FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25985

FusionGeneSummary for PARD3_PARD6G

check button Fusion gene summary
Fusion gene informationFusion gene name: PARD3_PARD6G
Fusion gene ID: 25985
HgeneTgene
Gene symbol

PARD3

PARD6G

Gene ID

56288

84552

Gene namepar-3 family cell polarity regulatorpar-6 family cell polarity regulator gamma
SynonymsASIP|Baz|PAR3|PAR3alpha|PARD-3|PARD3A|PPP1R118|SE2-5L16|SE2-5LT1|SE2-5T2PAR-6G|PAR6gamma
Cytomap

10p11.22-p11.21

18q23

Type of geneprotein-codingprotein-coding
Descriptionpartitioning defective 3 homologCTCL tumor antigen se2-5PAR3-alphaatypical PKC isotype-specific interacting proteinbazookapar-3 family cell polarity regulator alphapar-3 partitioning defective 3 homologprotein phosphatase 1, regulatory subunit 118partitioning defective 6 homolog gammaPAR-6 gamma proteinPAR6Dpar-6 partitioning defective 6 homolog gamma
Modification date2018052320180523
UniProtAcc

Q8TEW0

Q9BYG4

Ensembl transtripts involved in fusion geneENST00000545260, ENST00000545693, 
ENST00000350537, ENST00000346874, 
ENST00000374789, ENST00000374790, 
ENST00000374794, ENST00000374788, 
ENST00000466092, ENST00000374776, 
ENST00000340077, ENST00000544292, 
ENST00000374773, ENST00000374768, 
ENST00000353265, ENST00000470488, 
Fusion gene scores* DoF score22 X 13 X 12=34327 X 2 X 7=98
# samples 267
** MAII scorelog2(26/3432*10)=-3.72246602447109
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/98*10)=-0.485426827170242
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PARD3 [Title/Abstract] AND PARD6G [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-61-1737-01APARD3chr10

34985246

-PARD6Gchr18

77960815

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000545260ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000545260ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000545693ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000545693ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000350537ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000350537ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000346874ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000346874ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374789ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374789ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374790ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374790ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374794ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374794ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374788ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374788ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
intron-3CDSENST00000466092ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
intron-3CDSENST00000466092ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374776ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374776ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000340077ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000340077ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
intron-3CDSENST00000544292ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
intron-3CDSENST00000544292ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374773ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
In-frameENST00000374773ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-
intron-3CDSENST00000374768ENST00000353265PARD3chr10

34985246

-PARD6Gchr18

77960815

-
intron-3CDSENST00000374768ENST00000470488PARD3chr10

34985246

-PARD6Gchr18

77960815

-

Top

FusionProtFeatures for PARD3_PARD6G


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PARD3

Q8TEW0

PARD6G

Q9BYG4

Adapter protein involved in asymmetrical cell divisionand cell polarization processes. May play a role in the formationof epithelial tight junctions. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins (Bysimilarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePARD6Gchr10:34985246chr18:77960815ENST00000353265-03134_15124377DomainNote=Pseudo-CRIB
TgenePARD6Gchr10:34985246chr18:77960815ENST00000353265-03158_25124377DomainPDZ
TgenePARD6Gchr10:34985246chr18:77960815ENST00000470488-03134_15124108DomainNote=Pseudo-CRIB
TgenePARD6Gchr10:34985246chr18:77960815ENST00000470488-03158_25124108DomainPDZ

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-2211049_1077741032Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-2211151_1174741032Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-2211201_1224741032Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-2211280_1301741032Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-2241049_1077741320Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-2241151_1174741320Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-2241201_1224741320Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-2241280_1301741320Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-2241049_1077741311Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-2241151_1174741311Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-2241201_1224741311Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-2241280_1301741311Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-2201049_107774989Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-2201151_117474989Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-2201201_122474989Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-2201280_130174989Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-2251049_1077741354Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-2251151_1174741354Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-2251201_1224741354Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-2251280_1301741354Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-2251049_1077741357Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-2251151_1174741357Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-2251201_1224741357Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-2251280_1301741357Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-2211049_1077741245Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-2211151_1174741245Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-2211201_1224741245Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-2211280_1301741245Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-2231049_1077741267Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-2231151_1174741267Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-2231201_1224741267Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-2231280_1301741267Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-2241049_1077741341Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-2241151_1174741341Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-2241201_1224741341Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-2241280_1301741341Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-221984_1042741032Compositional biasNote=Lys-rich
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-224984_1042741320Compositional biasNote=Lys-rich
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-224984_1042741311Compositional biasNote=Lys-rich
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-220984_104274989Compositional biasNote=Lys-rich
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-225984_1042741354Compositional biasNote=Lys-rich
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-225984_1042741357Compositional biasNote=Lys-rich
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-221984_1042741245Compositional biasNote=Lys-rich
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-223984_1042741267Compositional biasNote=Lys-rich
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-224984_1042741341Compositional biasNote=Lys-rich
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-221271_359741032DomainPDZ 1
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-221461_546741032DomainPDZ 2
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-221590_677741032DomainPDZ 3
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-224271_359741320DomainPDZ 1
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-224461_546741320DomainPDZ 2
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-224590_677741320DomainPDZ 3
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-224271_359741311DomainPDZ 1
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-224461_546741311DomainPDZ 2
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-224590_677741311DomainPDZ 3
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-220271_35974989DomainPDZ 1
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-220461_54674989DomainPDZ 2
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-220590_67774989DomainPDZ 3
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-225271_359741354DomainPDZ 1
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-225461_546741354DomainPDZ 2
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-225590_677741354DomainPDZ 3
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-225271_359741357DomainPDZ 1
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-225461_546741357DomainPDZ 2
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-225590_677741357DomainPDZ 3
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-221271_359741245DomainPDZ 1
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-221461_546741245DomainPDZ 2
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-221590_677741245DomainPDZ 3
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-223271_359741267DomainPDZ 1
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-223461_546741267DomainPDZ 2
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-223590_677741267DomainPDZ 3
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-224271_359741341DomainPDZ 1
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-224461_546741341DomainPDZ 2
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-224590_677741341DomainPDZ 3
TgenePARD6Gchr10:34985246chr18:77960815ENST00000353265-0318_9824377DomainPB1
TgenePARD6Gchr10:34985246chr18:77960815ENST00000470488-0318_9824108DomainPB1


Top

FusionGeneSequence for PARD3_PARD6G


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PARD3_ENST00000545260_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000545260_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000545693_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000545693_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000350537_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000350537_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000346874_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000346874_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000374789_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000374789_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000374790_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000374790_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000374794_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000374794_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000374788_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000374788_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000374776_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000374776_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000340077_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000340077_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG

>In-frame_PARD3_ENST00000374773_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_427aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG
KFEDFYKLVVHTHHISNSDVTIGTADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRA
HLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVN
GIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDNDVVIEGTLEPA

>In-frame_PARD3_ENST00000374773_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_158aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRFGAEFRRFSLDRHKPG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PARD3_ENST00000545260_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000545260_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000545693_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000545693_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000350537_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000350537_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000346874_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000346874_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000374789_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000374789_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000374790_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000374790_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000374794_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000374794_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000374788_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000374788_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000374776_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000374776_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000340077_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000340077_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC

>In-frame_PARD3_ENST00000374773_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_1281nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCA
CACCTGGACATCGGCCTCCCGCGCGACTTCCGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTG
CCCGGCATCTTCATCTCGCGCATGGTACCCGGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCC
AACCAGCGCAACAACGTGGTGCGCGGCGGCCGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCA
CGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCAC

>In-frame_PARD3_ENST00000374773_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_474nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGAC
CTGCTGCCCATCAACAATGATGACAACTTCTGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PARD3_ENST00000545260_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4150nt
CCCAGCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTG
CGGGCGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCC
CCCCGGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCG
GCCTCGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACC
CGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGAC
GATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTG
CACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTC
TGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCG
CTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTC
CGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTG
GGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCC
GGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGAC
CAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGC
CGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCC
GACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCA
GGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGC
TCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAG
AGGCCCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACC
ACAAAAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAA
TGAACGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAA
AAATGCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAG
TAAGTTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAG
AGGCTGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGA
GGTCAGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCC
TGTAATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGC
ACTCCAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATT
CCAGATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGT
TCCGGGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTC
CTGGGTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTA
GAGATGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGA
TTATAGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAG
GAAGCAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTG
ACTGACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTC
ATTTGCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGT
CACTGGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGAT
CTTCCAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATG
TTACATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTC
CCGCTGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAA
CTGCATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATT
CCTGCACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGAC
CTCTCCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGG
AACTAAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCG
GCTATCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAG
ATTTGTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTT
CTCCTTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGA

>In-frame_PARD3_ENST00000545260_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1076nt
CCCAGCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTG
CGGGCGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCC
CCCCGGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCG
GCCTCGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACC
CGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGAC
GATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTG
CACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTC
TGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTC
AGCTCAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCC
CTCATGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCC

>In-frame_PARD3_ENST00000545693_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4150nt
CCCAGCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTG
CGGGCGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCC
CCCCGGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCG
GCCTCGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACC
CGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGAC
GATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTG
CACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTC
TGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCG
CTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTC
CGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTG
GGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCC
GGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGAC
CAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGC
CGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCC
GACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCA
GGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGC
TCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAG
AGGCCCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACC
ACAAAAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAA
TGAACGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAA
AAATGCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAG
TAAGTTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAG
AGGCTGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGA
GGTCAGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCC
TGTAATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGC
ACTCCAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATT
CCAGATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGT
TCCGGGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTC
CTGGGTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTA
GAGATGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGA
TTATAGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAG
GAAGCAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTG
ACTGACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTC
ATTTGCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGT
CACTGGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGAT
CTTCCAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATG
TTACATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTC
CCGCTGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAA
CTGCATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATT
CCTGCACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGAC
CTCTCCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGG
AACTAAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCG
GCTATCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAG
ATTTGTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTT
CTCCTTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGA

>In-frame_PARD3_ENST00000545693_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1076nt
CCCAGCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTG
CGGGCGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCC
CCCCGGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCG
GCCTCGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACC
CGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGAC
GATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTG
CACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTC
TGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTC
AGCTCAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCC
CTCATGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCC

>In-frame_PARD3_ENST00000350537_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4146nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGT
GCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTCCGCC
CCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCT
TCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCCGGGG
GCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGACCAGG
TCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGCCGCG
CGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCCGACG
AGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCA
GCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCC
TGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAGAGGC
CCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACCACAA
AAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAATGAA
CGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAAAAAT
GCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAGTAAG
TTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAGAGGC
TGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGAGGTC
AGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCCTGTA
ATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGCACTC
CAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATTCCAG
ATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGTTCCG
GGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTCCTGG
GTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTAGAGA
TGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGATTAT
AGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAGGAAG
CAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTGACTG
ACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTCATTT
GCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGTCACT
GGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGATCTTC
CAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATGTTAC
ATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTCCCGC
TGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAACTGC
ATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATTCCTG
CACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGACCTCT
CCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGGAACT
AAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCGGCTA
TCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAGATTT
GTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTTCTCC
TTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGAGTAA

>In-frame_PARD3_ENST00000350537_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1072nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTCAGCT
CAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCCCTCA
TGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCCTGCA

>In-frame_PARD3_ENST00000346874_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4146nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGT
GCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTCCGCC
CCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCT
TCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCCGGGG
GCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGACCAGG
TCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGCCGCG
CGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCCGACG
AGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCA
GCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCC
TGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAGAGGC
CCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACCACAA
AAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAATGAA
CGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAAAAAT
GCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAGTAAG
TTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAGAGGC
TGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGAGGTC
AGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCCTGTA
ATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGCACTC
CAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATTCCAG
ATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGTTCCG
GGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTCCTGG
GTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTAGAGA
TGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGATTAT
AGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAGGAAG
CAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTGACTG
ACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTCATTT
GCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGTCACT
GGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGATCTTC
CAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATGTTAC
ATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTCCCGC
TGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAACTGC
ATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATTCCTG
CACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGACCTCT
CCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGGAACT
AAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCGGCTA
TCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAGATTT
GTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTTCTCC
TTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGAGTAA

>In-frame_PARD3_ENST00000346874_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1072nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTCAGCT
CAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCCCTCA
TGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCCTGCA

>In-frame_PARD3_ENST00000374789_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4146nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGT
GCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTCCGCC
CCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCT
TCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCCGGGG
GCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGACCAGG
TCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGCCGCG
CGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCCGACG
AGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCA
GCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCC
TGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAGAGGC
CCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACCACAA
AAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAATGAA
CGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAAAAAT
GCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAGTAAG
TTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAGAGGC
TGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGAGGTC
AGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCCTGTA
ATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGCACTC
CAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATTCCAG
ATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGTTCCG
GGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTCCTGG
GTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTAGAGA
TGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGATTAT
AGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAGGAAG
CAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTGACTG
ACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTCATTT
GCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGTCACT
GGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGATCTTC
CAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATGTTAC
ATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTCCCGC
TGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAACTGC
ATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATTCCTG
CACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGACCTCT
CCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGGAACT
AAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCGGCTA
TCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAGATTT
GTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTTCTCC
TTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGAGTAA

>In-frame_PARD3_ENST00000374789_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1072nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTCAGCT
CAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCCCTCA
TGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCCTGCA

>In-frame_PARD3_ENST00000374790_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4146nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGT
GCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTCCGCC
CCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCT
TCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCCGGGG
GCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGACCAGG
TCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGCCGCG
CGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCCGACG
AGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCA
GCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCC
TGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAGAGGC
CCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACCACAA
AAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAATGAA
CGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAAAAAT
GCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAGTAAG
TTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAGAGGC
TGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGAGGTC
AGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCCTGTA
ATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGCACTC
CAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATTCCAG
ATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGTTCCG
GGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTCCTGG
GTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTAGAGA
TGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGATTAT
AGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAGGAAG
CAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTGACTG
ACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTCATTT
GCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGTCACT
GGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGATCTTC
CAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATGTTAC
ATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTCCCGC
TGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAACTGC
ATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATTCCTG
CACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGACCTCT
CCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGGAACT
AAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCGGCTA
TCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAGATTT
GTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTTCTCC
TTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGAGTAA

>In-frame_PARD3_ENST00000374790_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1072nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTCAGCT
CAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCCCTCA
TGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCCTGCA

>In-frame_PARD3_ENST00000374794_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4146nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGT
GCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTCCGCC
CCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCT
TCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCCGGGG
GCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGACCAGG
TCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGCCGCG
CGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCCGACG
AGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCA
GCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCC
TGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAGAGGC
CCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACCACAA
AAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAATGAA
CGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAAAAAT
GCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAGTAAG
TTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAGAGGC
TGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGAGGTC
AGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCCTGTA
ATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGCACTC
CAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATTCCAG
ATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGTTCCG
GGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTCCTGG
GTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTAGAGA
TGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGATTAT
AGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAGGAAG
CAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTGACTG
ACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTCATTT
GCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGTCACT
GGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGATCTTC
CAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATGTTAC
ATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTCCCGC
TGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAACTGC
ATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATTCCTG
CACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGACCTCT
CCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGGAACT
AAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCGGCTA
TCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAGATTT
GTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTTCTCC
TTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGAGTAA

>In-frame_PARD3_ENST00000374794_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1072nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTCAGCT
CAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCCCTCA
TGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCCTGCA

>In-frame_PARD3_ENST00000374788_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4146nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGT
GCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTCCGCC
CCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCT
TCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCCGGGG
GCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGACCAGG
TCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGCCGCG
CGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCCGACG
AGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCA
GCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCC
TGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAGAGGC
CCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACCACAA
AAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAATGAA
CGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAAAAAT
GCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAGTAAG
TTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAGAGGC
TGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGAGGTC
AGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCCTGTA
ATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGCACTC
CAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATTCCAG
ATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGTTCCG
GGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTCCTGG
GTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTAGAGA
TGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGATTAT
AGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAGGAAG
CAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTGACTG
ACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTCATTT
GCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGTCACT
GGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGATCTTC
CAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATGTTAC
ATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTCCCGC
TGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAACTGC
ATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATTCCTG
CACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGACCTCT
CCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGGAACT
AAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCGGCTA
TCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAGATTT
GTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTTCTCC
TTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGAGTAA

>In-frame_PARD3_ENST00000374788_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1072nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTCAGCT
CAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCCCTCA
TGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCCTGCA

>In-frame_PARD3_ENST00000374776_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4146nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGT
GCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTCCGCC
CCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCT
TCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCCGGGG
GCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGACCAGG
TCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGCCGCG
CGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCCGACG
AGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCA
GCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCC
TGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAGAGGC
CCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACCACAA
AAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAATGAA
CGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAAAAAT
GCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAGTAAG
TTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAGAGGC
TGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGAGGTC
AGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCCTGTA
ATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGCACTC
CAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATTCCAG
ATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGTTCCG
GGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTCCTGG
GTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTAGAGA
TGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGATTAT
AGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAGGAAG
CAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTGACTG
ACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTCATTT
GCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGTCACT
GGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGATCTTC
CAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATGTTAC
ATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTCCCGC
TGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAACTGC
ATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATTCCTG
CACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGACCTCT
CCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGGAACT
AAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCGGCTA
TCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAGATTT
GTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTTCTCC
TTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGAGTAA

>In-frame_PARD3_ENST00000374776_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1072nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTCAGCT
CAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCCCTCA
TGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCCTGCA

>In-frame_PARD3_ENST00000340077_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4150nt
CCCAGCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTG
CGGGCGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCC
CCCCGGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCG
GCCTCGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACC
CGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGAC
GATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTG
CACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTC
TGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCG
CTGTGCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTC
CGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTG
GGCTTCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCC
GGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGAC
CAGGTCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGC
CGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCC
GACGAGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCA
GGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGC
TCCCTGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAG
AGGCCCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACC
ACAAAAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAA
TGAACGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAA
AAATGCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAG
TAAGTTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAG
AGGCTGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGA
GGTCAGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCC
TGTAATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGC
ACTCCAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATT
CCAGATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGT
TCCGGGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTC
CTGGGTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTA
GAGATGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGA
TTATAGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAG
GAAGCAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTG
ACTGACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTC
ATTTGCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGT
CACTGGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGAT
CTTCCAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATG
TTACATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTC
CCGCTGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAA
CTGCATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATT
CCTGCACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGAC
CTCTCCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGG
AACTAAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCG
GCTATCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAG
ATTTGTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTT
CTCCTTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGA

>In-frame_PARD3_ENST00000340077_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1076nt
CCCAGCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTG
CGGGCGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCC
CCCCGGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCG
GCCTCGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACC
CGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGAC
GATAAAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTG
CACACCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTC
TGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTC
AGCTCAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCC
CTCATGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCC

>In-frame_PARD3_ENST00000374773_chr10_34985246_-_PARD6G_ENST00000353265_chr18_77960815_-_4146nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAGGCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGT
GCAGGCGGAGGCGGGCGCTGGGCGCGCTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTCCGCC
CCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGGCTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCT
TCTACATCCGCGATGGCGCCAGCGTGCGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCCGGGG
GCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAACGGCATTGAGGTGGCCGGGAAGACGCTGGACCAGG
TCACGGACATGATGATCGCCAACAGCCACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGCCGCG
CGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCCGCCCCGCGCGTCCTGCAGAACTTCCACCCCGACG
AGGCGGAGAGCGATGAGGACAACGACGTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCAGGCA
GCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCCCTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCC
TGCGGGCCGACCCCCGTCACAGCCTGGCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAGACTCCCGAGAGGC
CCCCAAATCCTAGCTCCAGTTCCCCGGTAAGGACAGGGACAGGACCTGCAGACTGCATCCGCTCATTTTTTGTTGTTTTTGTGACCACAA
AAACAACGCTGCTCTTTGTTTCAACTTCCGGATATAAAAACACAAGTATTGCCTATTTTTATAGAATTTCGCCACAGAACTTAAAATGAA
CGCCTGTAGAGACACTCTATACCAGGCCTGAGTGCAGGTCTTGGCGCCTTTGCAAAGTGATAGAAAAGATCTGACCAAGTGCAAAAAAAT
GCTTTTTAAAATTTTTACAAATACTTTGTTTTTAAAGTGAAGCTTTAAAATTACTTTTTTAAAATAGTCAAATTCATGTTTTTAAGTAAG
TTGGCCCATGCAACATATCTCAGCATTCTTGCTGTGCTCTCTGCTGACTTGCAGGCGAGGCCGACTGTGCTGATGTACGTGACAAGAGGC
TGGTTTTTAATAACGAATGCAGCCAGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCTACGTGGGCTGATCACGAGGTC
AGGAGGTCGAGACCAGCATGGCCAACATGGTGAAACCCTGTCTCTACTAAAAATATAAAAATTAGCCAGGTGTGGTGGCAGGCGCCTGTA
ATCCCAGCTACCTTGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCACTGCACTC
CAGCCTGGGTGACAGAGCAAGACTCTGTCTCGGGAAAAAAAAAAAATACACCCAAACCTGTCCATGTACAACCATGGAGATGAATTCCAG
ATTTTCACACTGTTCATAGTCATAATTCGGTTGGGACAGGAGAGCTCCCACCAGCACACTTATGGCACCCGCAGCTGTGGAATTGTTCCG
GGGCTTTTTTTTGTTTGTTTTGAGACATAGTGTCTTGTTCTGTCATCCAAGCTGGAGGGATCTCAGCTCACTGCAACCTCCGCCTCCTGG
GTTCAAGCAATTCTCCTGCCTCAGCCTCCCAAGGAGCTGGGACAGGCACATGCCACCATACCCAGCTAATTTTTGTATTTTTAGTAGAGA
TGGGATTTCACCACGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGTGATACGGTCCCCCCTCAGCCTCCAAAAATGCTAGGATTAT
AGACGTGAGCCACAGCACCAGACCAGGGGCTATTTTTGTGACCCACATAGGTGGCCCATTCAGCCTCAAGGGGAAATCCAGGGTAGGAAG
CAGCAGCTCTGCTGGACTGGGCTCAGCAGTCCCATTTGGGATGTAAGCCTCTATTGCCTCTAAGATGACCCTTTTCCTGTGGGTTGACTG
ACTCTGAGGGCGATTTCGGAAATGTTTTCAGCAGAAATGAAGGATAAGCATCGCACATGTCCAGCAATGTCTTTGAGAATGCAGTCATTT
GCACGTGAGTTCTCATCTTTGTTTTCTGAAACAGACGTTTCTTTTAGTAAGTCACAATACATGCTAATTTTCATTTCTAGAATGGTCACT
GGCAGTTCTCACTTTTAACTATAAGAAGTCACGTGGAACTTAGTGATTTTTAACAAATACTAAATTCATCCTCACTTTATGTTGATCTTC
CAGCAACGTTTATATATTTAGTAATTTTAAAAATTCCTATTTGATACAATTAAATTTTATATAATGTGTTTTGCTTGAATAAAATGTTAC
ATTTATACTTTGAGAACTCTGACCAAATCTTTCATACAGATACAGGTAAAGAAATATTTTTCTAGGTTGTCGGAGCTGCGTACCTCCCGC
TGCTTCTCCTTGTGGTCCAGCACCACCTGCTGGTCAGTGGCAGAACTGTCCTGACTTCGTGAACATGGAACTGCTAAGAGGGAAAACTGC
ATCTCAGCATTTTCATTTTTTCTGAATATTAAGTGAAAAGCAAGTTCTATTTTTAAGAAATAGCTTTTGCTGAGGAGTTGTGAATTCCTG
CACCTGTGTTTGATGTTATTTGTATGCAATGGATTGCTGGCCCTTTGTTCCTAAGCAAGAGAAGACCAAAGATGCTTCCCCATGACCTCT
CCGGTGAGGATCCGCACCCCCCGGACTTGCTCTCTGATGAAGGGCATGTCGTTCAGTGCCCCAGCAGTCAGAAGCAGTTTTTGTGGAACT
AAAACTAATAATGTTACCCTCACAAAGGAAATGTTCTTTTACTAAGTTATTGCTGATTCTTGAATGTCTGTTATATAACTGGGTCGGCTA
TCAAGAAGGAAGGTTATATTTCTTATCACATTTTAAGTTGTTAAGCAAATGTGAGTTTTTTTTTAAGAAATGAGGCTTTCACTGAGATTT
GTGTGCTATTCATAATTTTAGGAATTACTGCTTAGAACAGCTGCTTGGGTGTATTTTTCTACACAGGTCTGTACTTCTGCCACTTTCTCC
TTTTAAAAAAACAAAACTATGCATATTATGTATTAAAGTTTTCTTGGTTTTATATATCAGAGAATAAAAACTTTTTTGACTTTTGAGTAA

>In-frame_PARD3_ENST00000374773_chr10_34985246_-_PARD6G_ENST00000470488_chr18_77960815_-_1072nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGATTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGGAAGTTTGAAGATTTCTACAAGCTGGTTGTGCACA
CCCACCATATCTCCAACAGTGATGTAACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTCTGCA
AGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGATGACGGAGCCCTGCGACCAGGAACCTGACTCTTCAGCT
CAAATCTTGGTTTGAAAGGGGGACTTCTCTGTGCCCCTGTTGTCGGCATGCCATGGTAGAGAATGGATGGCCCACGCAGCTGGCCCCTCA
TGAGACCCCAGCCATCTCATTCCACTGGGAGCCACGTCAGGACGAAGGAGGACTGGGAGGGGCGTCTGGCTGCGTGGTGTGGGGCCTGCA


Top

FusionGenePPI for PARD3_PARD6G


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PARD3YWHAB, YWHAG, SFN, ECT2, F11R, JAM2, JAM3, PVRL3, PARD6A, PARD6B, PARD6G, PRKCI, PRKCZ, YWHAZ, YWHAH, DCAF7, PNMA1, RASSF8, CCDC88A, PNMA2, LLGL1, SIAH1, HSPA8, HSPA6, HSPD1, PSME3, PSME2, RPS3, RPS18, PFKP, KPNA4, ANP32E, TJP1, VHL, ARHGAP17, AMOT, YWHAE, GAB1, MARK2, INADL, AMOTL2, LATS1, LATS2, YAP1, RASSF7, PSMC3, TP53BP2, RASSF9, RASSF10, SMAD7, SMAD4, SMAD1, SMAD2, SMAD3, CEP19, TMEM17, VAPA, MMGT1, CTNNB1, PPP1CA, CDH1, TRIM25PARD6GPARD3, PRKCZ, RAC1, CDC42, YWHAH, PRKCI, LLGL1, YWHAE, PARD6B, MARK2, LLGL2, BRINP1, HSPA4, PNMA3, PNMA2, PNMAL1, WDR83, RHOJ


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgenePARD6Gchr10:34985246chr18:77960815ENST00000353265-03127_25424377PARD3 and CDC42
TgenePARD6Gchr10:34985246chr18:77960815ENST00000470488-03127_25424108PARD3 and CDC42


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-221935_1356741032FRMD4A
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-224935_1356741320FRMD4A
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-224935_1356741311FRMD4A
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-220935_135674989FRMD4A
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-225935_1356741354FRMD4A
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-225935_1356741357FRMD4A
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-221935_1356741245FRMD4A
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-223935_1356741267FRMD4A
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-224935_1356741341FRMD4A
HgenePARD3chr10:34985246chr18:77960815ENST00000340077-221712_936741032PRKCI and PRKCZ
HgenePARD3chr10:34985246chr18:77960815ENST00000346874-224712_936741320PRKCI and PRKCZ
HgenePARD3chr10:34985246chr18:77960815ENST00000350537-224712_936741311PRKCI and PRKCZ
HgenePARD3chr10:34985246chr18:77960815ENST00000374776-220712_93674989PRKCI and PRKCZ
HgenePARD3chr10:34985246chr18:77960815ENST00000374788-225712_936741354PRKCI and PRKCZ
HgenePARD3chr10:34985246chr18:77960815ENST00000374789-225712_936741357PRKCI and PRKCZ
HgenePARD3chr10:34985246chr18:77960815ENST00000374794-221712_936741245PRKCI and PRKCZ
HgenePARD3chr10:34985246chr18:77960815ENST00000545260-223712_936741267PRKCI and PRKCZ
HgenePARD3chr10:34985246chr18:77960815ENST00000545693-224712_936741341PRKCI and PRKCZ


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PARD3_PARD6G


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PARD3_PARD6G


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource