FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25978

FusionGeneSummary for PARD3_HTRA1

check button Fusion gene summary
Fusion gene informationFusion gene name: PARD3_HTRA1
Fusion gene ID: 25978
HgeneTgene
Gene symbol

PARD3

HTRA1

Gene ID

56288

5654

Gene namepar-3 family cell polarity regulatorHtrA serine peptidase 1
SynonymsASIP|Baz|PAR3|PAR3alpha|PARD-3|PARD3A|PPP1R118|SE2-5L16|SE2-5LT1|SE2-5T2ARMD7|CADASIL2|CARASIL|HtrA|L56|ORF480|PRSS11
Cytomap

10p11.22-p11.21

10q26.13

Type of geneprotein-codingprotein-coding
Descriptionpartitioning defective 3 homologCTCL tumor antigen se2-5PAR3-alphaatypical PKC isotype-specific interacting proteinbazookapar-3 family cell polarity regulator alphapar-3 partitioning defective 3 homologprotein phosphatase 1, regulatory subunit 118serine protease HTRA1IGFBP5-proteasehigh-temperature requirement A serine peptidase 1protease, serine, 11 (IGF binding)
Modification date2018052320180527
UniProtAcc

Q8TEW0

Q92743

Ensembl transtripts involved in fusion geneENST00000545260, ENST00000545693, 
ENST00000350537, ENST00000346874, 
ENST00000374789, ENST00000374790, 
ENST00000374794, ENST00000374788, 
ENST00000466092, ENST00000374776, 
ENST00000340077, ENST00000544292, 
ENST00000374773, ENST00000374768, 
ENST00000368984, 
Fusion gene scores* DoF score22 X 13 X 12=34323 X 3 X 2=18
# samples 263
** MAII scorelog2(26/3432*10)=-3.72246602447109
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PARD3 [Title/Abstract] AND HTRA1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDHNSCTCGA-CV-6953-01APARD3chr10

34620045

-HTRA1chr10

124248418

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000545260ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000545693ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000350537ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000346874ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000374789ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000374790ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000374794ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000374788ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
5UTR-3CDSENST00000466092ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000374776ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000340077ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
Frame-shitENST00000544292ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
In-frameENST00000374773ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+
intron-3CDSENST00000374768ENST00000368984PARD3chr10

34620045

-HTRA1chr10

124248418

+

Top

FusionProtFeatures for PARD3_HTRA1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PARD3

Q8TEW0

HTRA1

Q92743

Serine protease with a variety of targets, includingextracellular matrix proteins such as fibronectin. HTRA1-generatedfibronectin fragments further induce synovial cells to up-regulateMMP1 and MMP3 production. May also degrade proteoglycans, such asaggrecan, decorin and fibromodulin. Through cleavage ofproteoglycans, may release soluble FGF-glycosaminoglycan complexesthat promote the range and intensity of FGF signals in theextracellular space. Regulates the availability of insulin-likegrowth factors (IGFs) by cleaving IGF-binding proteins. Inhibitssignaling mediated by TGF-beta family members. This activityrequires the integrity of the catalytic site, although it isunclear whether TGF-beta proteins are themselves degraded. Byacting on TGF-beta signaling, may regulate many physiologicalprocesses, including retinal angiogenesis and neuronal survivaland maturation during development. Intracellularly, degrades TSC2,leading to the activation of TSC2 downstream targets.{ECO:0000269|PubMed:16377621, ECO:0000269|PubMed:20671064,ECO:0000269|PubMed:9852107}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-1921271_3599441032DomainPDZ 1
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-1921461_5469441032DomainPDZ 2
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-1921590_6779441032DomainPDZ 3
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-1924271_3599471320DomainPDZ 1
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-1924461_5469471320DomainPDZ 2
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-1924590_6779471320DomainPDZ 3
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-1824271_3599011311DomainPDZ 1
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-1824461_5469011311DomainPDZ 2
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-1824590_6779011311DomainPDZ 3
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-1820271_359901989DomainPDZ 1
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-1820461_546901989DomainPDZ 2
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-1820590_677901989DomainPDZ 3
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-1925271_3599441354DomainPDZ 1
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-1925461_5469441354DomainPDZ 2
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-1925590_6779441354DomainPDZ 3
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-1925271_3599471357DomainPDZ 1
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-1925461_5469471357DomainPDZ 2
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-1925590_6779471357DomainPDZ 3
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-1621271_3598721245DomainPDZ 1
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-1621461_5468721245DomainPDZ 2
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-1621590_6778721245DomainPDZ 3
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-1723271_3598571267DomainPDZ 1
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-1723461_5468571267DomainPDZ 2
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-1723590_6778571267DomainPDZ 3
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-1824271_3599311341DomainPDZ 1
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-1824461_5469311341DomainPDZ 2
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-1824590_6779311341DomainPDZ 3
TgeneHTRA1chr10:34620045chr10:124248418ENST00000368984+09365_467157481DomainPDZ
TgeneHTRA1chr10:34620045chr10:124248418ENST00000368984+09204_364157481RegionNote=Serine protease

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-19211049_10779441032Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-19211151_11749441032Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-19211201_12249441032Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-19211280_13019441032Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-19241049_10779471320Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-19241151_11749471320Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-19241201_12249471320Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-19241280_13019471320Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-18241049_10779011311Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-18241151_11749011311Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-18241201_12249011311Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-18241280_13019011311Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-18201049_1077901989Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-18201151_1174901989Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-18201201_1224901989Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-18201280_1301901989Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-19251049_10779441354Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-19251151_11749441354Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-19251201_12249441354Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-19251280_13019441354Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-19251049_10779471357Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-19251151_11749471357Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-19251201_12249471357Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-19251280_13019471357Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-16211049_10778721245Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-16211151_11748721245Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-16211201_12248721245Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-16211280_13018721245Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-17231049_10778571267Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-17231151_11748571267Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-17231201_12248571267Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-17231280_13018571267Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-18241049_10779311341Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-18241151_11749311341Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-18241201_12249311341Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-18241280_13019311341Coiled coilOntology_term=ECO:0000255
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-1921984_10429441032Compositional biasNote=Lys-rich
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-1924984_10429471320Compositional biasNote=Lys-rich
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-1824984_10429011311Compositional biasNote=Lys-rich
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-1820984_1042901989Compositional biasNote=Lys-rich
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-1925984_10429441354Compositional biasNote=Lys-rich
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-1925984_10429471357Compositional biasNote=Lys-rich
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-1621984_10428721245Compositional biasNote=Lys-rich
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-1723984_10428571267Compositional biasNote=Lys-rich
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-1824984_10429311341Compositional biasNote=Lys-rich
TgeneHTRA1chr10:34620045chr10:124248418ENST00000368984+0933_100157481DomainIGFBP N-terminal
TgeneHTRA1chr10:34620045chr10:124248418ENST00000368984+0998_157157481DomainKazal-like


Top

FusionGeneSequence for PARD3_HTRA1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PARD3_ENST00000545260_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1181aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEH
ENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQR
APRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNIL
PRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELKAEDEDIVLTPDGTREFLTFEVPLNDSG
SAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKC
NELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVP
VASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQN
TVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKK
KYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIM

>In-frame_PARD3_ENST00000545693_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1255aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDD
MVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSG
YNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLI
AVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNA
ALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQ
SMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRII
RGRGCNESFRAAIDKSYDKPAVDDDDEGMETWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIV
TNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKE
LGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAK

>In-frame_PARD3_ENST00000350537_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1225aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDD
MVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSG
YNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLI
AVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNA
ALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQ
IADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGME
TWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVD
EKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLD
GEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAG

>In-frame_PARD3_ENST00000346874_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1271aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDD
MVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSG
YNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAA
SKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSP
DVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVP
VASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQN
TVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKK
KYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIM

>In-frame_PARD3_ENST00000374789_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1271aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDD
MVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSG
YNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAA
SKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSP
DVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVP
VASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQN
TVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKK
KYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIM

>In-frame_PARD3_ENST00000374790_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1211aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEH
ENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQR
APRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNIL
PRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELKAEDEDIVLTPDGTREFLTFEVPLNDSG
SAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKC
NELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQK
AGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETWQEDPNSLRHKYN
FIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQG
KLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAG
ISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQ

>In-frame_PARD3_ENST00000374794_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1196aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEH
ENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQR
APRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNIL
PRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELKAEDEDIVLTPDGTREFLTFEVPLNDSG
SAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKC
NELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGSSPSRDVGPSLGLK
KSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETWQEDPNSLRHKYNFIADVVEKIAPAVVH
IELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRP
GEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLT
ESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRE

>In-frame_PARD3_ENST00000374788_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1268aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDD
MVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSG
YNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAA
SKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVD
PVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLN
GDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVAS
GSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVT
TGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYI
GIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITV

>In-frame_PARD3_ENST00000374776_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1225aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDD
MVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSG
YNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLI
AVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNA
ALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQ
IADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGME
TWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVD
EKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLD
GEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAG

>In-frame_PARD3_ENST00000340077_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1268aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDD
MVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSG
YNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAA
SKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVD
PVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLN
GDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVAS
GSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVT
TGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYI
GIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITV

>In-frame_PARD3_ENST00000374773_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_1238aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDG
TSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDD
MVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSG
YNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAA
SKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVD
PVLAFQREGFGRQIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSY
DKPAVDDDDEGMETWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELK
NGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAII
NYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PARD3_ENST00000545260_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3543nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGA
CATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTG
GGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACAT
GAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTT
CGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAG
AACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGA
GCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCT
CCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTT
AAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTC
CCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAA
GAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGG
GAACTGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGA
TCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGA
GGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGAT
GCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGC
AATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCC
CTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACA
GTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGC
TCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCA
GATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAA
GCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTG
ACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGAC
AAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAAC
TTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCG
GTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTT
GAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGC
AAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAAC
ACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGAC
GCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGA
ATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAG
AAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCA
GGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAG
TCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATG

>In-frame_PARD3_ENST00000545693_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3765nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCT
AACCAATTTCAGAGAGACAATGCTCGCTCGTCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAG
GATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGAT
ATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGG
TTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGC
GACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCA
GCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGAC
AACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGA
CTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGT
TATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTA
ACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGA
CTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTG
AGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACC
AGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAAC
CACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATA
GCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGA
GGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATT
GAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCT
GCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTG
CCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCC
AAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAG
AGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGT
ATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAG
TCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATC
AGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAG
ACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATC
GAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTG
ACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGAT
GAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGA
GAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAG
CTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGAC
GGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAG
TCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAA
GAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGT
GGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGC

>In-frame_PARD3_ENST00000350537_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3675nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCT
AACCAATTTCAGAGAGACAATGCTCGCTCGTCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAG
GATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGAT
ATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGG
TTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGC
GACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCA
GCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGAC
AACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGA
CTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGT
TATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTA
ACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGA
CTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTG
AGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACC
AGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAAC
CACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATA
GCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGA
GGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATT
GAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCT
GCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTG
CCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCC
AAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAG
ATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAG
TCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATC
AGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAG
ACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATC
GAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTG
ACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGAT
GAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGA
GAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAG
CTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGAC
GGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAG
TCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAA
GAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGT
GGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGC

>In-frame_PARD3_ENST00000346874_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3813nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCT
AACCAATTTCAGAGAGACAATGCTCGCTCGTCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAG
GATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGAT
ATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGG
TTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGC
GACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCA
GCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGAC
AACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGA
CTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGT
TATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTA
ACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGA
CTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTG
AGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAA
GCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGC
CTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCA
TCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAA
ACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTG
AAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGT
GGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTGAGTCAGGTAAATACCAGCTGTCCCCTACA
GTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGC
TCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCA
GATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGT
CAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAA
GCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTG
ACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGAC
AAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAAC
TTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCG
GTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTT
GAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGC
AAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAAC
ACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGAC
GCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGA
ATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAG
AAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCA
GGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAG
TCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATG

>In-frame_PARD3_ENST00000374789_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3813nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCT
AACCAATTTCAGAGAGACAATGCTCGCTCGTCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAG
GATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGAT
ATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGG
TTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGC
GACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCA
GCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGAC
AACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGA
CTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGT
TATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTA
ACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGA
CTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTG
AGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAA
GCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGC
CTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCA
TCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAA
ACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTG
AAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGT
GGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTGAGTCAGGTAAATACCAGCTGTCCCCTACA
GTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGC
TCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCA
GATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGT
CAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAA
GCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTG
ACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGAC
AAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAAC
TTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCG
GTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTT
GAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGC
AAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAAC
ACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGAC
GCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGA
ATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAG
AAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCA
GGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAG
TCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATG

>In-frame_PARD3_ENST00000374790_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3633nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGA
CATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTG
GGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACAT
GAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTT
CGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAG
AACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGA
GCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCT
CCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTT
AAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTC
CCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAA
GAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGG
GAACTGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGA
TCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGA
GGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGAT
GCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGC
AATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCC
CTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACA
GTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGC
TCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCA
GATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGT
CAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAA
GCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTG
ACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGAC
AAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAAC
TTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCG
GTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTT
GAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGC
AAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAAC
ACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGAC
GCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGA
ATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAG
AAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCA
GGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAG
TCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATG

>In-frame_PARD3_ENST00000374794_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3588nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGA
CATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTG
GGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACAT
GAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTT
CGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAG
AACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGA
GCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCT
CCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTT
AAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTC
CCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAA
GAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGG
GAACTGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGA
TCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGA
GGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGAT
GCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGC
AATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCC
CTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACA
GTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGC
TCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCA
GATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGT
CAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTAGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAG
AAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATA
ATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATG
GAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCAT
ATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATC
GTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTG
GATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCG
GGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAA
GAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTG
GACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACG
GAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCC
AAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCT
GGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAA

>In-frame_PARD3_ENST00000374788_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3804nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCT
AACCAATTTCAGAGAGACAATGCTCGCTCGTCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAG
GATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGAT
ATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGG
TTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGC
GACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCA
GCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGAC
AACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGA
CTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGT
TATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTA
ACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGA
CTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTG
AGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAA
GCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGC
CTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCA
TCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAA
ACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTG
AAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGT
GGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATG
CCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGAT
GATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGAT
CCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGAT
TTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCT
CCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAAT
GGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTAT
GATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCG
GACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGT
GGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAG
AACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCT
GTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACC
ACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATC
AACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTT
GCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATT
GGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTAT
ATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTC
TCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTG

>In-frame_PARD3_ENST00000374776_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3675nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCT
AACCAATTTCAGAGAGACAATGCTCGCTCGTCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAG
GATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGAT
ATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGG
TTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGC
GACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCA
GCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGAC
AACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGA
CTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGT
TATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTA
ACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGA
CTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTG
AGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACC
AGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAAC
CACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATA
GCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGA
GGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATT
GAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCT
GCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTG
CCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCC
AAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAG
ATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAG
TCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATC
AGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAG
ACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATC
GAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTG
ACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGAT
GAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGA
GAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAG
CTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGAC
GGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAG
TCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAA
GAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGT
GGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGC

>In-frame_PARD3_ENST00000340077_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3804nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCT
AACCAATTTCAGAGAGACAATGCTCGCTCGTCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAG
GATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGAT
ATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGG
TTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGC
GACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCA
GCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGAC
AACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGA
CTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGT
TATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTA
ACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGA
CTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTG
AGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAA
GCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGC
CTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCA
TCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAA
ACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTG
AAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGT
GGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATG
CCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGAT
GATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGAT
CCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGAT
TTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCT
CCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAAT
GGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTAT
GATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCG
GACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGT
GGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAG
AACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCT
GTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACC
ACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATC
AACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTT
GCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATT
GGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTAT
ATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTC
TCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTG

>In-frame_PARD3_ENST00000374773_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_3714nt
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCG
GTGACCCGCTACCGGAAGGCCATCGCCAAGGATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGC
ACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGC
CTCTCCACTTCTGTCAGTGATAGTAATTTTTCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCT
AACCAATTTCAGAGAGACAATGCTCGCTCGTCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAG
GATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGAT
ATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGG
TTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGC
GACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCA
GCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGAC
AACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGA
CTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGT
TATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTA
ACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGA
CTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTG
AGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAA
GCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGC
CTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCA
TCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAA
ACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTG
AAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGT
GGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATG
CCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGAT
GATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGAT
CCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCT
CCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAAT
GGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTAT
GATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCG
GACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGT
GGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAG
AACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCT
GTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACC
ACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATC
AACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTT
GCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATT
GGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTAT
ATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTC
TCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PARD3_ENST00000545260_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4422nt
CCCAGCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTG
CGGGCGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCC
CCCCGGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCG
GCCTCGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACC
CGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGAC
GATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGC
CCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCA
GTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTT
TCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACC
TGCGACAGGAAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCC
AACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGA
GGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATT
GTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGG
TTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCT
GACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAG
ATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGT
ACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGC
ATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGA
CTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACC
AAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAAAGCAGAAGATGAGGATATTGTT
CTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGT
AACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGG
GTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCT
ACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCT
GGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAA
TCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATT
ATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCA
GATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGA
GAAGGATTTGGACGTCAGATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCT
TCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGT
CCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGAT
GATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCC
CCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCG
GAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCC
AAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCC
TCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACC
CAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGC
CCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATT
AAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTC
ACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGAT
ACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGAC
GTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCA
TAGGCAGAGGCATGAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCGTGGATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACAC
TCAAGACTTTTGACTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCCAACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTA
ATGTTGCAGATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCAGTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTA
GACAGTCAGCATTTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACTAATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCA
CGGGAGCCAGGATGGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGCACCCAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGC
TGGCTTCTCAAACGGCCGAAGTTGCCTCTTTTAGGAATCTCTTTGGAATTGGGAGCACGATGACTCTGAGTTTGAGCTATTAAAGTACTT

>In-frame_PARD3_ENST00000545693_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4644nt
CCCAGCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTG
CGGGCGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCC
CCCCGGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCG
GCCTCGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACC
CGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGAC
GATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGC
CCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCA
GTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTT
TCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACC
TGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCTAACCAATTTCAGAGAGACAATGCTCGCTCG
TCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTT
GAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGAT
GGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGT
AAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCA
CAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCC
CAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCAC
ACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAA
CCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTT
AATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTG
AAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTG
GGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCC
TTCCACCCAAGGGAACTGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTT
AATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCC
ATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAG
ACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGA
ATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGA
ATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAG
CTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAG
TCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGC
TCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTT
TCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTG
GATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCA
GTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGA
GCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGC
CATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAA
CGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCAC
CGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATT
GACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTT
TCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTAC
ATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAA
GTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCC
ATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCA
GACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGC
ATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAAT
GAAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGGCAGAGGCATGAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCC
GTGGATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAAGACTTTTGACTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGC
CAACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGTTGCAGATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTA
TGCAGTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACAGTCAGCATTTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCC
AACTAATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGGAGCCAGGATGGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAG
CACCCAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGCTTCTCAAACGGCCGAAGTTGCCTCTTTTAGGAATCTCTTTGGAA

>In-frame_PARD3_ENST00000350537_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4550nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAG
AGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCAGTCC
TTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTTTCCT
CTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACCTGCG
ACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCTAACCAATTTCAGAGAGACAATGCTCGCTCGTCTC
TGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAAC
CTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAG
GGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAG
CTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAAC
ATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAA
GTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGG
TGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCAC
CATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATA
TCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAA
ACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCA
AATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCC
ACCCAAGGGAACTGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATG
ATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTA
TTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAA
ACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAA
GCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTT
CCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGT
CCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCT
CTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTT
TGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGATAGCTGACGAGACTAAACTCAATACAGTGGATG
ACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTG
CCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTG
CCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATA
AATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAG
AGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGG
TCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACC
ACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCC
TTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCC
AGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGA
CAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCA
CCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACG
TGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCA
ATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAG
ATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGGCAGAGGCATGAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCGTGG
ATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAAGACTTTTGACTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCCAAC
AGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGTTGCAGATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCA
GTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACAGTCAGCATTTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACT
AATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGGAGCCAGGATGGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGCACC
CAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGCTTCTCAAACGGCCGAAGTTGCCTCTTTTAGGAATCTCTTTGGAATTGG

>In-frame_PARD3_ENST00000346874_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4688nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAG
AGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCAGTCC
TTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTTTCCT
CTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACCTGCG
ACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCTAACCAATTTCAGAGAGACAATGCTCGCTCGTCTC
TGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAAC
CTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAG
GGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAG
CTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAAC
ATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAA
GTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGG
TGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCAC
CATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATA
TCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAA
ACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCA
AATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCC
ACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATG
GCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAG
AGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAAC
TGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATA
AACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGC
CCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAA
ATGCTGCCCTCAGTAGGATAATGGGTGAGTCAGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAG
AAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATG
CTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAG
GATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAA
GCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCC
TGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCAC
GGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATG
ATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTG
CCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAG
ATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAA
TCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAG
AGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGC
GAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGT
TAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAA
AGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGT
CCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCC
CAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCA
TTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGG
CAGAGGCATGAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCGTGGATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAA
GACTTTTGACTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCCAACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGT
TGCAGATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCAGTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACA
GTCAGCATTTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACTAATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGG
AGCCAGGATGGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGCACCCAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGC
TTCTCAAACGGCCGAAGTTGCCTCTTTTAGGAATCTCTTTGGAATTGGGAGCACGATGACTCTGAGTTTGAGCTATTAAAGTACTTCTTA

>In-frame_PARD3_ENST00000374789_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4688nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAG
AGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCAGTCC
TTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTTTCCT
CTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACCTGCG
ACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCTAACCAATTTCAGAGAGACAATGCTCGCTCGTCTC
TGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAAC
CTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAG
GGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAG
CTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAAC
ATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAA
GTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGG
TGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCAC
CATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATA
TCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAA
ACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCA
AATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCC
ACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATG
GCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAG
AGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAAC
TGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATA
AACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGC
CCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAA
ATGCTGCCCTCAGTAGGATAATGGGTGAGTCAGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAG
AAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATG
CTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAG
GATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAA
GCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCC
TGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCAC
GGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATG
ATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTG
CCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAG
ATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAA
TCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAG
AGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGC
GAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGT
TAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAA
AGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGT
CCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCC
CAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCA
TTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGG
CAGAGGCATGAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCGTGGATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAA
GACTTTTGACTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCCAACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGT
TGCAGATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCAGTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACA
GTCAGCATTTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACTAATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGG
AGCCAGGATGGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGCACCCAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGC
TTCTCAAACGGCCGAAGTTGCCTCTTTTAGGAATCTCTTTGGAATTGGGAGCACGATGACTCTGAGTTTGAGCTATTAAAGTACTTCTTA

>In-frame_PARD3_ENST00000374790_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4508nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAG
AGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCAGTCC
TTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTTTCCT
CTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACCTGCG
ACAGGAAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACT
TTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCG
GCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCA
GGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCC
ATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACA
GCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAG
ACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGA
CTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCA
CTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTA
AGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGA
TGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAAAGCAGAAGATGAGGATATTGTTCTTA
CACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACC
GGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGA
ATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTG
AAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGAC
CTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGC
CCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAG
AAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATG
CTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAG
GATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAA
GCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCC
TGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCAC
GGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATG
ATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTG
CCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAG
ATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAA
TCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAG
AGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGC
GAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGT
TAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAA
AGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGT
CCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCC
CAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCA
TTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGG
CAGAGGCATGAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCGTGGATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAA
GACTTTTGACTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCCAACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGT
TGCAGATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCAGTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACA
GTCAGCATTTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACTAATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGG
AGCCAGGATGGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGCACCCAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGC
TTCTCAAACGGCCGAAGTTGCCTCTTTTAGGAATCTCTTTGGAATTGGGAGCACGATGACTCTGAGTTTGAGCTATTAAAGTACTTCTTA

>In-frame_PARD3_ENST00000374794_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4463nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAG
AGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCAGTCC
TTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTTTCCT
CTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACCTGCG
ACAGGAAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACT
TTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCG
GCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCA
GGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCC
ATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACA
GCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAG
ACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGA
CTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCA
CTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTA
AGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGA
TGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAAAGCAGAAGATGAGGATATTGTTCTTA
CACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACC
GGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGA
ATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTG
AAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGAC
CTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGC
CCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAG
AAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATG
CTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAG
GATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAA
GCATGGATTTAGGTAGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAG
TTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAG
CTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCC
ATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAAC
GAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACC
GGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTG
ACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTT
CCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACA
TCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAG
TGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCA
TCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAG
ACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCA
TCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATG
AAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGGCAGAGGCATGAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCG
TGGATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAAGACTTTTGACTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCC
AACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGTTGCAGATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTAT
GCAGTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACAGTCAGCATTTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCA
ACTAATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGGAGCCAGGATGGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGC
ACCCAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGCTTCTCAAACGGCCGAAGTTGCCTCTTTTAGGAATCTCTTTGGAAT

>In-frame_PARD3_ENST00000374788_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4679nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAG
AGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCAGTCC
TTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTTTCCT
CTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACCTGCG
ACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCTAACCAATTTCAGAGAGACAATGCTCGCTCGTCTC
TGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAAC
CTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAG
GGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAG
CTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAAC
ATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAA
GTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGG
TGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCAC
CATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATA
TCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAA
ACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCA
AATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCC
ACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATG
GCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAG
AGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAAC
TGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATA
AACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGC
CCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAA
ATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACA
GGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTT
GGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGAC
GTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATT
TAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGA
AGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGA
TAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCA
TGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTC
ATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGA
TCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATG
TGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGC
CGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCA
AAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACC
TGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCA
CGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAG
CCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAG
CTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGG
AAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGGCAGAGGCAT
GAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCGTGGATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAAGACTTTTGA
CTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCCAACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGTTGCAGATCC
GCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCAGTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACAGTCAGCATT
TGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACTAATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGGAGCCAGGAT
GGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGCACCCAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGCTTCTCAAAC

>In-frame_PARD3_ENST00000374776_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4550nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAG
AGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCAGTCC
TTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTTTCCT
CTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACCTGCG
ACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCTAACCAATTTCAGAGAGACAATGCTCGCTCGTCTC
TGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAAC
CTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAG
GGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAG
CTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAAC
ATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAA
GTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGG
TGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCAC
CATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATA
TCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAA
ACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCA
AATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCC
ACCCAAGGGAACTGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATG
ATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTA
TTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAA
ACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAA
GCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTT
CCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGT
CCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCT
CTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTT
TGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGACGTCAGATAGCTGACGAGACTAAACTCAATACAGTGGATG
ACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTG
CCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTG
CCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATA
AATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAG
AGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGG
TCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACC
ACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCC
TTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCC
AGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGA
CAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCA
CCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACG
TGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCA
ATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAG
ATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGGCAGAGGCATGAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCGTGG
ATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAAGACTTTTGACTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCCAAC
AGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGTTGCAGATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCA
GTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACAGTCAGCATTTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACT
AATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGGAGCCAGGATGGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGCACC
CAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGCTTCTCAAACGGCCGAAGTTGCCTCTTTTAGGAATCTCTTTGGAATTGG

>In-frame_PARD3_ENST00000340077_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4683nt
CCCAGCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTG
CGGGCGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCC
CCCCGGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCG
GCCTCGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACC
CGGGTGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGAC
GATAAAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGC
CCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCA
GTCCTTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTT
TCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACC
TGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCTAACCAATTTCAGAGAGACAATGCTCGCTCG
TCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTT
GAACCTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGAT
GGAGGGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGT
AAAGCTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCA
CAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCC
CAAAGTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCAC
ACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAA
CCACCATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTT
AATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTG
AAAAACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTG
GGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCC
TTCCACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAAGCAGAAGATGAGGATATTGTTCTTACACCT
GATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCA
AAAGAGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGAT
CAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGC
AATAAACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAG
CTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGC
AGAAATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAGAAGAT
GACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGT
ACTTGGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTT
GGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATG
GATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGT
CTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCG
CGGATAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAA
GGCATGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTG
GTTCATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGA
CTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAG
GATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTG
CGGCCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGC
GGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTA
AACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTC
CTCACGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGC
AAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCA
GAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAA
AGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGGCAGAG
GCATGAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCGTGGATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAAGACTT
TTGACTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCCAACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGTTGCAG
ATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCAGTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACAGTCAG
CATTTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACTAATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGGAGCCA
GGATGGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGCACCCAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGCTTCTC
AAACGGCCGAAGTTGCCTCTTTTAGGAATCTCTTTGGAATTGGGAGCACGATGACTCTGAGTTTGAGCTATTAAAGTACTTCTTACACAT

>In-frame_PARD3_ENST00000374773_chr10_34620045_-_HTRA1_ENST00000368984_chr10_124248418_+_4589nt
GCGGCCCCGAGCGAGCGCCAGCGCCACACAGCCCCGGGCAGCCGCCGGCGAGCGCGCCGCGACGCCGAACAGGTGGCCGGAGGCTGCGGG
CGCCGCGGCGGGGAGAGGCGAGGCAAGCCCCGGGCGAAGCGAGGCGAGGCGAGGGCGGCCGGGCCGGGCATGCGAGCTGAGCGGCCCCCC
GGCGTCGCCGCCGCCTGCCCGCGCCCCTAGCCGCCCGCGCGCCCGAGTCCCCAGCGGCTCCTCCGCGCCCAGCGTCCTCGGTCCCGGCCT
CGGCTGCTCCGGCTGCGCTCGGCGAGGGGCGCGGGCCCGCCCGCGGCGGCGGCGGCATGAAAGTGACCGTGTGCTTCGGACGGACCCGGG
TGGTCGTGCCGTGCGGGGACGGCCACATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAGGATC
CAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGACCTTGATGACATTCTTTGTGATGTAGCAGACGATA
AAGACAGACTGGTAGCAGTGTTTGATGAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGCCCAG
AGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAAGCAACAAGTGAAATTGAGGTCACACCTTCAGTCC
TTCGAGCAAATATGCCTCTTCATGTTCGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTTTCCT
CTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTCAAGCAGAACACTGCTGGGAGTCCTAAAACCTGCG
ACAGGAAGAAAGATGAAAACTACAGAAGCCTCCCGCGGGATACTAGTAACTGGTCTAACCAATTTCAGAGAGACAATGCTCGCTCGTCTC
TGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAGGATGGGACAGAAGAGGATAACAGTCGTGTTGAAC
CTGTTGGACATGCTGACACGGGTTTGGAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGATGGAG
GGCCTCTGGGAATCCACGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGGTTATTAGTAAAACGATTGGAGAAAGGTGGTAAAG
CTGAACATGAAAATCTTTTTCGTGAGAATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCACAAC
ATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCAGCAAATAAAGAGCAGTATGAACAACTATCCCAAA
GTGAGAAGAACAATTACTATTCAAGCCGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCACACGG
TGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGACTACCTCATAGCGCACACCCCTCGGGAAAACCAC
CATCCGCTCCAGCCTCGGCACCTCAGAATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTTAATA
TCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTAACAATAGGTGGCTCAGCTCCAATCTATGTGAAAA
ACATTCTCCCCCGGGGGGCGGCCATTCAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTGGGCA
AATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTGAGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCC
ACCCAAGGGAACTGAATGCAGAGCCAAGCCAGATGCAGATTCCAAAAGAAACGAAAGCAGAAGATGAGGATATTGTTCTTACACCTGATG
GCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGCCTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAG
AGAACCACGCAGATTTGGGAATCTTTGTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGATCAAC
TGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAAACCCTAAGAAGGTCTATGTCTACTGAAGGCAATA
AACGAGGAATGATCCAGCTTATTGTTGCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAGCTGC
CCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGTGGGATTGAGGGGCTTGATGAATCGCCCAGCAGAA
ATGCTGCCCTCAGTAGGATAATGGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATTATAGAAGATGACA
GGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGCTCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTT
GGGCCAAGGCTGCAATCAGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGAGAAGGATTTGGAC
GTCAGATAGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCTTCCCTGGGTCTGA
AGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTGACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGA
TAATCAGAGGCAGGGGATGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGATGATGATGAAGGCA
TGGAGACCTGGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTC
ATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCGGAAGATGGACTGA
TCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATG
TGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGC
CGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCA
AAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACC
TGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCA
CGGAGTCCCATGACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAG
CCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAAG
CTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGG
AAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCATAGGCAGAGGCAT
GAGCTGGACTTCATGTTTCCCTCAAAGACTCTCCCGTGGATGACGGATGAGGACTCTGGGCTGCTGGAATAGGACACTCAAGACTTTTGA
CTGCCATTTTGTTTGTTCAGTGGAGACTCCCTGGCCAACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAATGTTGCAGATCC
GCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCAGTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACAGTCAGCATT
TGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACTAATGCAGTCGATACAATGCGTAGATAGAAGAAGCCCCACGGGAGCCAGGAT
GGGACTGGTCGTGTTTGTGCTTTTCTCCAAGTCAGCACCCAAAGGTCAATGCACAGAGACCCCGGGTGGGTGAGCGCTGGCTTCTCAAAC


Top

FusionGenePPI for PARD3_HTRA1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PARD3YWHAB, YWHAG, SFN, ECT2, F11R, JAM2, JAM3, PVRL3, PARD6A, PARD6B, PARD6G, PRKCI, PRKCZ, YWHAZ, YWHAH, DCAF7, PNMA1, RASSF8, CCDC88A, PNMA2, LLGL1, SIAH1, HSPA8, HSPA6, HSPD1, PSME3, PSME2, RPS3, RPS18, PFKP, KPNA4, ANP32E, TJP1, VHL, ARHGAP17, AMOT, YWHAE, GAB1, MARK2, INADL, AMOTL2, LATS1, LATS2, YAP1, RASSF7, PSMC3, TP53BP2, RASSF9, RASSF10, SMAD7, SMAD4, SMAD1, SMAD2, SMAD3, CEP19, TMEM17, VAPA, MMGT1, CTNNB1, PPP1CA, CDH1, TRIM25HTRA1XIAP, NOS3, APOE, FAM46A, CSNK2B, IMPDH1, TMEM25, GOLT1B, SPINK4, REG4, AVP, DEFB127, MGAT4C, C12orf49, DEFA5, FUT1, DKKL1, FAM107A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-1921712_9369441032PRKCI and PRKCZ
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-1924712_9369471320PRKCI and PRKCZ
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-1925712_9369441354PRKCI and PRKCZ
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-1925712_9369471357PRKCI and PRKCZ


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgenePARD3chr10:34620045chr10:124248418ENST00000340077-1921935_13569441032FRMD4A
HgenePARD3chr10:34620045chr10:124248418ENST00000346874-1924935_13569471320FRMD4A
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-1824935_13569011311FRMD4A
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-1820935_1356901989FRMD4A
HgenePARD3chr10:34620045chr10:124248418ENST00000374788-1925935_13569441354FRMD4A
HgenePARD3chr10:34620045chr10:124248418ENST00000374789-1925935_13569471357FRMD4A
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-1621935_13568721245FRMD4A
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-1723935_13568571267FRMD4A
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-1824935_13569311341FRMD4A
HgenePARD3chr10:34620045chr10:124248418ENST00000350537-1824712_9369011311PRKCI and PRKCZ
HgenePARD3chr10:34620045chr10:124248418ENST00000374776-1820712_936901989PRKCI and PRKCZ
HgenePARD3chr10:34620045chr10:124248418ENST00000374794-1621712_9368721245PRKCI and PRKCZ
HgenePARD3chr10:34620045chr10:124248418ENST00000545260-1723712_9368571267PRKCI and PRKCZ
HgenePARD3chr10:34620045chr10:124248418ENST00000545693-1824712_9369311341PRKCI and PRKCZ


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PARD3_HTRA1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PARD3_HTRA1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneHTRA1C1838577Cerebral Autosomal Recessive Arteriopathy with Subcortical Infarcts and Leukoencephalopathy1ORPHANET;UNIPROT
TgeneHTRA1C4225211CEREBRAL ARTERIOPATHY, AUTOSOMAL DOMINANT, WITH SUBCORTICAL INFARCTS AND LEUKOENCEPHALOPATHY, TYPE 21UNIPROT