGCTCCACCGGCGTGGTCAACATCCCTGCCGCAGAGGAAATACCAAT
GAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGT
GTGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTT
CATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCAC
AAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGT
AAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATG
GCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGG
GCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGG
AGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCA
TGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGAT
TAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGT
GGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTT
GATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTA
TGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCA
AAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTA
AAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAA
ATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATAT
ATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTT
AAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATG
CTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACA
TTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGT

>In-frame_PAWR_ENST00000328827_chr12_80083509_-_PTPRR_ENST00000440835_chr12_71092129_-_2780nt
TTTTCCGCTCGTGCTTCGGCGCCGCTCGGCTCCCTTCCCGCCCCTGGCTCCCTCCCTCCCTCCCTCCCTCCTTCTTCTCCCTCCCTCCTG
TCCTGGGATTGCCTGGAGCTCCGCACCGCGAGTTTGCCGCGGCACTTTCCGCGCGGCGGAAGAGCGCGCGCCAGCTTCGGCACACCTGGG
AGCCGGATCCCAGCCCTACGCCTCGTCCCCTACAAGCTCCTCCAAGCCCCGCCGGCTGCTGTGGGAGCGGCGGCCGTCCCTCTCCTGGAG
GTCGTCTCCTGGCATCCTCGGGGCCGCAGGAAGGAAGAGGAGGCAGCGGCCGGAGCCCTGGTGGGCGGCCTGAGGTGAGAGCCCGACCGG
CCCCTTTGGGAATATGGCGACCGGTGGCTACCGGACCAGCAGCGGCCTCGGCGGCAGCACCACAGACTTCCTGGAGGAGTGGAAGGCGAA
ACGCGAGAAGATGCGCGCCAAGCAGAACCCCCCGGGCCCGGCCCCCCCGGGAGGGGGCAGCAGCGACGCCGCTGGGAAGCCCCCCGCGGG
GGCTCTGGGCACCCCGGCGGCCGCCGCTGCCAACGAGCTCAACAACAACCTCCCGGGCGGCGCGCCGGCCGCACCTGCCGTCCCCGGTCC
CGGGGGCGTGAACTGCGCGGTCGGCTCCGCCATGCTGACGCGGGCGGCCCCCGGCCCGCGGCGGTCGGAGGACGAGCCCCCAGCCGCCTC
TGCCTCGGCTGCACCGCCGCCCCAGCGTGACGAGGAGGAGCCGGACGGCGTCCCAGAGAAGGGCAAGAGCTCGGGCCCCAGTGCCAGGAA
AGGCAAGGGGCAGATCGAGAAGAGGAAGCTGCGGGAGAAGCGGCGCTCCACCGGCGTGGTCAACATCCCTGCCGCAGAGGAAATACCAAT
GAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGT
GTGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTT
CATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCAC
AAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGT
AAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATG
GCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGG
GCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGG
AGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCA
TGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGAT
TAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGT
GGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTT
GATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTA
TGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCA
AAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTA
AAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAA
ATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATAT
ATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTT
AAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATG
CTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACA
TTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGT


Top

FusionGenePPI for PAWR_PTPRR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PAWRTHAP1, SLC5A7, SLC5A1, AATF, DAPK3, PRKCZ, WT1, HSPA5, FBXO25, SPSB1, SPSB2, SPSB4, SQSTM1, DRD2, PAN2, APEH, CAND1, CARS, FAM129B, H3F3A, IDE, JMJD6, ATP6V1C1, SHMT1, PPM1G, SHMT2, SNX2, SNX6, STAT1, VPS29, FBXO45, CCDC8, EED, LUZP4, DDX39A, CEP290, CEP128, MYH9, HMG20A, IKBIP, SCOC, SLC25A41, G3BP1, HDAC6PTPRRMAPK1, MAPK3, MAPK7, MAPK14, NTRK1, CEP290, EGFR, ERBB2, IGF1R, RET, MST1R, ERBB4, FGFR2, FGFR4, KDR, TEK, INSR, ALDH18A1, DHPS, PNMA2, TRIM11, KIAA0196, TBC1D5, DNAJC13, SNX6, PTPRR, MAPK1IP1L, MAPKAPK3, MAD2L1BP, CBS, MAPK11, CCT8L1P, HSPA4L, LMTK2, AATK, ERBB3, RYK, ROR1, ROR2, PTK7, EPHA2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PAWR_PTPRR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PAWR_PTPRR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePAWRC0036341Schizophrenia2PSYGENET
HgenePAWRC0041696Unipolar Depression2PSYGENET
HgenePAWRC1269683Major Depressive Disorder2PSYGENET
HgenePAWRC0001418Adenocarcinoma1CTD_human
HgenePAWRC0005586Bipolar Disorder1PSYGENET
HgenePAWRC0014170Endometrial Neoplasms1CTD_human
HgenePAWRC0033578Prostatic Neoplasms1CTD_human
HgenePAWRC0033975Psychotic Disorders1PSYGENET
HgenePAWRC0525045Mood Disorders1PSYGENET
HgenePAWRC0600427Cocaine Dependence1PSYGENET
TgenePTPRRC0041696Unipolar Depression1PSYGENET
TgenePTPRRC1269683Major Depressive Disorder1PSYGENET