FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25990

FusionGeneSummary for PARD6B_PTPN1

check button Fusion gene summary
Fusion gene informationFusion gene name: PARD6B_PTPN1
Fusion gene ID: 25990
HgeneTgene
Gene symbol

PARD6B

PTPN1

Gene ID

84612

5770

Gene namepar-6 family cell polarity regulator betaprotein tyrosine phosphatase, non-receptor type 1
SynonymsPAR6BPTP1B
Cytomap

20q13.13

20q13.13

Type of geneprotein-codingprotein-coding
Descriptionpartitioning defective 6 homolog betaPAR-6 betapar-6 partitioning defective 6 homolog betatyrosine-protein phosphatase non-receptor type 1protein tyrosine phosphatase, placentalprotein-tyrosine phosphatase 1B
Modification date2018052320180522
UniProtAcc

Q9BYG5

P18031

Ensembl transtripts involved in fusion geneENST00000371610, ENST00000396039, 
ENST00000371621, ENST00000541713, 
Fusion gene scores* DoF score3 X 2 X 2=127 X 5 X 5=175
# samples 310
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(10/175*10)=-0.807354922057604
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PARD6B [Title/Abstract] AND PTPN1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePARD6B

GO:0065003

protein-containing complex assembly

12545177

TgenePTPN1

GO:0030100

regulation of endocytosis

21135139

TgenePTPN1

GO:0030968

endoplasmic reticulum unfolded protein response

22169477

TgenePTPN1

GO:0035335

peptidyl-tyrosine dephosphorylation

21135139

TgenePTPN1

GO:0061098

positive regulation of protein tyrosine kinase activity

21216966

TgenePTPN1

GO:1903898

negative regulation of PERK-mediated unfolded protein response

21216966


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVOVTCGA-VG-A8LO-01APARD6Bchr20

49348389

+PTPN1chr20

49177900

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000371610ENST00000371621PARD6Bchr20

49348389

+PTPN1chr20

49177900

+
5CDS-intronENST00000371610ENST00000541713PARD6Bchr20

49348389

+PTPN1chr20

49177900

+
In-frameENST00000396039ENST00000371621PARD6Bchr20

49348389

+PTPN1chr20

49177900

+
5CDS-intronENST00000396039ENST00000541713PARD6Bchr20

49348389

+PTPN1chr20

49177900

+

Top

FusionProtFeatures for PARD6B_PTPN1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PARD6B

Q9BYG5

PTPN1

P18031

Adapter protein involved in asymmetrical cell divisionand cell polarization processes. Probably involved in formation ofepithelial tight junctions. Association with PARD3 may prevent theinteraction of PARD3 with F11R/JAM1, thereby preventing tightjunction assembly. The PARD6-PARD3 complex links GTP-bound Rhosmall GTPases to atypical protein kinase C proteins. Tyrosine-protein phosphatase which acts as a regulatorof endoplasmic reticulum unfolded protein response. Mediatesdephosphorylation of EIF2AK3/PERK; inactivating the protein kinaseactivity of EIF2AK3/PERK. May play an important role in CKII- andp60c-src-induced signal transduction cascades. May regulate theEFNA5-EPHA3 signaling pathway which modulates cell reorganizationand cell-cell repulsion. May also regulate the hepatocyte growthfactor receptor signaling pathway through dephosphorylation ofMET. {ECO:0000269|PubMed:18819921, ECO:0000269|PubMed:21135139,ECO:0000269|PubMed:22169477}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePTPN1chr20:49348389chr20:49177900ENST00000371621+010215_22121436RegionSubstrate binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePARD6Bchr20:49348389chr20:49177900ENST00000371610+13133_15022373DomainNote=Pseudo-CRIB
HgenePARD6Bchr20:49348389chr20:49177900ENST00000371610+13157_25022373DomainPDZ
HgenePARD6Bchr20:49348389chr20:49177900ENST00000371610+1316_9622373DomainPB1
HgenePARD6Bchr20:49348389chr20:49177900ENST00000396039+13133_15022116DomainNote=Pseudo-CRIB
HgenePARD6Bchr20:49348389chr20:49177900ENST00000396039+13157_25022116DomainPDZ
HgenePARD6Bchr20:49348389chr20:49177900ENST00000396039+1316_9622116DomainPB1
TgenePTPN1chr20:49348389chr20:49177900ENST00000371621+0103_27721436DomainTyrosine-protein phosphatase


Top

FusionGeneSequence for PARD6B_PTPN1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PARD6B_ENST00000371610_chr20_49348389_+_PTPN1_ENST00000371621_chr20_49177900_+_437aa
MNRSHRHGAGSGCLGTMEVKSKDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDTINASLIKMEEAQRSYILTQGPLP
NTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSTTTVRQLELENLTTQETREILHFHTTTW
PDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRF
SYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPY

>In-frame_PARD6B_ENST00000396039_chr20_49348389_+_PTPN1_ENST00000371621_chr20_49177900_+_437aa
MNRSHRHGAGSGCLGTMEVKSKDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDTINASLIKMEEAQRSYILTQGPLP
NTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSTTTVRQLELENLTTQETREILHFHTTTW
PDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRF
SYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PARD6B_ENST00000371610_chr20_49348389_+_PTPN1_ENST00000371621_chr20_49177900_+_1311nt
ATGAACCGCAGCCACCGGCACGGGGCGGGCAGCGGCTGCCTGGGCACTATGGAGGTGAAGAGCAAGGATATCCGACATGAAGCCAGTGAC
TTCCCATGTAGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTA
CATCAAGAAGATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCT
AACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTA
AAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATC
AAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAACCTTACAACCCAAGAAACTCGAGAGATCTTACATTTCCACTATACCACATGG
CCTGACTTTGGAGTCCCTGAATCACCAGCCTCATTCTTGAACTTTCTTTTCAAAGTCCGAGAGTCAGGGTCACTCAGCCCGGAGCACGGG
CCCGTTGTGGTGCACTGCAGTGCAGGCATCGGCAGGTCTGGAACCTTCTGTCTGGCTGATACCTGCCTCTTGCTGATGGACAAGAGGAAA
GACCCTTCTTCCGTTGATATCAAGAAAGTGCTGTTAGAAATGAGGAAGTTTCGGATGGGGCTGATCCAGACAGCCGACCAGCTGCGCTTC
TCCTACCTGGCTGTGATCGAAGGTGCCAAATTCATCATGGGGGACTCTTCCGTGCAGGATCAGTGGAAGGAGCTTTCCCACGAGGACCTG
GAGCCCCCACCCGAGCATATCCCCCCACCTCCCCGGCCACCCAAACGAATCCTGGAGCCACACAATGGGAAATGCAGGGAGTTCTTCCCA
AATCACCAGTGGGTGAAGGAAGAGACCCAGGAGGATAAAGACTGCCCCATCAAGGAAGAAAAAGGAAGCCCCTTAAATGCCGCACCCTAC
GGCATCGAAAGCATGAGTCAAGACACTGAAGTTAGAAGTCGGGTCGTGGGGGGAAGTCTTCGAGGTGCCCAGGCTGCCTCCCCAGCCAAA
GGGGAGCCGTCACTGCCCGAGAAGGACGAGGACCATGCACTGAGTTACTGGAAGCCCTTCCTGGTCAACATGTGCGTGGCTACGGTCCTC

>In-frame_PARD6B_ENST00000396039_chr20_49348389_+_PTPN1_ENST00000371621_chr20_49177900_+_1311nt
ATGAACCGCAGCCACCGGCACGGGGCGGGCAGCGGCTGCCTGGGCACTATGGAGGTGAAGAGCAAGGATATCCGACATGAAGCCAGTGAC
TTCCCATGTAGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTA
CATCAAGAAGATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCT
AACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTA
AAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATC
AAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAACCTTACAACCCAAGAAACTCGAGAGATCTTACATTTCCACTATACCACATGG
CCTGACTTTGGAGTCCCTGAATCACCAGCCTCATTCTTGAACTTTCTTTTCAAAGTCCGAGAGTCAGGGTCACTCAGCCCGGAGCACGGG
CCCGTTGTGGTGCACTGCAGTGCAGGCATCGGCAGGTCTGGAACCTTCTGTCTGGCTGATACCTGCCTCTTGCTGATGGACAAGAGGAAA
GACCCTTCTTCCGTTGATATCAAGAAAGTGCTGTTAGAAATGAGGAAGTTTCGGATGGGGCTGATCCAGACAGCCGACCAGCTGCGCTTC
TCCTACCTGGCTGTGATCGAAGGTGCCAAATTCATCATGGGGGACTCTTCCGTGCAGGATCAGTGGAAGGAGCTTTCCCACGAGGACCTG
GAGCCCCCACCCGAGCATATCCCCCCACCTCCCCGGCCACCCAAACGAATCCTGGAGCCACACAATGGGAAATGCAGGGAGTTCTTCCCA
AATCACCAGTGGGTGAAGGAAGAGACCCAGGAGGATAAAGACTGCCCCATCAAGGAAGAAAAAGGAAGCCCCTTAAATGCCGCACCCTAC
GGCATCGAAAGCATGAGTCAAGACACTGAAGTTAGAAGTCGGGTCGTGGGGGGAAGTCTTCGAGGTGCCCAGGCTGCCTCCCCAGCCAAA
GGGGAGCCGTCACTGCCCGAGAAGGACGAGGACCATGCACTGAGTTACTGGAAGCCCTTCCTGGTCAACATGTGCGTGGCTACGGTCCTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PARD6B_ENST00000371610_chr20_49348389_+_PTPN1_ENST00000371621_chr20_49177900_+_3601nt
GAGGGAGGGAGCTGCTTCCCCGCCTGCCGCGCCACCAGTCCGACCCTCGGTCCCGCCGTGTGAGCAGCTGGTGGAGTGGAGCTCAGCGCG
GACGCCGGAGCTGCGGCCGCCCCCTCTGCAGGTGCCTGTGAGGAGGCGCCCGGGCCGCAACCGCTTTCCGAGATCCCCAGTCGCGCACTC
GCTCCCCGCGCTCCTGAGGGGCCGCCCGGCCGGAGGAGGCCGTCGCGGGGCTCGGCGTTCAGCATGAACCGCAGCCACCGGCACGGGGCG
GGCAGCGGCTGCCTGGGCACTATGGAGGTGAAGAGCAAGGATATCCGACATGAAGCCAGTGACTTCCCATGTAGAGTGGCCAAGCTTCCT
AAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTACATCAAGAAGATAATGACTATATCAAC
GCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATG
GTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAA
GAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTA
GAATTGGAAAACCTTACAACCCAAGAAACTCGAGAGATCTTACATTTCCACTATACCACATGGCCTGACTTTGGAGTCCCTGAATCACCA
GCCTCATTCTTGAACTTTCTTTTCAAAGTCCGAGAGTCAGGGTCACTCAGCCCGGAGCACGGGCCCGTTGTGGTGCACTGCAGTGCAGGC
ATCGGCAGGTCTGGAACCTTCTGTCTGGCTGATACCTGCCTCTTGCTGATGGACAAGAGGAAAGACCCTTCTTCCGTTGATATCAAGAAA
GTGCTGTTAGAAATGAGGAAGTTTCGGATGGGGCTGATCCAGACAGCCGACCAGCTGCGCTTCTCCTACCTGGCTGTGATCGAAGGTGCC
AAATTCATCATGGGGGACTCTTCCGTGCAGGATCAGTGGAAGGAGCTTTCCCACGAGGACCTGGAGCCCCCACCCGAGCATATCCCCCCA
CCTCCCCGGCCACCCAAACGAATCCTGGAGCCACACAATGGGAAATGCAGGGAGTTCTTCCCAAATCACCAGTGGGTGAAGGAAGAGACC
CAGGAGGATAAAGACTGCCCCATCAAGGAAGAAAAAGGAAGCCCCTTAAATGCCGCACCCTACGGCATCGAAAGCATGAGTCAAGACACT
GAAGTTAGAAGTCGGGTCGTGGGGGGAAGTCTTCGAGGTGCCCAGGCTGCCTCCCCAGCCAAAGGGGAGCCGTCACTGCCCGAGAAGGAC
GAGGACCATGCACTGAGTTACTGGAAGCCCTTCCTGGTCAACATGTGCGTGGCTACGGTCCTCACGGCCGGCGCTTACCTCTGCTACAGG
TTCCTGTTCAACAGCAACACATAGCCTGACCCTCCTCCACTCCACCTCCACCCACTGTCCGCCTCTGCCCGCAGAGCCCACGCCCGACTA
GCAGGCATGCCGCGGTAGGTAAGGGCCGCCGGACCGCGTAGAGAGCCGGGCCCCGGACGGACGTTGGTTCTGCACTAAAACCCATCTTCC
CCGGATGTGTGTCTCACCCCTCATCCTTTTACTTTTTGCCCCTTCCACTTTGAGTACCAAATCCACAAGCCATTTTTTGAGGAGAGTGAA
AGAGAGTACCATGCTGGCGGCGCAGAGGGAAGGGGCCTACACCCGTCTTGGGGCTCGCCCCACCCAGGGCTCCCTCCTGGAGCATCCCAG
GCGGGCGGCACGCCAACAGCCCCCCCCTTGAATCTGCAGGGAGCAACTCTCCACTCCATATTTATTTAAACAATTTTTTCCCCAAAGGCA
TCCATAGTGCACTAGCATTTTCTTGAACCAATAATGTATTAAAATTTTTTGATGTCAGCCTTGCATCAAGGGCTTTATCAAAAAGTACAA
TAATAAATCCTCAGGTAGTACTGGGAATGGAAGGCTTTGCCATGGGCCTGCTGCGTCAGACCAGTACTGGGAAGGAGGACGGTTGTAAGC
AGTTGTTATTTAGTGATATTGTGGGTAACGTGAGAAGATAGAACAATGCTATAATATATAATGAACACGTGGGTATTTAATAAGAAACAT
GATGTGAGATTACTTTGTCCCGCTTATTCTCCTCCCTGTTATCTGCTAGATCTAGTTCTCAATCACTGCTCCCCCGTGTGTATTAGAATG
CATGTAAGGTCTTCTTGTGTCCTGATGAAAAATATGTGCTTGAAATGAGAAACTTTGATCTCTGCTTACTAATGTGCCCCATGTCCAAGT
CCAACCTGCCTGTGCATGACCTGATCATTACATGGCTGTGGTTCCTAAGCCTGTTGCTGAAGTCATTGTCGCTCAGCAATAGGGTGCAGT
TTTCCAGGAATAGGCATTTGCCTAATTCCTGGCATGACACTCTAGTGACTTCCTGGTGAGGCCCAGCCTGTCCTGGTACAGCAGGGTCTT
GCTGTAACTCAGACATTCCAAGGGTATGGGAAGCCATATTCACACCTCACGCTCTGGACATGATTTAGGGAAGCAGGGACACCCCCCGCC
CCCCACCTTTGGGATCAGCCTCCGCCATTCCAAGTCAACACTCTTCTTGAGCAGACCGTGATTTGGAAGAGAGGCACCTGCTGGAAACCA
CACTTCTTGAAACAGCCTGGGTGACGGTCCTTTAGGCAGCCTGCCGCCGTCTCTGTCCCGGTTCACCTTGCCGAGAGAGGCGCGTCTGCC
CCACCCTCAAACCCTGTGGGGCCTGATGGTGCTCACGACTCTTCCTGCAAAGGGAACTGAAGACCTCCACATTAAGTGGCTTTTTAACAT
GAAAAACACGGCAGCTGTAGCTCCCGAGCTACTCTCTTGCCAGCATTTTCACATTTTGCCTTTCTCGTGGTAGAAGCCAGTACAGAGAAA
TTCTGTGGTGGGAACATTCGAGGTGTCACCCTGCAGAGCTATGGTGAGGTGTGGATAAGGCTTAGGTGCCAGGCTGTAAGCATTCTGAGC
TGGGCTTGTTGTTTTTAAGTCCTGTATATGTATGTAGTAGTTTGGGTGTGTATATATAGTAGCATTTCAAAATGGACGTACTGGTTTAAC
CTCCTATCCTTGGAGAGCAGCTGGCTCTCCACCTTGTTACACATTATGTTAGAGAGGTAGCGAGCTGCTCTGCTATATGCCTTAAGCCAA
TATTTACTCATCAGGTCATTATTTTTTACAATGGCCATGGAATAAACCATTTTTACAAAAATAAAAACAAAAAAAGCAAGGTGTTTTGGT
ATAATACCTTTTCAGGTGTGTGTGGATACGTGGCTGCATGACCGGGTGGGTGGGGGGGAGTGTCTCAGGGTCTTCTGTGACCTCACAGAA
CTGTCAGACTGTACAGTTTTCCAACTTGCCATATTCATGATGGGTTTGCATTTTAGCTGCAACAATAAAATTTTTTTCTAAAGAACATGA

>In-frame_PARD6B_ENST00000396039_chr20_49348389_+_PTPN1_ENST00000371621_chr20_49177900_+_3480nt
GTGCCTGTGAGGAGGCGCCCGGGCCGCAACCGCTTTCCGAGATCCCCAGTCGCGCACTCGCTCCCCGCGCTCCTGAGGGGCCGCCCGGCC
GGAGGAGGCCGTCGCGGGGCTCGGCGTTCAGCATGAACCGCAGCCACCGGCACGGGGCGGGCAGCGGCTGCCTGGGCACTATGGAGGTGA
AGAGCAAGGATATCCGACATGAAGCCAGTGACTTCCCATGTAGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACG
TCAGTCCCTTTGACCATAGTCGGATTAAACTACATCAAGAAGATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAA
GGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCA
TGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAA
ATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAACCTTACAACCCAAGAAACTC
GAGAGATCTTACATTTCCACTATACCACATGGCCTGACTTTGGAGTCCCTGAATCACCAGCCTCATTCTTGAACTTTCTTTTCAAAGTCC
GAGAGTCAGGGTCACTCAGCCCGGAGCACGGGCCCGTTGTGGTGCACTGCAGTGCAGGCATCGGCAGGTCTGGAACCTTCTGTCTGGCTG
ATACCTGCCTCTTGCTGATGGACAAGAGGAAAGACCCTTCTTCCGTTGATATCAAGAAAGTGCTGTTAGAAATGAGGAAGTTTCGGATGG
GGCTGATCCAGACAGCCGACCAGCTGCGCTTCTCCTACCTGGCTGTGATCGAAGGTGCCAAATTCATCATGGGGGACTCTTCCGTGCAGG
ATCAGTGGAAGGAGCTTTCCCACGAGGACCTGGAGCCCCCACCCGAGCATATCCCCCCACCTCCCCGGCCACCCAAACGAATCCTGGAGC
CACACAATGGGAAATGCAGGGAGTTCTTCCCAAATCACCAGTGGGTGAAGGAAGAGACCCAGGAGGATAAAGACTGCCCCATCAAGGAAG
AAAAAGGAAGCCCCTTAAATGCCGCACCCTACGGCATCGAAAGCATGAGTCAAGACACTGAAGTTAGAAGTCGGGTCGTGGGGGGAAGTC
TTCGAGGTGCCCAGGCTGCCTCCCCAGCCAAAGGGGAGCCGTCACTGCCCGAGAAGGACGAGGACCATGCACTGAGTTACTGGAAGCCCT
TCCTGGTCAACATGTGCGTGGCTACGGTCCTCACGGCCGGCGCTTACCTCTGCTACAGGTTCCTGTTCAACAGCAACACATAGCCTGACC
CTCCTCCACTCCACCTCCACCCACTGTCCGCCTCTGCCCGCAGAGCCCACGCCCGACTAGCAGGCATGCCGCGGTAGGTAAGGGCCGCCG
GACCGCGTAGAGAGCCGGGCCCCGGACGGACGTTGGTTCTGCACTAAAACCCATCTTCCCCGGATGTGTGTCTCACCCCTCATCCTTTTA
CTTTTTGCCCCTTCCACTTTGAGTACCAAATCCACAAGCCATTTTTTGAGGAGAGTGAAAGAGAGTACCATGCTGGCGGCGCAGAGGGAA
GGGGCCTACACCCGTCTTGGGGCTCGCCCCACCCAGGGCTCCCTCCTGGAGCATCCCAGGCGGGCGGCACGCCAACAGCCCCCCCCTTGA
ATCTGCAGGGAGCAACTCTCCACTCCATATTTATTTAAACAATTTTTTCCCCAAAGGCATCCATAGTGCACTAGCATTTTCTTGAACCAA
TAATGTATTAAAATTTTTTGATGTCAGCCTTGCATCAAGGGCTTTATCAAAAAGTACAATAATAAATCCTCAGGTAGTACTGGGAATGGA
AGGCTTTGCCATGGGCCTGCTGCGTCAGACCAGTACTGGGAAGGAGGACGGTTGTAAGCAGTTGTTATTTAGTGATATTGTGGGTAACGT
GAGAAGATAGAACAATGCTATAATATATAATGAACACGTGGGTATTTAATAAGAAACATGATGTGAGATTACTTTGTCCCGCTTATTCTC
CTCCCTGTTATCTGCTAGATCTAGTTCTCAATCACTGCTCCCCCGTGTGTATTAGAATGCATGTAAGGTCTTCTTGTGTCCTGATGAAAA
ATATGTGCTTGAAATGAGAAACTTTGATCTCTGCTTACTAATGTGCCCCATGTCCAAGTCCAACCTGCCTGTGCATGACCTGATCATTAC
ATGGCTGTGGTTCCTAAGCCTGTTGCTGAAGTCATTGTCGCTCAGCAATAGGGTGCAGTTTTCCAGGAATAGGCATTTGCCTAATTCCTG
GCATGACACTCTAGTGACTTCCTGGTGAGGCCCAGCCTGTCCTGGTACAGCAGGGTCTTGCTGTAACTCAGACATTCCAAGGGTATGGGA
AGCCATATTCACACCTCACGCTCTGGACATGATTTAGGGAAGCAGGGACACCCCCCGCCCCCCACCTTTGGGATCAGCCTCCGCCATTCC
AAGTCAACACTCTTCTTGAGCAGACCGTGATTTGGAAGAGAGGCACCTGCTGGAAACCACACTTCTTGAAACAGCCTGGGTGACGGTCCT
TTAGGCAGCCTGCCGCCGTCTCTGTCCCGGTTCACCTTGCCGAGAGAGGCGCGTCTGCCCCACCCTCAAACCCTGTGGGGCCTGATGGTG
CTCACGACTCTTCCTGCAAAGGGAACTGAAGACCTCCACATTAAGTGGCTTTTTAACATGAAAAACACGGCAGCTGTAGCTCCCGAGCTA
CTCTCTTGCCAGCATTTTCACATTTTGCCTTTCTCGTGGTAGAAGCCAGTACAGAGAAATTCTGTGGTGGGAACATTCGAGGTGTCACCC
TGCAGAGCTATGGTGAGGTGTGGATAAGGCTTAGGTGCCAGGCTGTAAGCATTCTGAGCTGGGCTTGTTGTTTTTAAGTCCTGTATATGT
ATGTAGTAGTTTGGGTGTGTATATATAGTAGCATTTCAAAATGGACGTACTGGTTTAACCTCCTATCCTTGGAGAGCAGCTGGCTCTCCA
CCTTGTTACACATTATGTTAGAGAGGTAGCGAGCTGCTCTGCTATATGCCTTAAGCCAATATTTACTCATCAGGTCATTATTTTTTACAA
TGGCCATGGAATAAACCATTTTTACAAAAATAAAAACAAAAAAAGCAAGGTGTTTTGGTATAATACCTTTTCAGGTGTGTGTGGATACGT
GGCTGCATGACCGGGTGGGTGGGGGGGAGTGTCTCAGGGTCTTCTGTGACCTCACAGAACTGTCAGACTGTACAGTTTTCCAACTTGCCA


Top

FusionGenePPI for PARD6B_PTPN1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PARD6BRHOQ, CDC42, PARD3, PRKCZ, RAC1, YWHAH, PRKCI, LLGL1, LLGL2, PARD6A, DMBT1, PARD6G, APP, NPM1, WDR83, CRB3, GOLGA2, RHOJ, GMCL1, CEP76, PTPN14, ZZEF1, WWC1, ATAD3C, ARL10, KBTBD7, KBTBD6, PTPN21, RASSF8, HECTD3, CLPTM1, DR1, FOXM1, GNS, HNRNPA1, INPP5B, KIFC1, MYO10, P4HA1, PHKA1, PPP1CA, PSMD5, ROBO1, ROBO2, ICAM5, TP53BP2, SF1, RBM10, AGPS, MKNK1, CCNK, RECQL5, YWHAQ, PROSC, DLGAP4, AVL9, UBR2, LTN1, GOLIM4, VPS28, EPB41L4B, AGGF1, IARS2, EEFSEC, PDF, IFT22, RNF170, CDCA3, ANKRD32, MSANTD4, LRCH3, KIAA2013, MRPL55, EME1, TMEM92PTPN1GSK3B, GRB2, IRS1, CAV1, EGFR, CRK, BCAR1, CTNNB1, STAT5A, STAT5B, NTRK1, NTRK2, NTRK3, LTK, TYK2, JAK2, INSR, IGF1R, GHR, STAM2, ILF3, SLC25A3, MCAT, MARCKSL1, LAMTOR3, HNRNPU, ZMPSTE24, STAT3, ATF2, CSNK2A1, SRC, ATP4A, ASS1, RFWD2, IL1B, ASGR2, HMOX2, SLC39A4, LYPD3, ENPP6, ZACN, PLTP, LYPD6, KRAS, AGR3, BCAS3, CASC3, CASZ1, CCL5, CDH13, DIRAS3, FAM84B, KLK7, MRC2, RHOBTB2, SNAI1, THRSP, VPS45, HERC2, TCTN2, TCTN3, EVC2, TMEM17, TMEM216, ATP6V1B2, ATP6V0A1, COL5A1, STOM, FLOT2, GALNT2, MSN, PHB, ABCD3, SMARCD2, ATP6V0D1, GOSR1, MVP, FLOT1, PHB2, LTN1, GOLIM4, BCOR, WRAP53, MREG, PCNP, KIDINS220, RNF213, ARHGAP39, PTRF, CDH1, ACTB, APLP2, CASC4, SNRPD2, TOMM70A, CTDNEP1, C5AR2, TMEM63A, C3AR1, GPR21, GHITM, SLCO6A1, TMPRSS3, AMTN, MRAP2, GPR114, KIAA1467, SLC39A12, APLNR, DUSP1, DCUN1D5, PISD, COX11, NDUFAF4, NARS, PTRH2, TBC1D15, NPPC, PFN2, ARL1, DHCR24, AIP, RAB5C, PGRMC1, SEC61A1, CDIPT, SLC27A4, ILVBL, DHCR7, TRIP13, ARF4, HEATR3, PCMT1, ARF1, CCDC47, CDK4, FLAD1, RMDN3, CLK2, LAT


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgenePARD6Bchr20:49348389chr20:49177900ENST00000371610+13126_25322373PARD3 and CDC42
HgenePARD6Bchr20:49348389chr20:49177900ENST00000396039+13126_25322116PARD3 and CDC42


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PARD6B_PTPN1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgenePTPN1P18031DB01133Tiludronic acidTyrosine-protein phosphatase non-receptor type 1small moleculeapproved|investigational|vet_approved

Top

RelatedDiseases for PARD6B_PTPN1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePTPN1C0019829Hodgkin Disease1CTD_human
TgenePTPN1C0021655Insulin Resistance1CTD_human
TgenePTPN1C0023893Liver Cirrhosis, Experimental1CTD_human
TgenePTPN1C0025063Mediastinal Neoplasms1CTD_human
TgenePTPN1C0028754Obesity1CTD_human
TgenePTPN1C0035372Rett Syndrome1CTD_human
TgenePTPN1C0036341Schizophrenia1PSYGENET
TgenePTPN1C0079731B-Cell Lymphomas1CTD_human