FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26002

FusionGeneSummary for PARK2_LANCL1

check button Fusion gene summary
Fusion gene informationFusion gene name: PARK2_LANCL1
Fusion gene ID: 26002
HgeneTgene
Gene symbol

PARK2

LANCL1

Gene ID

10314

Gene nameLanC like 1
SynonymsGPR69A|p40
Cytomap

2q34

Type of geneprotein-coding
DescriptionlanC-like protein 140 kDa erythrocyte membrane proteinG protein-coupled receptor 69ALanC (bacterial lantibiotic synthetase component C)-like 1LanC (bacterial lantibiotic synthetase component)LanC lantibiotic synthetase component C-like 1
Modification date20180523
UniProtAcc

O43813

Ensembl transtripts involved in fusion geneENST00000366898, ENST00000366897, 
ENST00000366896, ENST00000366894, 
ENST00000338468, ENST00000366892, 
ENST00000443314, ENST00000441020, 
ENST00000450366, ENST00000233714, 
ENST00000431941, 
Fusion gene scores* DoF score4 X 2 X 3=245 X 3 X 5=75
# samples 45
** MAII scorelog2(4/24*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PARK2 [Title/Abstract] AND LANCL1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneLANCL1

GO:0007186

G-protein coupled receptor signaling pathway

10944443


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-63-7023-01APARK2chr6

163148694

-LANCL1chr2

211336800

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000366898ENST00000443314PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366898ENST00000441020PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366898ENST00000450366PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366898ENST00000233714PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366898ENST00000431941PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366897ENST00000443314PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366897ENST00000441020PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366897ENST00000450366PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366897ENST00000233714PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366897ENST00000431941PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366896ENST00000443314PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366896ENST00000441020PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366896ENST00000450366PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366896ENST00000233714PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366896ENST00000431941PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000366894ENST00000443314PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000366894ENST00000441020PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000366894ENST00000450366PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000366894ENST00000233714PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000366894ENST00000431941PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000338468ENST00000443314PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000338468ENST00000441020PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000338468ENST00000450366PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000338468ENST00000233714PARK2chr6

163148694

-LANCL1chr2

211336800

-
5UTR-3CDSENST00000338468ENST00000431941PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366892ENST00000443314PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366892ENST00000441020PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366892ENST00000450366PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366892ENST00000233714PARK2chr6

163148694

-LANCL1chr2

211336800

-
In-frameENST00000366892ENST00000431941PARK2chr6

163148694

-LANCL1chr2

211336800

-

Top

FusionProtFeatures for PARK2_LANCL1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PARK2

LANCL1

O43813

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}. May play a role in EPS8 signaling. Binds glutathione.{ECO:0000269|PubMed:19528316}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneLANCL1chr6:163148694chr2:211336800ENST00000233714-110364_36727400RegionNote=Glutathione binding
TgeneLANCL1chr6:163148694chr2:211336800ENST00000431941-110364_36727400RegionNote=Glutathione binding
TgeneLANCL1chr6:163148694chr2:211336800ENST00000441020-110364_36727400RegionNote=Glutathione binding
TgeneLANCL1chr6:163148694chr2:211336800ENST00000443314-09364_36727400RegionNote=Glutathione binding
TgeneLANCL1chr6:163148694chr2:211336800ENST00000450366-110364_36727400RegionNote=Glutathione binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePARK2chr6:163148694chr2:211336800ENST00000338468-1111_76-148275DomainUbiquitin-like
HgenePARK2chr6:163148694chr2:211336800ENST00000366894-1111_76-109275DomainUbiquitin-like
HgenePARK2chr6:163148694chr2:211336800ENST00000366896-191_762317DomainUbiquitin-like
HgenePARK2chr6:163148694chr2:211336800ENST00000366897-1111_762438DomainUbiquitin-like
HgenePARK2chr6:163148694chr2:211336800ENST00000366898-1121_762466DomainUbiquitin-like
HgenePARK2chr6:163148694chr2:211336800ENST00000338468-111204_238-148275RegionSYT11 binding 1
HgenePARK2chr6:163148694chr2:211336800ENST00000338468-111257_293-148275RegionSYT11 binding 2
HgenePARK2chr6:163148694chr2:211336800ENST00000338468-111378_410-148275RegionREP
HgenePARK2chr6:163148694chr2:211336800ENST00000366894-111204_238-109275RegionSYT11 binding 1
HgenePARK2chr6:163148694chr2:211336800ENST00000366894-111257_293-109275RegionSYT11 binding 2
HgenePARK2chr6:163148694chr2:211336800ENST00000366894-111378_410-109275RegionREP
HgenePARK2chr6:163148694chr2:211336800ENST00000366896-19204_2382317RegionSYT11 binding 1
HgenePARK2chr6:163148694chr2:211336800ENST00000366896-19257_2932317RegionSYT11 binding 2
HgenePARK2chr6:163148694chr2:211336800ENST00000366896-19378_4102317RegionREP
HgenePARK2chr6:163148694chr2:211336800ENST00000366897-111204_2382438RegionSYT11 binding 1
HgenePARK2chr6:163148694chr2:211336800ENST00000366897-111257_2932438RegionSYT11 binding 2
HgenePARK2chr6:163148694chr2:211336800ENST00000366897-111378_4102438RegionREP
HgenePARK2chr6:163148694chr2:211336800ENST00000366898-112204_2382466RegionSYT11 binding 1
HgenePARK2chr6:163148694chr2:211336800ENST00000366898-112257_2932466RegionSYT11 binding 2
HgenePARK2chr6:163148694chr2:211336800ENST00000366898-112378_4102466RegionREP
HgenePARK2chr6:163148694chr2:211336800ENST00000338468-111141_225-148275Zinc fingerNote=RING-type 0%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000338468-111238_293-148275Zinc fingerNote=RING-type 1%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000338468-111313_377-148275Zinc fingerNote=IBR-type
HgenePARK2chr6:163148694chr2:211336800ENST00000338468-111418_449-148275Zinc fingerNote=RING-type 2
HgenePARK2chr6:163148694chr2:211336800ENST00000366894-111141_225-109275Zinc fingerNote=RING-type 0%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000366894-111238_293-109275Zinc fingerNote=RING-type 1%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000366894-111313_377-109275Zinc fingerNote=IBR-type
HgenePARK2chr6:163148694chr2:211336800ENST00000366894-111418_449-109275Zinc fingerNote=RING-type 2
HgenePARK2chr6:163148694chr2:211336800ENST00000366896-19141_2252317Zinc fingerNote=RING-type 0%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000366896-19238_2932317Zinc fingerNote=RING-type 1%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000366896-19313_3772317Zinc fingerNote=IBR-type
HgenePARK2chr6:163148694chr2:211336800ENST00000366896-19418_4492317Zinc fingerNote=RING-type 2
HgenePARK2chr6:163148694chr2:211336800ENST00000366897-111141_2252438Zinc fingerNote=RING-type 0%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000366897-111238_2932438Zinc fingerNote=RING-type 1%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000366897-111313_3772438Zinc fingerNote=IBR-type
HgenePARK2chr6:163148694chr2:211336800ENST00000366897-111418_4492438Zinc fingerNote=RING-type 2
HgenePARK2chr6:163148694chr2:211336800ENST00000366898-112141_2252466Zinc fingerNote=RING-type 0%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000366898-112238_2932466Zinc fingerNote=RING-type 1%3B atypical
HgenePARK2chr6:163148694chr2:211336800ENST00000366898-112313_3772466Zinc fingerNote=IBR-type
HgenePARK2chr6:163148694chr2:211336800ENST00000366898-112418_4492466Zinc fingerNote=RING-type 2


Top

FusionGeneSequence for PARK2_LANCL1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_375aa
MIADSXVLTTLDQXDSGASSANGERPEISRPSGWHRLHWLGRYCCALLTSLXCIWGPCLPTVSTWLCKAKSELLNQALHHLPLWGCRPPG
SGRCAISQDEQXEAGRRLHHTANSPKXDXSSCSKXNALWANRLHLCSSFCQXELWSGKDSSKPYSADLXNNFNLWRKPSXEEKLHGKVST
DVXMVPGILCRGCSWPGWNLLLPDAAQPSSEPREVTXFGQAQCRLRLPAEIPFWQLPSMYRXXSRSACPLVPWRPWGNLHAHPGLXGIQR
GKVSLXCLSVCXCDLAIWVAEEGIWAVPRFCRECLCLPDTLQPHTGHEVPVXGLXVCXMVLRVWRTWMQNTRHPFLSLXRNGWNNIFPGX


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_1126nt
ATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATCAGCAGA
CCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGCCTACCT
ACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCCCCTGGC
AGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGATTGATCC
TCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAAGATTCC
TCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTCTCCACT
GATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCTTCAAGT
GAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCCATGTAT
AGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATTCAGAGA
GGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCACGGTTC
TGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGAATGGTG
CTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCTGGCTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_4467nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA
AGTTTATGAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGT
ATTACACTTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAA
GGGGACAGAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCT
TGATGCCTATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTA
ATCAAAAACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTC
TCTAAAATAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGT
ATGAATATGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCT
GACTCTTTGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTC
TGTTTAAAAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTT
TATTGAGGAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCAC
AGAATCAGGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATT
ACTGCCTTTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAA
ATGTGCCTATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTC
CTGCAGGTAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAG
GATTTAAAAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGA
TTGCTGAAGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTA
AAAGTAGTGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACT
CTACTGTGCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAA
GCATCGTGATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCT
AGTGTTCCATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAA
AATTGCAACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTA
AGCTTTTCAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATT
TTAAATTCAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTT
AAAAGGAAGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTC
CTAGAAAACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTT
CATTTATCCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCT
ATTTCCATAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAG
TTCCAATTATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTA
AATAACTGAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTT
TAGAAATAGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAA
TTCCAATTTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAAT
TATAAAGCAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTA

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_4467nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA
AGTTTATGAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGT
ATTACACTTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAA
GGGGACAGAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCT
TGATGCCTATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTA
ATCAAAAACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTC
TCTAAAATAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGT
ATGAATATGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCT
GACTCTTTGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTC
TGTTTAAAAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTT
TATTGAGGAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCAC
AGAATCAGGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATT
ACTGCCTTTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAA
ATGTGCCTATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTC
CTGCAGGTAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAG
GATTTAAAAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGA
TTGCTGAAGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTA
AAAGTAGTGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACT
CTACTGTGCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAA
GCATCGTGATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCT
AGTGTTCCATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAA
AATTGCAACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTA
AGCTTTTCAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATT
TTAAATTCAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTT
AAAAGGAAGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTC
CTAGAAAACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTT
CATTTATCCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCT
ATTTCCATAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAG
TTCCAATTATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTA
AATAACTGAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTT
TAGAAATAGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAA
TTCCAATTTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAAT
TATAAAGCAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTA

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_4467nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA
AGTTTATGAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGT
ATTACACTTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAA
GGGGACAGAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCT
TGATGCCTATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTA
ATCAAAAACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTC
TCTAAAATAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGT
ATGAATATGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCT
GACTCTTTGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTC
TGTTTAAAAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTT
TATTGAGGAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCAC
AGAATCAGGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATT
ACTGCCTTTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAA
ATGTGCCTATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTC
CTGCAGGTAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAG
GATTTAAAAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGA
TTGCTGAAGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTA
AAAGTAGTGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACT
CTACTGTGCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAA
GCATCGTGATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCT
AGTGTTCCATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAA
AATTGCAACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTA
AGCTTTTCAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATT
TTAAATTCAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTT
AAAAGGAAGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTC
CTAGAAAACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTT
CATTTATCCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCT
ATTTCCATAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAG
TTCCAATTATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTA
AATAACTGAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTT
TAGAAATAGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAA
TTCCAATTTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAAT
TATAAAGCAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTA

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_1601nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA

>In-frame_PARK2_ENST00000366898_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_1229nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_4467nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA
AGTTTATGAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGT
ATTACACTTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAA
GGGGACAGAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCT
TGATGCCTATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTA
ATCAAAAACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTC
TCTAAAATAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGT
ATGAATATGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCT
GACTCTTTGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTC
TGTTTAAAAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTT
TATTGAGGAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCAC
AGAATCAGGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATT
ACTGCCTTTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAA
ATGTGCCTATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTC
CTGCAGGTAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAG
GATTTAAAAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGA
TTGCTGAAGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTA
AAAGTAGTGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACT
CTACTGTGCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAA
GCATCGTGATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCT
AGTGTTCCATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAA
AATTGCAACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTA
AGCTTTTCAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATT
TTAAATTCAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTT
AAAAGGAAGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTC
CTAGAAAACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTT
CATTTATCCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCT
ATTTCCATAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAG
TTCCAATTATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTA
AATAACTGAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTT
TAGAAATAGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAA
TTCCAATTTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAAT
TATAAAGCAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTA

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_4467nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA
AGTTTATGAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGT
ATTACACTTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAA
GGGGACAGAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCT
TGATGCCTATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTA
ATCAAAAACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTC
TCTAAAATAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGT
ATGAATATGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCT
GACTCTTTGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTC
TGTTTAAAAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTT
TATTGAGGAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCAC
AGAATCAGGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATT
ACTGCCTTTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAA
ATGTGCCTATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTC
CTGCAGGTAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAG
GATTTAAAAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGA
TTGCTGAAGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTA
AAAGTAGTGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACT
CTACTGTGCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAA
GCATCGTGATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCT
AGTGTTCCATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAA
AATTGCAACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTA
AGCTTTTCAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATT
TTAAATTCAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTT
AAAAGGAAGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTC
CTAGAAAACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTT
CATTTATCCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCT
ATTTCCATAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAG
TTCCAATTATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTA
AATAACTGAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTT
TAGAAATAGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAA
TTCCAATTTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAAT
TATAAAGCAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTA

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_4467nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA
AGTTTATGAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGT
ATTACACTTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAA
GGGGACAGAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCT
TGATGCCTATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTA
ATCAAAAACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTC
TCTAAAATAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGT
ATGAATATGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCT
GACTCTTTGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTC
TGTTTAAAAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTT
TATTGAGGAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCAC
AGAATCAGGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATT
ACTGCCTTTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAA
ATGTGCCTATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTC
CTGCAGGTAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAG
GATTTAAAAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGA
TTGCTGAAGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTA
AAAGTAGTGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACT
CTACTGTGCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAA
GCATCGTGATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCT
AGTGTTCCATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAA
AATTGCAACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTA
AGCTTTTCAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATT
TTAAATTCAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTT
AAAAGGAAGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTC
CTAGAAAACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTT
CATTTATCCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCT
ATTTCCATAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAG
TTCCAATTATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTA
AATAACTGAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTT
TAGAAATAGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAA
TTCCAATTTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAAT
TATAAAGCAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTA

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_1601nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA

>In-frame_PARK2_ENST00000366897_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_1229nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_4467nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA
AGTTTATGAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGT
ATTACACTTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAA
GGGGACAGAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCT
TGATGCCTATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTA
ATCAAAAACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTC
TCTAAAATAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGT
ATGAATATGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCT
GACTCTTTGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTC
TGTTTAAAAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTT
TATTGAGGAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCAC
AGAATCAGGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATT
ACTGCCTTTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAA
ATGTGCCTATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTC
CTGCAGGTAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAG
GATTTAAAAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGA
TTGCTGAAGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTA
AAAGTAGTGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACT
CTACTGTGCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAA
GCATCGTGATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCT
AGTGTTCCATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAA
AATTGCAACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTA
AGCTTTTCAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATT
TTAAATTCAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTT
AAAAGGAAGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTC
CTAGAAAACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTT
CATTTATCCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCT
ATTTCCATAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAG
TTCCAATTATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTA
AATAACTGAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTT
TAGAAATAGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAA
TTCCAATTTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAAT
TATAAAGCAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTA

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_4467nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA
AGTTTATGAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGT
ATTACACTTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAA
GGGGACAGAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCT
TGATGCCTATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTA
ATCAAAAACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTC
TCTAAAATAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGT
ATGAATATGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCT
GACTCTTTGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTC
TGTTTAAAAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTT
TATTGAGGAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCAC
AGAATCAGGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATT
ACTGCCTTTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAA
ATGTGCCTATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTC
CTGCAGGTAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAG
GATTTAAAAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGA
TTGCTGAAGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTA
AAAGTAGTGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACT
CTACTGTGCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAA
GCATCGTGATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCT
AGTGTTCCATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAA
AATTGCAACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTA
AGCTTTTCAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATT
TTAAATTCAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTT
AAAAGGAAGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTC
CTAGAAAACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTT
CATTTATCCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCT
ATTTCCATAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAG
TTCCAATTATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTA
AATAACTGAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTT
TAGAAATAGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAA
TTCCAATTTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAAT
TATAAAGCAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTA

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_4467nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA
AGTTTATGAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGT
ATTACACTTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAA
GGGGACAGAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCT
TGATGCCTATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTA
ATCAAAAACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTC
TCTAAAATAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGT
ATGAATATGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCT
GACTCTTTGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTC
TGTTTAAAAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTT
TATTGAGGAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCAC
AGAATCAGGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATT
ACTGCCTTTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAA
ATGTGCCTATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTC
CTGCAGGTAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAG
GATTTAAAAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGA
TTGCTGAAGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTA
AAAGTAGTGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACT
CTACTGTGCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAA
GCATCGTGATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCT
AGTGTTCCATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAA
AATTGCAACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTA
AGCTTTTCAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATT
TTAAATTCAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTT
AAAAGGAAGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTC
CTAGAAAACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTT
CATTTATCCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCT
ATTTCCATAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAG
TTCCAATTATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTA
AATAACTGAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTT
TAGAAATAGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAA
TTCCAATTTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAAT
TATAAAGCAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTA

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_1601nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT
ATTTCCTGGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCA
TGACCCTTTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAG
CTTTTTTCAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATT
TCCATTTCTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTA

>In-frame_PARK2_ENST00000366896_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_1229nt
CCTGGAGGATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCAC
CTACCCAGTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCC
TGAAATCAGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGG
ACCCTGCCTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATG
CAGGCCCCCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAA
ATAAGATTGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAG
TGGAAAAGATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGG
CAAAGTCTCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGC
CCAGCCTTCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATT
ACCCTCCATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATA
AGGTATTCAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGC
TGTGCCACGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGT
TTGCTGAATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATAT

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000443314_chr2_211336800_-_4460nt
GATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCACCTACCCA
GTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATC
AGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGC
CTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCC
CCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGAT
TGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAA
GATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTC
TCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCT
TCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCC
ATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATT
CAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCA
CGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGA
ATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCT
GGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCATGACCCT
TTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAGCTTTTTT
CAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATTTCCATTT
CTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTAAGTTTAT
GAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGTATTACAC
TTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAAGGGGACA
GAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCTTGATGCC
TATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTAATCAAAA
ACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTCTCTAAAA
TAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGTATGAATA
TGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCTGACTCTT
TGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTCTGTTTAA
AAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTTTATTGAG
GAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCACAGAATCA
GGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATTACTGCCT
TTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAAATGTGCC
TATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTCCTGCAGG
TAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAGGATTTAA
AAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGATTGCTGA
AGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTAAAAGTAG
TGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACTCTACTGT
GCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAAGCATCGT
GATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCTAGTGTTC
CATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAAAATTGCA
ACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTAAGCTTTT
CAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATTTTAAATT
CAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTTAAAAGGA
AGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTCCTAGAAA
ACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTTCATTTAT
CCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCTATTTCCA
TAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAGTTCCAAT
TATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTAAATAACT
GAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTTTAGAAAT
AGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAATTCCAAT
TTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAATTATAAAG
CAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTATGTTCTG

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000441020_chr2_211336800_-_4460nt
GATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCACCTACCCA
GTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATC
AGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGC
CTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCC
CCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGAT
TGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAA
GATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTC
TCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCT
TCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCC
ATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATT
CAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCA
CGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGA
ATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCT
GGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCATGACCCT
TTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAGCTTTTTT
CAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATTTCCATTT
CTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTAAGTTTAT
GAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGTATTACAC
TTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAAGGGGACA
GAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCTTGATGCC
TATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTAATCAAAA
ACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTCTCTAAAA
TAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGTATGAATA
TGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCTGACTCTT
TGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTCTGTTTAA
AAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTTTATTGAG
GAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCACAGAATCA
GGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATTACTGCCT
TTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAAATGTGCC
TATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTCCTGCAGG
TAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAGGATTTAA
AAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGATTGCTGA
AGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTAAAAGTAG
TGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACTCTACTGT
GCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAAGCATCGT
GATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCTAGTGTTC
CATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAAAATTGCA
ACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTAAGCTTTT
CAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATTTTAAATT
CAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTTAAAAGGA
AGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTCCTAGAAA
ACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTTCATTTAT
CCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCTATTTCCA
TAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAGTTCCAAT
TATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTAAATAACT
GAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTTTAGAAAT
AGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAATTCCAAT
TTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAATTATAAAG
CAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTATGTTCTG

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000450366_chr2_211336800_-_4460nt
GATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCACCTACCCA
GTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATC
AGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGC
CTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCC
CCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGAT
TGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAA
GATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTC
TCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCT
TCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCC
ATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATT
CAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCA
CGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGA
ATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCT
GGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCATGACCCT
TTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAGCTTTTTT
CAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATTTCCATTT
CTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTAAGTTTAT
GAATATAACCATCTGTTACTGTTCTAAAAATGTTTAAAAGAAACTCAATACAGATAAAGATAAATATGTGACTATTATTGGGTATTACAC
TTCACTTCTCTTTAATATTTTTCCTCCAACTGGAGGGCAGACAATTTTCTGACTTGCTTTTCTCTAGGTGGTTCATTTTGAAAGGGGACA
GAAATATAACTAAATGCTTCCAGGAGAAAAATTCCAAGAGTTACAATCTGGACTTGGTACCTAAATATCATTTTTTAAATTCTTGATGCC
TATTTGGACTAGAGGTAAACATACTTTCAGATTGGCCTGTTTTTGTCGGTAAGGCATACAGCCTTCAGAAGCCAACATTTTTAATCAAAA
ACTTATAAAACATGATGATCATTGTGAAAATTCTGAGTTGAAGGTTAGTTTAAGATAAGCTAACAATAACAGTCTGTGTTTTCTCTAAAA
TAATCTGAGTTTTTTGGAACTCTTTATTTAAATATGTGTGTTTTTCAGTATTCAAATAAGATCAGGAAGCCAATTTTCTATGTATGAATA
TGCTTTAACCTAGGATTTCAGTCCACTCTGACTGACTTTCTAAACTTTAACTTGGGTTTTTACAGTGACTATGCATTAGTGCTGACTCTT
TGGTATAAGCCATAAAATATTTTCCTTCCTATCAATTTATCTGAACTTTGGTCTTTTCACTAAATTGTACAGTATTCTACTTCTGTTTAA
AAAGGGGAGATGAGAAAGGGAATACTATCTAACCAATAACTTGAACAAAAACACTAAACTAAGCATTTAATAGAAATGCTTTTTATTGAG
GAGGTATTATCCAGAGTTCATGCTTAGAACAAATGCATCTTTGCGTATCCTAGACTTAACAATTCATCAGTTTCTGAGACCACAGAATCA
GGTTTTCCGTAGTAGATAAAGACTCTCTGGTGCTTCAAATTCTGTTCAAGTGTTTTGACTCATCAGCTTCTACTCTTTCTATTACTGCCT
TTGCCTGGCTTGTTTTGTCTCTTTGCAACTGATTTTGCAAAAAAAAATTGTAGCTTTAAAATAACAGGGTCTAAGTATTTTAAATGTGCC
TATTTCACAGCTCTCTTGGTCACAAAAACATGCTATTTTTATTGGAACTTCAAACCAAATCCCCACTGAGTGTGTACTGGTTCCTGCAGG
TAGCAGTCTCCTATTATCTCCTGTTTAGCACCAAAAGAGCTAATATTATTGGAAACTGACCTTTTAAAGGCCACTGGCAGTAGGATTTAA
AAAGCAGCCCACTGCTCAGTTTCCAGGATCAGCTTCCTCCTTCTGTCACTTGTGTAAGTTGGCACTACCTTGTGCCTCTCAGATTGCTGA
AGTGCTGCTGGTAAGCATGTGCATGCTCTGCCTTTCTTGTGAAAGTTTTCAATCAGCGATATCAGCACTTACAGTAAGAAGTAAAAGTAG
TGCACAGCAAAGCTAATTTGCCTTTGCCTGGGGTGTTCAGCTTGAAAGAATAAAGCTCATTTGGTTTAGTTAAATGTCTTACTCTACTGT
GCCTATGCTTTTAGCTGCGTTACTAAGCAAGGGAAAAATAACAGTTTCTCTGAGCCAGAGAAGACTTGATCACAGTTCTCCAAGCATCGT
GATAGCAATGCTTAACCCCAGGAAGATTTCAAGGCAGGGAGAAGAACATTTCAAATAAGATTCTTGTTAACCCATTTATGCCTAGTGTTC
CATTATTGGAATGCTAAGCTTGTGGGAGTCATTTACATCCTACTGCTCAAAGTCATTGCCAAGGTCTGATTTTTCACACAAAAAATTGCA
ACCCCCAGCATAAATGGGTTAGCTACTGTCATCAGTTAGCAAATTCATCCACACAAACACAATTAGAGTTTGGTTTTTTTTTAAGCTTTT
CAAAACTTACTAAACTGGCACAATTTTATATGTATGCTATTTGTTGTATTTATGCTTAAGAGCAAAAAAGTTTTGATGGGATTTTAAATT
CAGGCAAAGCCTACAACGCTGAGACAATCCCCTAACAACATGGTAGTAACTAAAGAAACTTTTATACTAGGCTTCTTAGTTTTAAAAGGA
AGTGGCATCATTGTTTCAGTTCTAGTTTGTATTTTTCTCTCAGATATTTTTCTTCTTTAAAAATCTTTCCCAGAAGTTGGTTCCTAGAAA
ACTCAATACCATCATCTCTTATCTCTATACAGGGACTAGGTAATAAAACCTTCAAAGGTTGTCAAAGGTCATCAAGCAGTGTTCATTTAT
CCTGTCACATGTTTCTGTTTCTATAGTAATTTAGAAATTGCAAATAGTTAACTTTTCATCATGTAAAAAGTTAACATTATCCTATTTCCA
TAGATACCATGGACGGCGGTGTGGCCTGAGTTGTCAGTCTTTAATCCTGAGTCATGTGGCTCTCTTTTCATCTTTGATGTCAGTTCCAAT
TATTTGGCATCAAAAACCTTCATGGTAGGTAGAGTTTTAGGTAAAAGTGGATCTAGGGTTACTTTCTTTATTAACATTTCCTAAATAACT
GAATTGAGAGACATACTCTGCTACTATGTCCTCAGGTTAATTTTTGTCTGATCTTACGATGCCCTGCCTTTTACTAGCTACTTTAGAAAT
AGAAAATGTGAAGAGTGACTATTTACATGTATACTCCTTTGGCTGCTAGAACTCATCTGTAGTCCTTTATTATTTACACTGAATTCCAAT
TTCATTTCTGCTTCCGCTAAGTAAGAGCACCTCATTCCTGTGTTTTCTCTACTATTGAGCTGTAGACGAACTGTTTCTCTAATTATAAAG
CAAACTGTTTGGGATATTCAGGGAAACTACCCCAATGTTATGTTGTCATTTAATGGGAAAGGCTGGGATCATATGTATTTCTATGTTCTG

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000233714_chr2_211336800_-_1594nt
GATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCACCTACCCA
GTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATC
AGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGC
CTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCC
CCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGAT
TGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAA
GATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTC
TCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCT
TCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCC
ATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATT
CAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCA
CGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGA
ATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCT
GGCTGACCTGCTAGTCCCCACAAAAGCCAGGTTCCCTGCATTTGAACTCTGAAAGGATAGCATGCCACCTGCAACTCACTGCATGACCCT
TTCTGTATATTCAAACCCAAGCTAAGTGCTTCCGTTGCTTTCCAAGGAAACAAAGAGTCAAACTGTGGACTTGATTTTGTTAGCTTTTTT
CAGAATTTATCTTTCATTCAGTTCCCTTCCATTATCATTTACTTTTACTTAGAAGTATCCAAGGAAGTCTTTTAACTTTAATTTCCATTT
CTTCCTAAAGGGAGAGTGAGTGATATGTACAGTGTTTTGAGATTGTATACATATATTCCAGAACTTGGAGGAAATCTTATTTAAGTTTAT

>In-frame_PARK2_ENST00000366892_chr6_163148694_-_LANCL1_ENST00000431941_chr2_211336800_-_1222nt
GATTTAACCCAGGAGAGCCGCTGGTGGGAGGCGCGGCTGGCGCCGCTGCGCGCATGGGCCTGTTCCTGGCCCGCAGCCGCCACCTACCCA
GTGACCATGATAGCTGACTCCTGAGTTCTCACAACGCTTGACCAATAAGATTCGGGAGCTTCTTCAGCAAATGGAGAGAGGCCTGAAATC
AGCAGACCCTCGGGATGGCACCGGTTACACTGGCTGGGCAGGTATTGCTGTGCTTTACTTACATCTTTATGATGTATTTGGGGACCCTGC
CTACCTACAGTTAGCACATGGCTATGTAAAGCAAAGTCTGAACTGCTTAACCAAGCGCTCCATCACCTTCCTTTGTGGGGATGCAGGCCC
CCTGGCAGTGGCCGCTGTGCTATATCACAAGATGAACAATGAGAAGCAGGCAGAAGATTGCATCACACGGCTAATTCACCTAAATAAGAT
TGATCCTCATGCTCCAAATGAAATGCTCTATGGGCGAATAGGCTACATCTATGCTCTTCTTTTTGTCAATAAGAACTTTGGAGTGGAAAA
GATTCCTCAAAGCCATATTCAGCAGATTTGTGAAACAATTTTAACCTCTGGAGAAAACCTAGCTAGGAAGAGAAACTTCACGGCAAAGTC
TCCACTGATGTATGAATGGTACCAGGAATATTATGTAGGGGCTGCTCATGGCCTGGCTGGAATTTATTACTACCTGATGCAGCCCAGCCT
TCAAGTGAGCCAAGGGAAGTTACATAGTTTGGTCAAGCCCAGTGTAGACTACGTCTGCCAGCTGAAATTCCCTTCTGGCAATTACCCTCC
ATGTATAGGTGATAATCGAGATCTGCTTGTCCATTGGTGCCATGGCGCCCCTGGGGTAATCTACATGCTCATCCAGGCCTATAAGGTATT
CAGAGAGGAAAAGTATCTCTGTGATGCCTATCAGTGTGCTGATGTGATCTGGCAATATGGGTTGCTGAAGAAGGGATATGGGCTGTGCCA
CGGTTCTGCAGGGAATGCCTATGCCTTCCTGACACTCTACAACCTCACACAGGACATGAAGTACCTGTATAGGGCCTGTAAGTTTGCTGA
ATGGTGCTTAGAGTATGGAGAACATGGATGCAGAACACCAGACACCCCTTTCTCTCTCTTTGAAGGAATGGCTGGAACAATATATTTCCT


Top

FusionGenePPI for PARK2_LANCL1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PARK2TRIP13, SEPT5, SYT11, AIMP2, FBXW7, CUL1, CCNE1, CCNA1, NDUFA4L2, RAC1, RAD1, PAFAH1B2, RGS2, CASK, GRIN2B, DLG4, HOMER1, CAMK2A, GPR37, UBE2G1, UBE2J1, SNCA, HSPA1A, STUB1, DNAJA1, HSPA8, DNAJB1, PSMA1, SNCAIP, UBE2L6, PDCD2, RNF41, PLCG1, MAPT, HSPA4, PARK2, BACH1, CDK5, LIMK1, EPS15, TUBA1A, TUBG1, PSMA4, LRRK2, RANBP2, HDAC4, SIM2, PARK7, SLC6A3, PSMC5, UBE2L3, SYN1, HTRA2, BCL2, APP, PINK1, ZNF746, ABL1, AMBRA1, PICK1, IKBKG, TRAF2, SLC11A2, MFN1, MFN2, ESRRA, ESRRB, ESRRG, UBE2E2, ARRB2, ARRB1, ATXN3, PSMD4, DNM1L, C1QBP, FBP1, GBA, BAG5, RAD23A, PSMD2, PSMC3, ATXN2, YWHAH, ARIH1, MAPK1, TFRC, GAPDH, HSPA9, PCNA, PRPS1, UBASH3B, UBASH3A, UBE2J2, CHPF, RHOT1, UBC, UBE2G2, UBE2N, UBE2D2, UBE2E1, UBE2D3, UBE2V1, VDAC1, VDAC2, VDAC3, HK1, TOMM70A, CISD1, NME2, UBE2M, TCP1, CCT2, PACRG, VCP, HSP90AA1, RHOT2, ACSL1, ACSL4, MDH1, MDH2, CPT1A, CYB5R1, CYB5R3, MARC1, HK2, TOMM22, FIS1, MARCH5, TBC1D15, TOM1, MYO6, TAX1BP1, SQSTM1, CALCOCO2, PSMA2, PSMA3, PSMA5, PSMA6, PSMA7, PSMB1, PSMB2, PSMB3, PSMB4, PSMB5, PSMB6, PSMB7, PSMC1, PSMC2, PSMC4, PSMC6, RAD23B, ADRM1, PAAF1, PSMD1, PSMD3, PSMD5, PSMD6, PSMD7, PSMD8, PSMD9, PSMD10, PSMD11, PSMD12, PSMD13, PSMD14, PSME1, PSME2, PSME3, FBXO7, TOMM40, LRPPRC, PRDX1, CALM1P1, HNRNPA2B1, CLPX, CBX1, HSPD1, ACTB, ATP2B3, ATP2B1, CASP14, H1F0, DAP3, PRKCSH, TUBA1C, AIFM1, ALB, TUBB4B, VIM, TUBA4A, HSP90AB1, NPM1, TUBB, HSPA5, GSDMA, RBM8A, CALU, RCN2, MRPS31, SLC25A3, ATP5A1, HADHB, EEF1A1, NEFL, TUBB6, SLC25A13, HIST1H2AA, ATP5O, MRPS7, SET, OPA1, NEFM, CBX3, EIF4B, BAG2, SART1, ATP5J2, MYL12A, ATP5C1, RPS20, RPL13, RPL6, CCT3, ANXA2, HNRNPF, HIST1H4J, TPM4, NDUFS4, INA, HSPA2, CIRBP, YBX3, LMNB1, SLC25A4, CALR, MRPL12, PRPF19, SFPQ, HSP90B1, RFC4, FUS, NDUFS2, SSBP1, IGF2BP1, HSPA1L, XRCC6, YWHAE, RUVBL1, LMNA, RUVBL2, VGF, ZC3H15, GPD2, HSDL2, AMY2B, MARCKSL1, CHGA, ACTBL2, NTPCR, GCNT2, AGPS, CHGB, CEP55, HDGF, TUBA3D, ABCE1, TGM3, AGK, MRPS28, MRPS18B, RPL26L1, STOML2, CALML3, DBT, VAT1, NACA, CHCHD3, TPM3, NDUFA10, AMOT, HNRNPH3, PDIA4, SRSF9, MRPS23, TUBB1, NIPSNAP1, PCCA, RPS19, PCCB, ACTA2, MARCKS, DDX47, PABPC1L, PRRC2C, MCCC2, TXN, PDIA6, HNRNPCL1, HNRNPDL, P4HB, PIP, HNRNPD, NDUFS3, CKAP4, ATAD3B, RPL22, PABPC3, HNRNPA3, RPS27A, IMPDH2, MCM7, TPM1, SLC25A1, EEF1A2, ATAD3A, RPL8, PGAM5, SRSF1, RALY, ELAVL1, RPS2, HIST1H1C, MRPS15, PTCD3, HNRNPR, SRSF3, HNRNPM, MRPS27, SERBP1, TUFM, SRSF2, PRPF6, SYNCRIP, HNRNPC, RPL23A, RPS8, RPS25, MATR3, RPS14, SLC25A5, DDX17, RPL12, RPS6, RPL4, SNRNP200, HNRNPH1, MRPS22, RPL7A, RPS16, RPLP0, RPL7, DDX5, HNRNPK, HNRNPU, HNRNPA1, DDX3X, IGHA1, EEF1A1P5, HSPA7, IGHG1, IGKV2-30, TUBB7P, SLC25A24, NACC1, TARDBP, BECN1, PIK3C3, DLX2, CRX, FAM46C, MEOX1, MEOX2, RBCK1, REL, TCF4, DDIT4, BCL2L1, BCL2L2, MCL1, OPTN, UCHL1, MLLT4, SUMO1, PRAME, PASK, PCYT2, PTPN5, FUBP1, CTNNB1, EGFR, HSD17B10, DLG1, BIRC5, GRIK2, COMMD1, MTOR, RPTOR, PLK1, CCNB1, AURKA, AURKB, NEK2, CDC20, FZR1, PTTG1, DYRK1A, RAB7A, APEX1, TNFRSF17, BBOX1, BNIP3, DDIT3, MAVS, RNF31, NBN, TP53LANCL1SIRT1, CUL3, SERPINH1, VHL, ERG, EGFR, ALDH16A1, DERA, TBC1D9, TBC1D9B, FIGN, MYO7A, IPP, OCIAD1, UBN2, NTRK1, MCM2, MCM5, CDC73, NR3C1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PARK2_LANCL1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PARK2_LANCL1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource