FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2597

FusionGeneSummary for ARHGEF7_SPATA7

check button Fusion gene summary
Fusion gene informationFusion gene name: ARHGEF7_SPATA7
Fusion gene ID: 2597
HgeneTgene
Gene symbol

ARHGEF7

SPATA7

Gene ID

8874

55812

Gene nameRho guanine nucleotide exchange factor 7spermatogenesis associated 7
SynonymsBETA-PIX|COOL-1|COOL1|Nbla10314|P50|P50BP|P85|P85COOL1|P85SPR|PAK3|PIXBHEL-S-296|HSD-3.1|HSD3|LCA3
Cytomap

13q34

14q31.3

Type of geneprotein-codingprotein-coding
Descriptionrho guanine nucleotide exchange factor 7PAK-interacting exchange factor betaRho guanine nucleotide exchange factor (GEF) 7SH3 domain-containing proline-rich proteinspermatogenesis-associated protein 7epididymis secretory protein Li 296spermatogenesis-associated protein HSD3
Modification date2018052220180519
UniProtAcc

Q14155

Q9P0W8

Ensembl transtripts involved in fusion geneENST00000317133, ENST00000375741, 
ENST00000375739, ENST00000370623, 
ENST00000544132, ENST00000218789, 
ENST00000375736, ENST00000426073, 
ENST00000375737, ENST00000375723, 
ENST00000478679, ENST00000483189, 
ENST00000556553, ENST00000393545, 
ENST00000356583, ENST00000554102, 
ENST00000045347, 
Fusion gene scores* DoF score11 X 9 X 7=6932 X 2 X 2=8
# samples 112
** MAII scorelog2(11/693*10)=-2.65535182861255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: ARHGEF7 [Title/Abstract] AND SPATA7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARHGEF7

GO:0043547

positive regulation of GTPase activity

21048939


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-SI-A71O-06AARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000317133ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000317133ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000317133ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000317133ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000317133ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375741ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375741ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375741ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375741ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375741ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375739ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375739ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375739ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375739ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375739ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000370623ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000370623ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000370623ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000370623ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000370623ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-3CDSENST00000544132ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-3CDSENST00000544132ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-3CDSENST00000544132ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-intronENST00000544132ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-intronENST00000544132ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000218789ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000218789ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000218789ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000218789ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000218789ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375736ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375736ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375736ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375736ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375736ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000426073ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000426073ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000426073ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000426073ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000426073ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375737ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375737ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375737ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375737ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375737ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375723ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375723ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000375723ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375723ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000375723ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000478679ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000478679ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
In-frameENST00000478679ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000478679ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
5CDS-intronENST00000478679ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-3CDSENST00000483189ENST00000556553ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-3CDSENST00000483189ENST00000393545ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-3CDSENST00000483189ENST00000356583ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-intronENST00000483189ENST00000554102ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+
intron-intronENST00000483189ENST00000045347ARHGEF7chr13

111940790

+SPATA7chr14

88883055

+

Top

FusionProtFeatures for ARHGEF7_SPATA7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARHGEF7

Q14155

SPATA7

Q9P0W8

Involved in photoreceptor cells maintenance (Bysimilarity). It is required for recruitment and properlocalization of RPGRIP1 to the photoreceptor connecting cilium(CC), as well as protein trafficking across the CC to the outersegments (By similarity). {ECO:0000250|UniProtKB:Q80VP2}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000317133+1819184_243711783DomainSH3
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000317133+18191_133711783DomainCalponin-homology (CH)
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000317133+1819271_451711783DomainDH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000317133+1819473_578711783DomainPH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000370623+1619184_243639732DomainSH3
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000370623+16191_133639732DomainCalponin-homology (CH)
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000370623+1619271_451639732DomainDH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000370623+1619473_578639732DomainPH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375723+1617184_243554626DomainSH3
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375723+16171_133554626DomainCalponin-homology (CH)
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375723+1617271_451554626DomainDH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375736+1720184_243554647DomainSH3
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375736+17201_133554647DomainCalponin-homology (CH)
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375736+1720271_451554647DomainDH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375739+1718184_243682754DomainSH3
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375739+17181_133682754DomainCalponin-homology (CH)
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375739+1718271_451682754DomainDH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375739+1718473_578682754DomainPH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375741+1920184_243732804DomainSH3
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375741+19201_133732804DomainCalponin-homology (CH)
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375741+1920271_451732804DomainDH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375741+1920473_578732804DomainPH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000426073+1720184_243554647DomainSH3
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000426073+17201_133554647DomainCalponin-homology (CH)
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000426073+1720271_451554647DomainDH

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375723+1617473_578554626DomainPH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000375736+1720473_578554647DomainPH
HgeneARHGEF7chr13:111940790chr14:88883055ENST00000426073+1720473_578554647DomainPH


Top

FusionGeneSequence for ARHGEF7_SPATA7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARHGEF7_ENST00000317133_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_1232aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLETFDAND
LYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNED
ELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQ
TVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEE
LGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEG
DDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCN
NQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWS
LSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSNADQQRREK
LKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSS
SPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDF
TDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKI
YSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSE
PNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSV

>In-frame_ARHGEF7_ENST00000317133_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_1232aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLETFDAND
LYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNED
ELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQ
TVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEE
LGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEG
DDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCN
NQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWS
LSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSNADQQRREK
LKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSS
SPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDF
TDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKI
YSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSE
PNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSV

>In-frame_ARHGEF7_ENST00000317133_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_1232aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLETFDAND
LYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNED
ELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQ
TVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEE
LGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEG
DDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCN
NQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWS
LSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSNADQQRREK
LKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSS
SPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDF
TDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKI
YSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSE
PNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSV

>In-frame_ARHGEF7_ENST00000375741_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_1253aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPS
QPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKS
YYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQE
VRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHG
TPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAY
CTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERL
HLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKT
EAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDAL
QHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENS
VKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLET

>In-frame_ARHGEF7_ENST00000375741_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_1253aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPS
QPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKS
YYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQE
VRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHG
TPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAY
CTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERL
HLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKT
EAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDAL
QHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENS
VKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLET

>In-frame_ARHGEF7_ENST00000375741_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_1253aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPS
QPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKS
YYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQE
VRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHG
TPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAY
CTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERL
HLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKT
EAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDAL
QHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENS
VKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLET

>In-frame_ARHGEF7_ENST00000375739_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_1203aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSD
SVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRT
GWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLE
EICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRL
DKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERY
LLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPH
SVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTM
KKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKS
LFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTF
PNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTD
SEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNR
FLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSA
PKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSV

>In-frame_ARHGEF7_ENST00000375739_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_1203aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSD
SVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRT
GWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLE
EICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRL
DKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERY
LLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPH
SVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTM
KKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKS
LFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTF
PNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTD
SEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNR
FLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSA
PKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSV

>In-frame_ARHGEF7_ENST00000375739_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_1203aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSD
SVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRT
GWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLE
EICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRL
DKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERY
LLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPH
SVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTM
KKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKS
LFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTF
PNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTD
SEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNR
FLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSA
PKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSV

>In-frame_ARHGEF7_ENST00000370623_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_1160aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLEDMTDNS
NNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYN
VVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLT
YCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRK
RKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHR
NAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPH
TTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTS
AKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLS
LHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAK
SFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHS
SPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQ
NDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTL

>In-frame_ARHGEF7_ENST00000370623_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_1160aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLEDMTDNS
NNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYN
VVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLT
YCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRK
RKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHR
NAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPH
TTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTS
AKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLS
LHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAK
SFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHS
SPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQ
NDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTL

>In-frame_ARHGEF7_ENST00000370623_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_1160aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLEDMTDNS
NNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYN
VVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLT
YCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRK
RKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHR
NAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPH
TTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTS
AKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLS
LHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAK
SFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHS
SPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQ
NDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTL

>In-frame_ARHGEF7_ENST00000218789_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000218789_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000218789_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000375736_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000375736_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000375736_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000426073_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000426073_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000426073_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000375737_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_1150aa
MKTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKF
NFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETE
NEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVN
VLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILT
EAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMI
ERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEP
PKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSN
ADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITN
GPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYT
PAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSL
KPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFD
FEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDS

>In-frame_ARHGEF7_ENST00000375737_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_1150aa
MKTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKF
NFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETE
NEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVN
VLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILT
EAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMI
ERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEP
PKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSN
ADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITN
GPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYT
PAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSL
KPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFD
FEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDS

>In-frame_ARHGEF7_ENST00000375737_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_1150aa
MKTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKF
NFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETE
NEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVN
VLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILT
EAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMI
ERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEP
PKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSN
ADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITN
GPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYT
PAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSL
KPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFD
FEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDS

>In-frame_ARHGEF7_ENST00000375723_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000375723_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000375723_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_1075aa
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAIN
KSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC
QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSH
HGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSE
RLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTL
KTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDD
ALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEE
NSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNL

>In-frame_ARHGEF7_ENST00000478679_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_997aa
MGSCSSQSVQKTRRGRKVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRV
GGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQK
SMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKL
PTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPL
TPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAA
LEEDAQILKVIEAYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGF
SSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELF
SNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLE
GHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLH
VLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEG
VIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIE

>In-frame_ARHGEF7_ENST00000478679_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_997aa
MGSCSSQSVQKTRRGRKVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRV
GGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQK
SMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKL
PTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPL
TPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAA
LEEDAQILKVIEAYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGF
SSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELF
SNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLE
GHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLH
VLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEG
VIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIE

>In-frame_ARHGEF7_ENST00000478679_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_997aa
MGSCSSQSVQKTRRGRKVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRV
GGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQK
SMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKL
PTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPL
TPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAA
LEEDAQILKVIEAYCTSAKTRQTLNSNADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGF
SSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELF
SNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLE
GHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLH
VLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEG
VIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARHGEF7_ENST00000317133_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3696nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATGAT
TTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCC
GTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAG
GGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGAC
GAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGC
TGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGA
TTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAG
ACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAA
ATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTA
AACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAG
TTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGAT
AAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTC
AAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGC
GATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTT
CTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATG
ACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAAC
AACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCA
GTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCAC
ACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGC
CTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAA
AAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCT
CAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAA
CTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTT
TTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGG
TCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCC
TCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCA
AATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTG
CCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTT
ACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCA
GAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACA
TGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATC
TACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTT
TTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGAC
TTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAA
CCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCA
AAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAG
GTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTG
AATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAG
TTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGAT

>In-frame_ARHGEF7_ENST00000317133_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3696nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATGAT
TTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCC
GTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAG
GGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGAC
GAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGC
TGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGA
TTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAG
ACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAA
ATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTA
AACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAG
TTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGAT
AAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTC
AAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGC
GATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTT
CTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATG
ACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAAC
AACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCA
GTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCAC
ACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGC
CTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAA
AAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCT
CAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAA
CTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTT
TTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGG
TCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCC
TCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCA
AATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTG
CCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTT
ACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCA
GAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACA
TGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATC
TACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTT
TTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGAC
TTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAA
CCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCA
AAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAG
GTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTG
AATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAG
TTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGAT

>In-frame_ARHGEF7_ENST00000317133_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3696nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATGAT
TTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCC
GTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAG
GGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGAC
GAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGC
TGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGA
TTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAG
ACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAA
ATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTA
AACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAG
TTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGAT
AAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTC
AAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGC
GATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTT
CTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATG
ACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAAC
AACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCA
GTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCAC
ACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGC
CTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAA
AAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCT
CAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAA
CTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTT
TTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGG
TCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCC
TCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCA
AATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTG
CCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTT
ACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCA
GAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACA
TGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATC
TACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTT
TTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGAC
TTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAA
CCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCA
AAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAG
GTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTG
AATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAG
TTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGAT

>In-frame_ARHGEF7_ENST00000375741_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3759nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGCTCCTGTTTCCTCCTTCC
CAGCCTCCTCAGCATCTGGTAACCACCATTCTCTTGTCTGCTTCTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAG
GTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGC
ATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACC
GATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTC
ATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAG
GTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGC
TATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCA
TTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTA
CAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTG
TACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGT
GCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTC
GAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAA
GTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTC
ACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATG
TTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAA
AATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTG
GAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCAC
CCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGC
ACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCC
CTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAA
CGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTAC
TGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAA
AAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGC
GAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTA
CACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCC
TCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATT
TCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACA
GAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACC
CAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAAT
TGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTT
CAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTAT
CTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATA
AAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCG
GTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAA
GTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCA
CCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACT
TCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCT
GAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAAT

>In-frame_ARHGEF7_ENST00000375741_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3759nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGCTCCTGTTTCCTCCTTCC
CAGCCTCCTCAGCATCTGGTAACCACCATTCTCTTGTCTGCTTCTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAG
GTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGC
ATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACC
GATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTC
ATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAG
GTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGC
TATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCA
TTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTA
CAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTG
TACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGT
GCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTC
GAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAA
GTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTC
ACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATG
TTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAA
AATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTG
GAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCAC
CCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGC
ACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCC
CTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAA
CGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTAC
TGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAA
AAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGC
GAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTA
CACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCC
TCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATT
TCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACA
GAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACC
CAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAAT
TGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTT
CAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTAT
CTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATA
AAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCG
GTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAA
GTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCA
CCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACT
TCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCT
GAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAAT

>In-frame_ARHGEF7_ENST00000375741_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3759nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGCTCCTGTTTCCTCCTTCC
CAGCCTCCTCAGCATCTGGTAACCACCATTCTCTTGTCTGCTTCTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAG
GTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGC
ATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACC
GATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTC
ATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAG
GTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGC
TATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCA
TTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTA
CAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTG
TACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGT
GCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTC
GAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAA
GTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTC
ACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATG
TTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAA
AATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTG
GAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCAC
CCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGC
ACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCC
CTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAA
CGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTAC
TGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAA
AAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGC
GAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTA
CACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCC
TCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATT
TCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACA
GAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACC
CAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAAT
TGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTT
CAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTAT
CTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATA
AAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCG
GTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAA
GTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCA
CCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACT
TCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCT
GAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAAT

>In-frame_ARHGEF7_ENST00000375739_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3609nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAACGTTTGATGCAAAT
GATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGAC
TCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTC
CAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAG
GACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACC
GGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAA
GGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTT
CAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAA
GAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTT
TTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAG
GAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTG
GATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCC
TTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAG
GGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATAT
CTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGA
ATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGC
AACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCAT
TCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTAC
CACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGG
AGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATG
AAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGAT
GCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAG
AAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCA
CTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCA
AGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGT
TCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTC
CCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAA
TTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGAT
TTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGAT
TCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCA
ACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAA
ATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGG
TTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTA
GACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCA
GAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCA
CCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAA
CAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCT
GTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTT
CAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTG

>In-frame_ARHGEF7_ENST00000375739_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3609nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAACGTTTGATGCAAAT
GATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGAC
TCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTC
CAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAG
GACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACC
GGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAA
GGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTT
CAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAA
GAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTT
TTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAG
GAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTG
GATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCC
TTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAG
GGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATAT
CTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGA
ATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGC
AACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCAT
TCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTAC
CACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGG
AGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATG
AAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGAT
GCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAG
AAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCA
CTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCA
AGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGT
TCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTC
CCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAA
TTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGAT
TTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGAT
TCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCA
ACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAA
ATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGG
TTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTA
GACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCA
GAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCA
CCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAA
CAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCT
GTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTT
CAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTG

>In-frame_ARHGEF7_ENST00000375739_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3609nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAACGTTTGATGCAAAT
GATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGAC
TCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTC
CAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAG
GACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACC
GGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAA
GGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTT
CAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAA
GAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTT
TTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAG
GAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTG
GATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCC
TTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAG
GGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATAT
CTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGA
ATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGC
AACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCAT
TCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTAC
CACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGG
AGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATG
AAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGAT
GCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAG
AAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCA
CTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCA
AGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGT
TCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTC
CCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAA
TTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGAT
TTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGAT
TCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCA
ACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAA
ATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGG
TTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTA
GACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCA
GAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCA
CCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAA
CAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCT
GTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTT
CAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTG

>In-frame_ARHGEF7_ENST00000370623_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3480nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGGACATGACCGATAATAGC
AACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTC
ACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCC
AGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAAT
GTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACC
AGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTA
GAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACG
TATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGC
CCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACAC
ATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAG
AGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATG
TCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCC
AGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGA
AATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTA
CAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACT
CCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCAC
ACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCC
TCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCT
TCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGC
GCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTC
AAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAA
ATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGT
CTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCC
CGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCA
CCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAA
TCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAA
TTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACA
TATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCC
TCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTC
ATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAAT
AAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAA
AATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATT
CAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAA
TTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTG
GATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTT
GAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATG

>In-frame_ARHGEF7_ENST00000370623_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3480nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGGACATGACCGATAATAGC
AACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTC
ACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCC
AGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAAT
GTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACC
AGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTA
GAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACG
TATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGC
CCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACAC
ATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAG
AGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATG
TCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCC
AGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGA
AATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTA
CAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACT
CCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCAC
ACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCC
TCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCT
TCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGC
GCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTC
AAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAA
ATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGT
CTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCC
CGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCA
CCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAA
TCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAA
TTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACA
TATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCC
TCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTC
ATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAAT
AAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAA
AATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATT
CAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAA
TTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTG
GATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTT
GAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATG

>In-frame_ARHGEF7_ENST00000370623_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3480nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGGACATGACCGATAATAGC
AACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTC
ACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCC
AGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAAT
GTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACC
AGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTA
GAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACG
TATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGC
CCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACAC
ATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAG
AGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATG
TCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCC
AGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGA
AATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTA
CAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACT
CCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCAC
ACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCC
TCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCT
TCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGC
GCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTC
AAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAA
ATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGT
CTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCC
CGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCA
CCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAA
TCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAA
TTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACA
TATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCC
TCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTC
ATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAAT
AAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAA
AATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATT
CAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAA
TTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTG
GATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTT
GAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATG

>In-frame_ARHGEF7_ENST00000218789_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000218789_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000218789_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000375736_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000375736_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000375736_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000426073_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000426073_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000426073_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000375737_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3450nt
ATGAAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCA
GACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCAC
ACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTT
AACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAG
GGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGA
ACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAA
AATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCA
TATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAG
CAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAAT
GTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTG
AGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGAT
ATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACG
GAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGT
GAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAG
GGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATT
GAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGA
AACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCC
GCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCT
CCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTT
AGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGC
ACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAAT
GCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAAT
TATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATG
AATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAAT
GGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGC
AGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCT
GAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACA
CCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCT
GAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTA
CCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTG
AAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAA
CTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCAC
CTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGAT
TTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCT
TTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCAT
TCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGT
TTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAAC
ACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATG

>In-frame_ARHGEF7_ENST00000375737_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3450nt
ATGAAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCA
GACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCAC
ACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTT
AACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAG
GGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGA
ACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAA
AATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCA
TATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAG
CAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAAT
GTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTG
AGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGAT
ATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACG
GAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGT
GAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAG
GGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATT
GAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGA
AACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCC
GCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCT
CCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTT
AGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGC
ACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAAT
GCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAAT
TATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATG
AATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAAT
GGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGC
AGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCT
GAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACA
CCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCT
GAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTA
CCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTG
AAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAA
CTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCAC
CTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGAT
TTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCT
TTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCAT
TCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGT
TTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAAC
ACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATG

>In-frame_ARHGEF7_ENST00000375737_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3450nt
ATGAAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCA
GACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCAC
ACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTT
AACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAG
GGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGA
ACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAA
AATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCA
TATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAG
CAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAAT
GTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTG
AGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGAT
ATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACG
GAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGT
GAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAG
GGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATT
GAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGA
AACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCC
GCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCT
CCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTT
AGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGC
ACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAAT
GCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAAT
TATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATG
AATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAAT
GGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGC
AGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCT
GAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACA
CCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCT
GAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTA
CCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTG
AAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAA
CTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCAC
CTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGAT
TTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCT
TTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCAT
TCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGT
TTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAAC
ACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATG

>In-frame_ARHGEF7_ENST00000375723_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000375723_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000375723_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3225nt
ATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGA
GACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTG
CGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAAC
AAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTA
CGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATG
CTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAA
ACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACC
AAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAA
GAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGT
CAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGC
AACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTG
CTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGAC
AGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAA
TGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCC
TCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCAC
CACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCG
CCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAA
CCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAA
GCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAA
TGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCC
TCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAG
AGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTAT
GCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTA
GTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTA
AAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCT
GAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCA
TCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGAT
GCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTG
TTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGA
CATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAA
AACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAA
AGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTC
CCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTT
GAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGT
GACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGAC

>In-frame_ARHGEF7_ENST00000478679_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_2991nt
ATGGGGTCCTGCAGCAGCCAGAGCGTGCAGAAGACGAGGAGGGGAAGAAAGGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATAT
TCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATG
GGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTC
GGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACG
GAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCC
TTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAA
TCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATC
CGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAG
AATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTT
CCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATA
TTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACC
ATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTG
ACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACA
CCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGC
CCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCT
TTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAA
CAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAAT
AATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTT
TCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAG
AAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCC
AGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTT
TCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAA
AGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAA
AACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAA
GGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCT
TCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTA
TTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCAT
GTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAG
GCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATG
TTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGG
GTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGAT
CGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCC
TCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAG

>In-frame_ARHGEF7_ENST00000478679_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_2991nt
ATGGGGTCCTGCAGCAGCCAGAGCGTGCAGAAGACGAGGAGGGGAAGAAAGGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATAT
TCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATG
GGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTC
GGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACG
GAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCC
TTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAA
TCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATC
CGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAG
AATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTT
CCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATA
TTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACC
ATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTG
ACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACA
CCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGC
CCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCT
TTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAA
CAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAAT
AATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTT
TCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAG
AAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCC
AGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTT
TCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAA
AGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAA
AACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAA
GGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCT
TCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTA
TTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCAT
GTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAG
GCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATG
TTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGG
GTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGAT
CGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCC
TCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAG

>In-frame_ARHGEF7_ENST00000478679_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_2991nt
ATGGGGTCCTGCAGCAGCCAGAGCGTGCAGAAGACGAGGAGGGGAAGAAAGGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATAT
TCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATG
GGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTC
GGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACG
GAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCC
TTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAA
TCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATC
CGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAG
AATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTT
CCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATA
TTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACC
ATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTG
ACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACA
CCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGC
CCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCT
TTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAA
CAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAAT
AATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTT
TCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAG
AAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCC
AGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTT
TCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAA
AGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAA
AACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAA
GGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCT
TCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTA
TTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCAT
GTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAG
GCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATG
TTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGG
GTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGAT
CGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCC
TCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARHGEF7_ENST00000317133_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_4642nt
CCCCGAGACGCAGCCAGGCGCCCGGCCCGGCCCGGCCCGGCCCTCTGCACAGCCCCACTTCAGGCCACGCCGTTTCCTTGACCTTCCCCC
GGCAGGGTCTGAAGCGTCACCGTCCGTCTAGAGCAGAGTCGCGCAGGCCCCTGCCCTGCCGGTGAGGTCGGCGCCGCGCTCCGGAGAGTC
GGTTCCTCCCGATTCAGACCCATATGGCTTCAGATGGAACCATCATTTCTGTTCCGTCATGACCGGCTTGCAAGGTAGCAAAGCGAAACA
AACGTCTCGTTTTCAGCCTGTCCCCGCCACCTTGAAATAAAACCGGCAAAAATAAAAAGAGCATTCTGGGAAGTACTTCATCATTTCAAC
GCTCACGAATTCAAAACATAAACAAAGGCTTCCGAGTGCCCCGGCCAGGGGCGCGGGGCGCACGGCGGGCCCGGGGCAGGTAAGCGCAGG
TGCGCGCCCGCCCCCACCCCCGGCTCCCTCCCCATCCGCTCCCCGCTCCCCTTCCCCTTTCCCTTCCCCGCCCGCTCCCAGCCGCCGCCG
CCGCCCCGCGCACGGCCTGGAGCGGAGGCTGCGCAGGGCGCGGGGCGGCGCGGGCCGGGCGCGGGCCGGGCGGACGGCCGCGTCTTTCTT
CTCCTGGCGGTGATGTCATTGGGCGACGGCGGCCGAGGCCGGGGGGCGGCGGCGGGCGCCCGCAGGTTCCCGAGCCGCTCCTGAGAAGGC
GCCTGACAGCGGGCCGGGGCGCACGGAGAAGCGGGCCGGGCCGGACCTGCTGGGCCGCGCCGAGCCAATCGCCGGCGCCGGCCGCTCGAT
GGGCGAGGCGGCGGCGGCGGCGGCGGGGGCCGCGGGCCGGGCCGCCGCTCCGAGGTGAAGGCGCGCGCCCCTCCCCGCCTGCCTCCCGGG
CCGCAGCGATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGG
AGGGCTTTCTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACC
CCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATG
CAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGA
GTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAAC
TGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCA
ATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCC
GGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTC
CCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAG
AACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATC
TAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCT
GCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACA
GTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGC
GCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGG
CTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACT
GGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAA
GATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGA
CAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGT
CGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGC
CTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCG
CCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGC
CCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGA
CCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAG
AAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAA
GAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCA
AGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCT
TTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACT
CCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCA
CATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACA
AACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAA
AGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGA
CAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATG
ACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTC
GTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAA
ACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGA
AAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGA
ATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGT
CGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAA
TTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAA
CTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAAT
CTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCC

>In-frame_ARHGEF7_ENST00000317133_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_4638nt
CCCCGAGACGCAGCCAGGCGCCCGGCCCGGCCCGGCCCGGCCCTCTGCACAGCCCCACTTCAGGCCACGCCGTTTCCTTGACCTTCCCCC
GGCAGGGTCTGAAGCGTCACCGTCCGTCTAGAGCAGAGTCGCGCAGGCCCCTGCCCTGCCGGTGAGGTCGGCGCCGCGCTCCGGAGAGTC
GGTTCCTCCCGATTCAGACCCATATGGCTTCAGATGGAACCATCATTTCTGTTCCGTCATGACCGGCTTGCAAGGTAGCAAAGCGAAACA
AACGTCTCGTTTTCAGCCTGTCCCCGCCACCTTGAAATAAAACCGGCAAAAATAAAAAGAGCATTCTGGGAAGTACTTCATCATTTCAAC
GCTCACGAATTCAAAACATAAACAAAGGCTTCCGAGTGCCCCGGCCAGGGGCGCGGGGCGCACGGCGGGCCCGGGGCAGGTAAGCGCAGG
TGCGCGCCCGCCCCCACCCCCGGCTCCCTCCCCATCCGCTCCCCGCTCCCCTTCCCCTTTCCCTTCCCCGCCCGCTCCCAGCCGCCGCCG
CCGCCCCGCGCACGGCCTGGAGCGGAGGCTGCGCAGGGCGCGGGGCGGCGCGGGCCGGGCGCGGGCCGGGCGGACGGCCGCGTCTTTCTT
CTCCTGGCGGTGATGTCATTGGGCGACGGCGGCCGAGGCCGGGGGGCGGCGGCGGGCGCCCGCAGGTTCCCGAGCCGCTCCTGAGAAGGC
GCCTGACAGCGGGCCGGGGCGCACGGAGAAGCGGGCCGGGCCGGACCTGCTGGGCCGCGCCGAGCCAATCGCCGGCGCCGGCCGCTCGAT
GGGCGAGGCGGCGGCGGCGGCGGCGGGGGCCGCGGGCCGGGCCGCCGCTCCGAGGTGAAGGCGCGCGCCCCTCCCCGCCTGCCTCCCGGG
CCGCAGCGATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGG
AGGGCTTTCTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACC
CCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATG
CAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGA
GTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAAC
TGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCA
ATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCC
GGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTC
CCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAG
AACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATC
TAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCT
GCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACA
GTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGC
GCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGG
CTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACT
GGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAA
GATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGA
CAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGT
CGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGC
CTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCG
CCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGC
CCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGA
CCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAG
AAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAA
GAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCA
AGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCT
TTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACT
CCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCA
CATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACA
AACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAA
AGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGA
CAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATG
ACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTC
GTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAA
ACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGA
AAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGA
ATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGT
CGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAA
TTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAA
CTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAAT
CTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCC

>In-frame_ARHGEF7_ENST00000317133_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_4640nt
CCCCGAGACGCAGCCAGGCGCCCGGCCCGGCCCGGCCCGGCCCTCTGCACAGCCCCACTTCAGGCCACGCCGTTTCCTTGACCTTCCCCC
GGCAGGGTCTGAAGCGTCACCGTCCGTCTAGAGCAGAGTCGCGCAGGCCCCTGCCCTGCCGGTGAGGTCGGCGCCGCGCTCCGGAGAGTC
GGTTCCTCCCGATTCAGACCCATATGGCTTCAGATGGAACCATCATTTCTGTTCCGTCATGACCGGCTTGCAAGGTAGCAAAGCGAAACA
AACGTCTCGTTTTCAGCCTGTCCCCGCCACCTTGAAATAAAACCGGCAAAAATAAAAAGAGCATTCTGGGAAGTACTTCATCATTTCAAC
GCTCACGAATTCAAAACATAAACAAAGGCTTCCGAGTGCCCCGGCCAGGGGCGCGGGGCGCACGGCGGGCCCGGGGCAGGTAAGCGCAGG
TGCGCGCCCGCCCCCACCCCCGGCTCCCTCCCCATCCGCTCCCCGCTCCCCTTCCCCTTTCCCTTCCCCGCCCGCTCCCAGCCGCCGCCG
CCGCCCCGCGCACGGCCTGGAGCGGAGGCTGCGCAGGGCGCGGGGCGGCGCGGGCCGGGCGCGGGCCGGGCGGACGGCCGCGTCTTTCTT
CTCCTGGCGGTGATGTCATTGGGCGACGGCGGCCGAGGCCGGGGGGCGGCGGCGGGCGCCCGCAGGTTCCCGAGCCGCTCCTGAGAAGGC
GCCTGACAGCGGGCCGGGGCGCACGGAGAAGCGGGCCGGGCCGGACCTGCTGGGCCGCGCCGAGCCAATCGCCGGCGCCGGCCGCTCGAT
GGGCGAGGCGGCGGCGGCGGCGGCGGGGGCCGCGGGCCGGGCCGCCGCTCCGAGGTGAAGGCGCGCGCCCCTCCCCGCCTGCCTCCCGGG
CCGCAGCGATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGG
AGGGCTTTCTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACC
CCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATG
CAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGA
GTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAAC
TGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCA
ATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCC
GGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTC
CCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAG
AACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATC
TAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCT
GCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACA
GTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGC
GCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGG
CTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACT
GGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAA
GATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGA
CAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGT
CGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGC
CTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCG
CCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGC
CCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGA
CCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAG
AAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAA
GAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCA
AGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCT
TTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACT
CCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCA
CATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACA
AACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAA
AGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGA
CAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATG
ACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTC
GTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAA
ACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGA
AAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGA
ATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGT
CGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAA
TTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAA
CTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAAT
CTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCC

>In-frame_ARHGEF7_ENST00000375741_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_4047nt
GCGGCCGAGGCCGGGGGGCGGCGGCGGGCGCCCGCAGGTTCCCGAGCCGCTCCTGAGAAGGCGCCTGACAGCGGGCCGGGGCGCACGGAG
AAGCGGGCCGGGCCGGACCTGCTGGGCCGCGCCGAGCCAATCGCCGGCGCCGGCCGCTCGATGGGCGAGGCGGCGGCGGCGGCGGCGGGG
GCCGCGGGCCGGGCCGCCGCTCCGAGGTGAAGGCGCGCGCCCCTCCCCGCCTGCCTCCCGGGCCGCAGCGATGAATTCCGCCGAGCAAAC
CGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTTCTGCAGGCGTCGCTGAAGGA
TGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCT
GAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGCTCCTGTTTCCTCCTTCCCAGCCTCCTCAGCATCTGGT
AACCACCATTCTCTTGTCTGCTTCTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGAC
TCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCT
TGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACT
GGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGA
AGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCC
TGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACA
GAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTT
AAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCAC
CAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAA
TCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCT
CGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTA
TCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCT
TGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCT
GATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGAT
GAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGA
AATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAAC
GAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAA
GCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAA
CTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCT
CTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGA
GTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAG
GCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAA
AACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGA
CATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATC
CAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAG
CTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGA
TCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTC
ACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAA
ATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAA
AGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGC
AATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGT
AACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGA
GGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGA
TATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACG
TCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCC
TATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCA
TCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAA
TGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAAC

>In-frame_ARHGEF7_ENST00000375741_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_4043nt
GCGGCCGAGGCCGGGGGGCGGCGGCGGGCGCCCGCAGGTTCCCGAGCCGCTCCTGAGAAGGCGCCTGACAGCGGGCCGGGGCGCACGGAG
AAGCGGGCCGGGCCGGACCTGCTGGGCCGCGCCGAGCCAATCGCCGGCGCCGGCCGCTCGATGGGCGAGGCGGCGGCGGCGGCGGCGGGG
GCCGCGGGCCGGGCCGCCGCTCCGAGGTGAAGGCGCGCGCCCCTCCCCGCCTGCCTCCCGGGCCGCAGCGATGAATTCCGCCGAGCAAAC
CGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTTCTGCAGGCGTCGCTGAAGGA
TGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCT
GAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGCTCCTGTTTCCTCCTTCCCAGCCTCCTCAGCATCTGGT
AACCACCATTCTCTTGTCTGCTTCTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGAC
TCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCT
TGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACT
GGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGA
AGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCC
TGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACA
GAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTT
AAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCAC
CAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAA
TCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCT
CGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTA
TCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCT
TGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCT
GATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGAT
GAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGA
AATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAAC
GAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAA
GCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAA
CTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCT
CTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGA
GTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAG
GCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAA
AACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGA
CATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATC
CAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAG
CTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGA
TCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTC
ACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAA
ATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAA
AGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGC
AATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGT
AACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGA
GGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGA
TATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACG
TCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCC
TATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCA
TCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAA
TGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAAC

>In-frame_ARHGEF7_ENST00000375741_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_4045nt
GCGGCCGAGGCCGGGGGGCGGCGGCGGGCGCCCGCAGGTTCCCGAGCCGCTCCTGAGAAGGCGCCTGACAGCGGGCCGGGGCGCACGGAG
AAGCGGGCCGGGCCGGACCTGCTGGGCCGCGCCGAGCCAATCGCCGGCGCCGGCCGCTCGATGGGCGAGGCGGCGGCGGCGGCGGCGGGG
GCCGCGGGCCGGGCCGCCGCTCCGAGGTGAAGGCGCGCGCCCCTCCCCGCCTGCCTCCCGGGCCGCAGCGATGAATTCCGCCGAGCAAAC
CGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTTCTGCAGGCGTCGCTGAAGGA
TGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCT
GAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGCTCCTGTTTCCTCCTTCCCAGCCTCCTCAGCATCTGGT
AACCACCATTCTCTTGTCTGCTTCTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGAC
TCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCT
TGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACT
GGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGA
AGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCC
TGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACA
GAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTT
AAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCAC
CAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAA
TCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCT
CGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTA
TCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCT
TGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCT
GATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGAT
GAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGA
AATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAAC
GAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAA
GCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAA
CTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCT
CTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGA
GTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAG
GCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAA
AACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGA
CATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATC
CAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAG
CTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGA
TCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTC
ACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAA
ATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAA
AGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGC
AATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGT
AACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGA
GGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGA
TATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACG
TCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCC
TATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCA
TCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAA
TGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAAC

>In-frame_ARHGEF7_ENST00000375739_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3897nt
GCGGCCGAGGCCGGGGGGCGGCGGCGGGCGCCCGCAGGTTCCCGAGCCGCTCCTGAGAAGGCGCCTGACAGCGGGCCGGGGCGCACGGAG
AAGCGGGCCGGGCCGGACCTGCTGGGCCGCGCCGAGCCAATCGCCGGCGCCGGCCGCTCGATGGGCGAGGCGGCGGCGGCGGCGGCGGGG
GCCGCGGGCCGGGCCGCCGCTCCGAGGTGAAGGCGCGCGCCCCTCCCCGCCTGCCTCCCGGGCCGCAGCGATGAATTCCGCCGAGCAAAC
CGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTTCTGCAGGCGTCGCTGAAGGA
TGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAACGTTTGATGCAAATGATTTGTATCAGGGGCAGAA
TTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTC
GTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTT
GGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAA
AGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTA
CGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCAT
AAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTA
CCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCA
AATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGAT
GAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGA
GACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCT
CAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCA
ATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCT
GGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGT
TTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGA
GGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCA
GGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCT
CCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTC
CCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCC
CGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCG
CAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCAT
TGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGC
ACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAA
GCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTC
AGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGA
TTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCA
GTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCAC
TTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGA
AGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCA
GGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGA
TGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGA
ACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGA
GCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGA
GGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAA
TGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGAT
ATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAA
TCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGA
TAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGG
CGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAAT

>In-frame_ARHGEF7_ENST00000375739_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3893nt
GCGGCCGAGGCCGGGGGGCGGCGGCGGGCGCCCGCAGGTTCCCGAGCCGCTCCTGAGAAGGCGCCTGACAGCGGGCCGGGGCGCACGGAG
AAGCGGGCCGGGCCGGACCTGCTGGGCCGCGCCGAGCCAATCGCCGGCGCCGGCCGCTCGATGGGCGAGGCGGCGGCGGCGGCGGCGGGG
GCCGCGGGCCGGGCCGCCGCTCCGAGGTGAAGGCGCGCGCCCCTCCCCGCCTGCCTCCCGGGCCGCAGCGATGAATTCCGCCGAGCAAAC
CGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTTCTGCAGGCGTCGCTGAAGGA
TGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAACGTTTGATGCAAATGATTTGTATCAGGGGCAGAA
TTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTC
GTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTT
GGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAA
AGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTA
CGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCAT
AAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTA
CCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCA
AATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGAT
GAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGA
GACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCT
CAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCA
ATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCT
GGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGT
TTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGA
GGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCA
GGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCT
CCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTC
CCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCC
CGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCG
CAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCAT
TGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGC
ACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAA
GCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTC
AGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGA
TTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCA
GTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCAC
TTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGA
AGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCA
GGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGA
TGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGA
ACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGA
GCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGA
GGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAA
TGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGAT
ATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAA
TCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGA
TAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGG
CGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAAT

>In-frame_ARHGEF7_ENST00000375739_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3895nt
GCGGCCGAGGCCGGGGGGCGGCGGCGGGCGCCCGCAGGTTCCCGAGCCGCTCCTGAGAAGGCGCCTGACAGCGGGCCGGGGCGCACGGAG
AAGCGGGCCGGGCCGGACCTGCTGGGCCGCGCCGAGCCAATCGCCGGCGCCGGCCGCTCGATGGGCGAGGCGGCGGCGGCGGCGGCGGGG
GCCGCGGGCCGGGCCGCCGCTCCGAGGTGAAGGCGCGCGCCCCTCCCCGCCTGCCTCCCGGGCCGCAGCGATGAATTCCGCCGAGCAAAC
CGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTTCTGCAGGCGTCGCTGAAGGA
TGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAACGTTTGATGCAAATGATTTGTATCAGGGGCAGAA
TTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTC
GTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTT
GGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAA
AGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTA
CGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCAT
AAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTA
CCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCA
AATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGAT
GAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGA
GACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCT
CAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCA
ATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCT
GGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGT
TTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGA
GGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCA
GGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCT
CCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTC
CCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCC
CGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCG
CAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCAT
TGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGC
ACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAA
GCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTC
AGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGA
TTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCA
GTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCAC
TTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGA
AGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCA
GGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGA
TGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGA
ACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGA
GCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGA
GGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAA
TGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGAT
ATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAA
TCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGA
TAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGG
CGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAAT

>In-frame_ARHGEF7_ENST00000370623_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3518nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGGACATGACCGATAATAGC
AACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTC
ACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCC
AGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAAT
GTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACC
AGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTA
GAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACG
TATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGC
CCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACAC
ATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAG
AGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATG
TCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCC
AGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGA
AATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTA
CAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACT
CCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCAC
ACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCC
TCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCT
TCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGC
GCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTC
AAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAA
ATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGT
CTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCC
CGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCA
CCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAA
TCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAA
TTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACA
TATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCC
TCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTC
ATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAAT
AAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAA
AATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATT
CAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAA
TTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTG
GATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTT
GAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATG
GAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATACCTCAAATGGCCAG

>In-frame_ARHGEF7_ENST00000370623_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3514nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGGACATGACCGATAATAGC
AACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTC
ACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCC
AGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAAT
GTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACC
AGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTA
GAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACG
TATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGC
CCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACAC
ATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAG
AGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATG
TCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCC
AGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGA
AATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTA
CAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACT
CCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCAC
ACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCC
TCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCT
TCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGC
GCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTC
AAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAA
ATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGT
CTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCC
CGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCA
CCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAA
TCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAA
TTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACA
TATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCC
TCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTC
ATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAAT
AAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAA
AATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATT
CAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAA
TTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTG
GATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTT
GAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATG
GAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATACCTCAAATGGCCAG

>In-frame_ARHGEF7_ENST00000370623_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3516nt
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCCAAAAAAACCATCTCGGACCCGGAGGGCTTT
CTGCAGGCGTCGCTGAAGGATGGGGTGGTCCTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGGACATGACCGATAATAGC
AACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTC
ACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCC
AGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAAT
GTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACC
AGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTA
GAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACG
TATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGC
CCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACAC
ATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAG
AGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATG
TCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCC
AGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGA
AATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTA
CAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACT
CCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCAC
ACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCC
TCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCT
TCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGC
GCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTC
AAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAA
ATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGT
CTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCC
CGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCA
CCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAA
TCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAA
TTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACA
TATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCC
TCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTC
ATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAAT
AAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAA
AATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATT
CAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAA
TTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTG
GATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTT
GAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATG
GAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATACCTCAAATGGCCAG

>In-frame_ARHGEF7_ENST00000218789_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3760nt
AAAAAAGGGTGAGGAGAAGCAGCGGCTGAGCGGGTTGGCATCTGGGGCAGCGGGCTCGCTCCAGGCCGTCGGGGGCCGCTCGCCAGCGTC
GCCCGCTGTGTTGGGAGCGCGGGCCGTGGGCGTCGCTCGGCCTTGTCCGCGGCGTCCCCGCTGCCGGCCACGGCGCTCAGCGCTTGTGCT
CTGTATTGCAGGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGC
GGCTGGAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAG
CAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGC
ACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGT
TTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGG
AGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAG
GAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAG
AAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTT
CATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTC
AGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGA
ATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCC
TGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAG
ATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGA
CGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAA
GTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATC
AGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGA
TTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGG
GAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGC
CCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGC
CTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATC
TTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAA
GCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAA
ATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCA
ATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAA
TGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAA
ATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATG
GCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATT
CTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATA
CACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAG
CTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTT
TACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCC
TGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGA
AACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCC
ACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTG
ATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGG
CTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGC
ATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACA
GTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTA
ACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAA

>In-frame_ARHGEF7_ENST00000218789_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3756nt
AAAAAAGGGTGAGGAGAAGCAGCGGCTGAGCGGGTTGGCATCTGGGGCAGCGGGCTCGCTCCAGGCCGTCGGGGGCCGCTCGCCAGCGTC
GCCCGCTGTGTTGGGAGCGCGGGCCGTGGGCGTCGCTCGGCCTTGTCCGCGGCGTCCCCGCTGCCGGCCACGGCGCTCAGCGCTTGTGCT
CTGTATTGCAGGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGC
GGCTGGAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAG
CAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGC
ACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGT
TTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGG
AGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAG
GAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAG
AAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTT
CATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTC
AGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGA
ATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCC
TGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAG
ATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGA
CGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAA
GTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATC
AGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGA
TTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGG
GAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGC
CCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGC
CTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATC
TTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAA
GCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAA
ATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCA
ATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAA
TGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAA
ATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATG
GCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATT
CTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATA
CACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAG
CTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTT
TACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCC
TGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGA
AACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCC
ACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTG
ATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGG
CTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGC
ATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACA
GTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTA
ACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAA

>In-frame_ARHGEF7_ENST00000218789_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3758nt
AAAAAAGGGTGAGGAGAAGCAGCGGCTGAGCGGGTTGGCATCTGGGGCAGCGGGCTCGCTCCAGGCCGTCGGGGGCCGCTCGCCAGCGTC
GCCCGCTGTGTTGGGAGCGCGGGCCGTGGGCGTCGCTCGGCCTTGTCCGCGGCGTCCCCGCTGCCGGCCACGGCGCTCAGCGCTTGTGCT
CTGTATTGCAGGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGC
GGCTGGAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAG
CAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGC
ACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGT
TTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGG
AGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAG
GAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAG
AAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTT
CATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTC
AGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGA
ATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCC
TGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAG
ATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGA
CGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAA
GTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATC
AGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGA
TTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGG
GAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGC
CCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGC
CTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATC
TTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAA
GCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAA
ATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCA
ATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAA
TGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAA
ATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATG
GCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATT
CTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATA
CACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAG
CTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTT
TACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCC
TGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGA
AACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCC
ACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTG
ATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGG
CTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGC
ATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACA
GTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTA
ACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAA

>In-frame_ARHGEF7_ENST00000375736_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3736nt
GCTGAGCGGGTTGGCATCTGGGGCAGCGGGCTCGCTCCAGGCCGTCGGGGGCCGCTCGCCAGCGTCGCCCGCTGTGTTGGGAGCGCGGGC
CGTGGGCGTCGCTCGGCCTTGTCCGCGGCGTCCCCGCTGCCGGCCACGGCGCTCAGCGCTTGTGCTCTGTATTGCAGGTCTACCCCGAGC
CCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATG
ATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACT
CCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCC
AGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGG
ACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCG
GCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAG
GATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTC
AGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAG
AAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTT
TAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGG
AGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGG
ATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCT
TCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGG
GCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATC
TTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAA
TGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCA
ACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATT
CAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACC
ACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGA
GCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGA
AAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATG
CTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGA
AACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCAC
TTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAA
GGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTT
CCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCC
CAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAAT
TGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATT
TTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATT
CAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAA
CATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAA
TCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGT
TTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAG
ACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAG
AACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCAC
CAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAAC
AGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTG
TGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTC
AGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGG

>In-frame_ARHGEF7_ENST00000375736_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3732nt
GCTGAGCGGGTTGGCATCTGGGGCAGCGGGCTCGCTCCAGGCCGTCGGGGGCCGCTCGCCAGCGTCGCCCGCTGTGTTGGGAGCGCGGGC
CGTGGGCGTCGCTCGGCCTTGTCCGCGGCGTCCCCGCTGCCGGCCACGGCGCTCAGCGCTTGTGCTCTGTATTGCAGGTCTACCCCGAGC
CCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATG
ATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACT
CCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCC
AGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGG
ACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCG
GCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAG
GATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTC
AGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAG
AAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTT
TAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGG
AGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGG
ATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCT
TCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGG
GCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATC
TTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAA
TGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCA
ACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATT
CAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACC
ACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGA
GCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGA
AAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATG
CTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGA
AACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCAC
TTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAA
GGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTT
CCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCC
CAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAAT
TGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATT
TTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATT
CAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAA
CATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAA
TCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGT
TTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAG
ACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAG
AACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCAC
CAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAAC
AGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTG
TGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTC
AGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGG

>In-frame_ARHGEF7_ENST00000375736_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3734nt
GCTGAGCGGGTTGGCATCTGGGGCAGCGGGCTCGCTCCAGGCCGTCGGGGGCCGCTCGCCAGCGTCGCCCGCTGTGTTGGGAGCGCGGGC
CGTGGGCGTCGCTCGGCCTTGTCCGCGGCGTCCCCGCTGCCGGCCACGGCGCTCAGCGCTTGTGCTCTGTATTGCAGGTCTACCCCGAGC
CCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATG
ATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACT
CCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCC
AGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGG
ACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCG
GCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAG
GATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTC
AGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAG
AAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTT
TAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGG
AGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGG
ATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCT
TCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGG
GCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATC
TTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAA
TGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCA
ACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATT
CAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACC
ACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGA
GCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGA
AAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATG
CTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGA
AACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCAC
TTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAA
GGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTT
CCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCC
CAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAAT
TGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATT
TTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATT
CAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAA
CATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAA
TCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGT
TTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAG
ACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAG
AACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCAC
CAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAAC
AGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTG
TGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTC
AGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGG

>In-frame_ARHGEF7_ENST00000426073_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3619nt
GATGGTGGAAAGTGAGGAGAAGCAAAAAGACGACTACTTCTTTCCCCATTTCCCGGTCTGGTCTTTTTGGGGTCTACTACGTAGAGGTGC
ATCAGCCAGCGCTACCATGGAGGCAGGAGGCATTCTTTTGCTCTCGTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACA
AGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACC
GCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGA
CCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACG
TCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCG
AGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAA
GCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGC
CATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCG
TACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCC
TGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAG
GTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGC
TCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAG
AAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACG
TCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAA
TGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTG
AAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGG
TGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCC
ACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACG
GCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTC
CCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTG
AACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTT
ACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTG
AAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAG
GCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGAC
TACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAG
CCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCA
TTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAA
CAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAA
CCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTA
ATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTC
TTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGT
ATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATA
TAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACT
CGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTG
AAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTT
CACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAA
CTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACC
CTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATA
ATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATACCT

>In-frame_ARHGEF7_ENST00000426073_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3615nt
GATGGTGGAAAGTGAGGAGAAGCAAAAAGACGACTACTTCTTTCCCCATTTCCCGGTCTGGTCTTTTTGGGGTCTACTACGTAGAGGTGC
ATCAGCCAGCGCTACCATGGAGGCAGGAGGCATTCTTTTGCTCTCGTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACA
AGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACC
GCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGA
CCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACG
TCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCG
AGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAA
GCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGC
CATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCG
TACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCC
TGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAG
GTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGC
TCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAG
AAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACG
TCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAA
TGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTG
AAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGG
TGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCC
ACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACG
GCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTC
CCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTG
AACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTT
ACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTG
AAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAG
GCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGAC
TACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAG
CCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCA
TTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAA
CAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAA
CCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTA
ATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTC
TTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGT
ATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATA
TAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACT
CGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTG
AAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTT
CACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAA
CTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACC
CTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATA
ATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATACCT

>In-frame_ARHGEF7_ENST00000426073_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3617nt
GATGGTGGAAAGTGAGGAGAAGCAAAAAGACGACTACTTCTTTCCCCATTTCCCGGTCTGGTCTTTTTGGGGTCTACTACGTAGAGGTGC
ATCAGCCAGCGCTACCATGGAGGCAGGAGGCATTCTTTTGCTCTCGTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACA
AGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACC
GCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGA
CCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACG
TCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCG
AGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAA
GCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGC
CATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCG
TACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCC
TGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAG
GTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGC
TCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAG
AAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACG
TCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAA
TGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTG
AAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGG
TGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCC
ACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACG
GCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTC
CCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTG
AACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTT
ACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTG
AAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAG
GCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGAC
TACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAG
CCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCA
TTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAA
CAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAA
CCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTA
ATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTC
TTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGT
ATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATA
TAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACT
CGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTG
AAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTT
CACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAA
CTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACC
CTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATA
ATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATACCT

>In-frame_ARHGEF7_ENST00000375737_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3532nt
CACATCCTGTTATTCTGGGTTTTGTGACTTGCTGCCTTGCCACTATGAAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTA
ACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTC
ACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACA
TGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAG
ACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGC
GCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACA
AAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTAC
GGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGC
TCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAA
CCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCA
AAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAG
AGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTC
AAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCA
ACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGC
TAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACA
GTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAAT
GGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCT
CCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACC
ACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGC
CTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAAC
CTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAG
CTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAAT
GTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCT
CAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGA
GACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATG
CAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAG
TCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAA
AAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTG
AAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCAT
CTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATG
CTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGT
TGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGAC
ATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAA
ACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAA
GTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCC
CTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTG
AAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTG
ACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACA
ATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATA

>In-frame_ARHGEF7_ENST00000375737_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3528nt
CACATCCTGTTATTCTGGGTTTTGTGACTTGCTGCCTTGCCACTATGAAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTA
ACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTC
ACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACA
TGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAG
ACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGC
GCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACA
AAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTAC
GGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGC
TCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAA
CCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCA
AAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAG
AGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTC
AAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCA
ACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGC
TAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACA
GTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAAT
GGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCT
CCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACC
ACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGC
CTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAAC
CTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAG
CTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAAT
GTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCT
CAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGA
GACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATG
CAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAG
TCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAA
AAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTG
AAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCAT
CTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATG
CTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGT
TGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGAC
ATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAA
ACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAA
GTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCC
CTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTG
AAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTG
ACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACA
ATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATA

>In-frame_ARHGEF7_ENST00000375737_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3530nt
CACATCCTGTTATTCTGGGTTTTGTGACTTGCTGCCTTGCCACTATGAAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTA
ACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTC
ACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACA
TGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAG
ACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGC
GCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACA
AAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTAC
GGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGC
TCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAA
CCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCA
AAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAG
AGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTC
AAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCA
ACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGC
TAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACA
GTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAAT
GGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCT
CCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACC
ACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGC
CTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAAC
CTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAG
CTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAAT
GTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCT
CAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGA
GACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATG
CAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAG
TCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAA
AAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTG
AAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCAT
CTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATG
CTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGT
TGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGAC
ATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAA
ACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAA
GTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCC
CTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTG
AAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTG
ACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACA
ATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATA

>In-frame_ARHGEF7_ENST00000375723_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3482nt
ACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATC
GGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGG
ACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTC
CAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACA
CTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTG
AAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAA
TATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTA
ATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGA
GTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTC
ACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAA
CCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAA
AAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCC
ATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAA
AAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAG
CTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGG
ATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCC
ACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCG
CTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAA
ACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAG
AGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCT
GCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGAC
CAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAA
AATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGA
TTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCT
GAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGG
CCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTC
TTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCC
AAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACT
AAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTA
GAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCC
CCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGT
TTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTG
CATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAA
AAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGAT
ATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAA
GGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACA
GATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCA
CCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATT

>In-frame_ARHGEF7_ENST00000375723_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3478nt
ACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATC
GGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGG
ACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTC
CAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACA
CTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTG
AAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAA
TATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTA
ATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGA
GTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTC
ACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAA
CCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAA
AAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCC
ATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAA
AAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAG
CTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGG
ATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCC
ACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCG
CTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAA
ACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAG
AGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCT
GCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGAC
CAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAA
AATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGA
TTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCT
GAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGG
CCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTC
TTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCC
AAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACT
AAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTA
GAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCC
CCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGT
TTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTG
CATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAA
AAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGAT
ATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAA
GGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACA
GATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCA
CCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATT

>In-frame_ARHGEF7_ENST00000375723_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3480nt
ACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATC
GGGCTGGGGAGTGACTCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAGTCTTTGCACACTCGG
ACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTC
CAGCAGACCAATGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACA
CTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTG
AAGAGCCCTCCCAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAA
TATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTA
ATGGGAAATCTAGAAGAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGA
GTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTC
ACGGAACACAGTGAGGAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAA
CCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAA
AAATCCATGGCTGCCTTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCC
ATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAA
AAGAATGAAAGATATCTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAG
CTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGG
ATATTAGTGTCGTGCAACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCC
ACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCG
CTGACGCCCGCCTACCACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAA
ACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAG
AGCCCTAAGACCATGAAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCT
GCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGAC
CAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAA
AATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGA
TTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCT
GAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGG
CCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTC
TTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCC
AAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACT
AAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTA
GAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCC
CCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGT
TTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTG
CATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAA
AAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGAT
ATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAA
GGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACA
GATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCA
CCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATT

>In-frame_ARHGEF7_ENST00000478679_chr13_111940790_+_SPATA7_ENST00000556553_chr14_88883055_+_3092nt
CTGCGTCCTCTGGGTTCCCAGCGTTGGTGGGATGGAGCTGTGGCGTCCAGGCTGTGAGGTCTCATGGGGTCCTGCAGCAGCCAGAGCGTG
CAGAAGACGAGGAGGGGAAGAAAGGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCA
ACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTC
CAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCA
CAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTC
ATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACG
CTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCA
GCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAA
ACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCA
AATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAG
CTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGAT
CTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCAT
ACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCAC
CCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTG
CGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCC
AAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAA
GTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAA
TTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTA
CAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCC
TCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGT
GTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGG
TTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCT
CGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGG
ATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATA
AAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATT
AAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAA
GAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTG
TTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACA
TCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTA
AAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAAC
GAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAA
ACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAA
GGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTC
AAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCA

>In-frame_ARHGEF7_ENST00000478679_chr13_111940790_+_SPATA7_ENST00000393545_chr14_88883055_+_3088nt
CTGCGTCCTCTGGGTTCCCAGCGTTGGTGGGATGGAGCTGTGGCGTCCAGGCTGTGAGGTCTCATGGGGTCCTGCAGCAGCCAGAGCGTG
CAGAAGACGAGGAGGGGAAGAAAGGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCA
ACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTC
CAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCA
CAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTC
ATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACG
CTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCA
GCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAA
ACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCA
AATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAG
CTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGAT
CTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCAT
ACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCAC
CCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTG
CGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCC
AAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAA
GTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAA
TTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTA
CAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCC
TCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGT
GTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGG
TTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCT
CGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGG
ATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATA
AAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATT
AAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAA
GAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTG
TTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACA
TCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTA
AAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAAC
GAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAA
ACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAA
GGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTC
AAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCA

>In-frame_ARHGEF7_ENST00000478679_chr13_111940790_+_SPATA7_ENST00000356583_chr14_88883055_+_3090nt
CTGCGTCCTCTGGGTTCCCAGCGTTGGTGGGATGGAGCTGTGGCGTCCAGGCTGTGAGGTCTCATGGGGTCCTGCAGCAGCCAGAGCGTG
CAGAAGACGAGGAGGGGAAGAAAGGTGGTGCTACAGAATATTTTAGAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCA
ACGTACCTACGGCCATTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAAGAAATATGTTCTTTC
CAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCA
CAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAGGAGTTGGGGGAGTTC
ATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACCACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACG
CTGCTCAAAGAGCTCGAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCCTTCAAAAACCTTTCA
GCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAGATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAA
ACTCTGGGCAACGTCACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATATCTTCTACTCTTCCCA
AATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTTATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAG
CTTGAGGACAGTGAAAATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGCAACAACCAGCAGGAT
CTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACGTCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCAT
ACCCTCCCCTCCCACCCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTACCACACGCTGCCCCAC
CCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCCCTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTG
CGGCCCGCGCCTCCCCTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATGAAAAAGCTGCTGCCC
AAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCCCGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAA
GTCATTGAAGCTTACTGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAAATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAA
TTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTA
CAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCC
TCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGT
GTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGG
TTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCT
CGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGG
ATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATA
AAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATT
AAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAA
GAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTG
TTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACA
TCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTA
AAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAAC
GAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAA
ACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAA
GGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTC
AAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCA


Top

FusionGenePPI for ARHGEF7_SPATA7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARHGEF7SHANK2, SHANK1, CBL, SHANK3, TUBB3, GIT1, PPM1E, PPM1F, PAK1, PAK3, CDC42, CBLB, CALM1, ITCH, LRRK2, PAK2, ADAM15, ARHGEF6, GRB2, ERBB2IP, MEOX2, EGFR, RAC1, NCK2, HSPB1, KDM2A, NTRK1, MED4, SLC33A1, SCRIB, GIT2, FBXO28, LPXN, NCKIPSD, ICAM1, EXOC1, KLHL2, CAMK4, SYNC, C1orf106, POTEB3SPATA7APP, PTF1A, HSPB1, RPGRIP1L, RAF1, C21orf2, NEK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARHGEF7_SPATA7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARHGEF7_SPATA7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSPATA7C0035334Retinitis Pigmentosa1CTD_human;ORPHANET
TgeneSPATA7C0339527Leber Congenital Amaurosis1CTD_human;ORPHANET