FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2590

FusionGeneSummary for ARHGEF7_ATP11A

check button Fusion gene summary
Fusion gene informationFusion gene name: ARHGEF7_ATP11A
Fusion gene ID: 2590
HgeneTgene
Gene symbol

ARHGEF7

ATP11A

Gene ID

8874

23250

Gene nameRho guanine nucleotide exchange factor 7ATPase phospholipid transporting 11A
SynonymsBETA-PIX|COOL-1|COOL1|Nbla10314|P50|P50BP|P85|P85COOL1|P85SPR|PAK3|PIXBATPIH|ATPIS
Cytomap

13q34

13q34

Type of geneprotein-codingprotein-coding
Descriptionrho guanine nucleotide exchange factor 7PAK-interacting exchange factor betaRho guanine nucleotide exchange factor (GEF) 7SH3 domain-containing proline-rich proteinprobable phospholipid-transporting ATPase IHATPase, class VI, type 11AP4-ATPase flippase complex alpha subunit ATP11Aphospholipid-translocating ATPasepotential phospholipid-transporting ATPase IH
Modification date2018052220180523
UniProtAcc

Q14155

P98196

Ensembl transtripts involved in fusion geneENST00000317133, ENST00000375741, 
ENST00000375739, ENST00000370623, 
ENST00000544132, ENST00000218789, 
ENST00000375736, ENST00000426073, 
ENST00000375737, ENST00000375723, 
ENST00000478679, ENST00000483189, 
ENST00000283558, ENST00000375630, 
ENST00000487903, ENST00000375645, 
ENST00000419448, 
Fusion gene scores* DoF score11 X 9 X 7=69311 X 10 X 4=440
# samples 1113
** MAII scorelog2(11/693*10)=-2.65535182861255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(13/440*10)=-1.7589919004962
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARHGEF7 [Title/Abstract] AND ATP11A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARHGEF7

GO:0043547

positive regulation of GTPase activity

21048939


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-O1-A52J-01AARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000317133ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000317133ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000317133ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000317133ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000317133ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375741ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375741ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375741ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375741ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000375741ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375739ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375739ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375739ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375739ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000375739ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000370623ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000370623ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000370623ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000370623ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000370623ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
In-frameENST00000544132ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
In-frameENST00000544132ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
In-frameENST00000544132ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
In-frameENST00000544132ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000544132ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000218789ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000218789ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000218789ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000218789ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000218789ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375736ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375736ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375736ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375736ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000375736ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000426073ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000426073ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000426073ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000426073ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000426073ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375737ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375737ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375737ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375737ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000375737ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375723ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375723ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375723ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000375723ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000375723ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000478679ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000478679ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000478679ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
Frame-shitENST00000478679ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
5CDS-intronENST00000478679ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
3UTR-3CDSENST00000483189ENST00000283558ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
3UTR-3CDSENST00000483189ENST00000375630ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
3UTR-3CDSENST00000483189ENST00000487903ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
3UTR-3CDSENST00000483189ENST00000375645ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+
3UTR-intronENST00000483189ENST00000419448ARHGEF7chr13

111920017

+ATP11Achr13

113459271

+

Top

FusionProtFeatures for ARHGEF7_ATP11A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARHGEF7

Q14155

ATP11A

P98196

Catalytic component of a P4-ATPase flippase complexwhich catalyzes the hydrolysis of ATP coupled to the transport ofaminophospholipids from the outer to the inner leaflet of variousmembranes and ensures the maintenance of asymmetric distributionof phospholipids. Phospholipid translocation seems also to beimplicated in vesicle formation and in uptake of lipid signalingmolecules (Probable). May be involved in the uptake offarnesyltransferase inhibitor drugs, such as lonafarnib.{ECO:0000269|PubMed:15860663, ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ARHGEF7_ATP11A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000283558_chr13_113459271_+_1162aa
MCFPRSSVTTDDHQLDGIKSTRAPAPGCCCCPSETLRSGEVARSSAESRRLLFKPDATDENPVPHVLCQSPFCSECPHGTQYTFWNFIPK
NLFEQFRRVANFTFLIIFLVQLIIDTPTSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVM
VKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRP
LGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKT
ESERQRNLFLKAFTDFLAFMVLFNYIIPVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENN
MEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVA
LVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAV
EGLRTLCVATKRLIQEETEGICKLLQAAKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMET
AAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYREL
FLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGH
FTYIRISELVQYFFTKNVCFIFPQFLYQFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWR
VFIYWTLLGLFDALVFFFGATFVFENTTVTSNGQIFGNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWGGVI

>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000375630_chr13_113459271_+_1219aa
MCFPRSSVTTDDHQLDGIKSTRAPAPGCCCCPSETLRSGEVARSSAESRRLLFKPDATDENPVPHVLCQSPFCSECPHGTQYTFWNFIPK
NLFEQFRRVANFTFLIIFLVQLIIDTPTSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVM
VKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRP
LGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKT
ESERQRNLFLKAFTDFLAFMVLFNYIIPVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENN
MEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVA
LVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAV
EGLRTLCVATKRLIQEETEGICKLLQAAKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMET
AAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYREL
FLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGH
FTYIRISELVQYFFTKNVCFIFPQFLYQFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWR
VFIYWTLLGLFDALVFFFGATFVFENTTVTSNGQIFGNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWGGVI
WPFLNYQRMYYVFIQMLSSGPAWLAIVLLVTISLLPDVLKKVLCRQLWPTATERVQNGCAQPRDRDSEFTPLASLQSPGYQSTCPSAAWY

>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000487903_chr13_113459271_+_1162aa
MCFPRSSVTTDDHQLDGIKSTRAPAPGCCCCPSETLRSGEVARSSAESRRLLFKPDATDENPVPHVLCQSPFCSECPHGTQYTFWNFIPK
NLFEQFRRVANFTFLIIFLVQLIIDTPTSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVM
VKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRP
LGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKT
ESERQRNLFLKAFTDFLAFMVLFNYIIPVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENN
MEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVA
LVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAV
EGLRTLCVATKRLIQEETEGICKLLQAAKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMET
AAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYREL
FLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGH
FTYIRISELVQYFFTKNVCFIFPQFLYQFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWR
VFIYWTLLGLFDALVFFFGATFVFENTTVTSNGQIFGNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWGGVI

>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000375645_chr13_113459271_+_1162aa
MCFPRSSVTTDDHQLDGIKSTRAPAPGCCCCPSETLRSGEVARSSAESRRLLFKPDATDENPVPHVLCQSPFCSECPHGTQYTFWNFIPK
NLFEQFRRVANFTFLIIFLVQLIIDTPTSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVM
VKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRP
LGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKT
ESERQRNLFLKAFTDFLAFMVLFNYIIPVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENN
MEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVA
LVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAV
EGLRTLCVATKRLIQEETEGICKLLQAAKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMET
AAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYREL
FLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGH
FTYIRISELVQYFFTKNVCFIFPQFLYQFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWR
VFIYWTLLGLFDALVFFFGATFVFENTTVTSNGQIFGNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWGGVI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000283558_chr13_113459271_+_3486nt
ATGTGTTTCCCCAGATCATCTGTTACTACAGATGATCACCAATTGGATGGTATTAAAAGCACACGTGCCCCTGCTCCGGGTTGTTGCTGT
TGTCCTTCAGAAACTCTGAGGTCTGGAGAGGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAA
AACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTACACATTTTGGAACTTTATACCCAAG
AATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCACAAGTCCA
GTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGCAGACAAT
GCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACATTGTCATG
GTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGCCAGCTTG
GATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCACGCCACC
ATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGTGAGGCCC
TTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAATGGAAACC
AAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCTCTGCATT
CTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCAGAAAACG
GAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCCTGTGTCC
ATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGGCGAGGGG
CCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGAAAACAAC
ATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATC
GACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTG
AAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGAGGTGGCG
CTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCACATCGAA
AGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAATTTATCTG
TTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTG
GAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTG
GCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGTTGAGGAC
CGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGATGGAGACG
GCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCAGAGCCTG
CACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGCAGATATG
CAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAGGGAGCTC
TTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAATCAAATTT
TCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGGTGTCATC
GGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCACGGGCAT
TTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCAGTTCTTC
TGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCTGTACAGC
CTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGC
GTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAACTGTGACA
AGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAAAGCTTGCATTGGAC
ACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATC
TGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTG
ACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCCAGACTAAGAGCCAG

>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000375630_chr13_113459271_+_3657nt
ATGTGTTTCCCCAGATCATCTGTTACTACAGATGATCACCAATTGGATGGTATTAAAAGCACACGTGCCCCTGCTCCGGGTTGTTGCTGT
TGTCCTTCAGAAACTCTGAGGTCTGGAGAGGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAA
AACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTACACATTTTGGAACTTTATACCCAAG
AATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCACAAGTCCA
GTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGCAGACAAT
GCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACATTGTCATG
GTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGCCAGCTTG
GATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCACGCCACC
ATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGTGAGGCCC
TTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAATGGAAACC
AAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCTCTGCATT
CTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCAGAAAACG
GAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCCTGTGTCC
ATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGGCGAGGGG
CCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGAAAACAAC
ATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATC
GACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTG
AAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGAGGTGGCG
CTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCACATCGAA
AGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAATTTATCTG
TTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTG
GAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTG
GCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGTTGAGGAC
CGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGATGGAGACG
GCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCAGAGCCTG
CACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGCAGATATG
CAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAGGGAGCTC
TTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAATCAAATTT
TCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGGTGTCATC
GGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCACGGGCAT
TTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCAGTTCTTC
TGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCTGTACAGC
CTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGC
GTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAACTGTGACA
AGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAAAGCTTGCATTGGAC
ACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATC
TGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTG
ACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCCAGAATGGGTGCGCA
CAGCCTCGGGACCGCGACTCAGAATTCACCCCTCTTGCCTCTCTGCAGAGCCCAGGCTACCAGAGCACCTGTCCCTCGGCCGCCTGGTAC
AGCTCCCACTCTCAGCAGGTGACACTCGCGGCCTGGAAGGAGAAGGTGTCCACGGAGCCCCCACCCATCCTCGGCGGTTCCCATCACCAC

>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000487903_chr13_113459271_+_3486nt
ATGTGTTTCCCCAGATCATCTGTTACTACAGATGATCACCAATTGGATGGTATTAAAAGCACACGTGCCCCTGCTCCGGGTTGTTGCTGT
TGTCCTTCAGAAACTCTGAGGTCTGGAGAGGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAA
AACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTACACATTTTGGAACTTTATACCCAAG
AATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCACAAGTCCA
GTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGCAGACAAT
GCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACATTGTCATG
GTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGCCAGCTTG
GATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCACGCCACC
ATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGTGAGGCCC
TTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAATGGAAACC
AAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCTCTGCATT
CTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCAGAAAACG
GAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCCTGTGTCC
ATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGGCGAGGGG
CCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGAAAACAAC
ATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATC
GACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTG
AAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGAGGTGGCG
CTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCACATCGAA
AGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAATTTATCTG
TTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTG
GAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTG
GCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGTTGAGGAC
CGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGATGGAGACG
GCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCAGAGCCTG
CACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGCAGATATG
CAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAGGGAGCTC
TTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAATCAAATTT
TCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGGTGTCATC
GGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCACGGGCAT
TTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCAGTTCTTC
TGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCTGTACAGC
CTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGC
GTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAACTGTGACA
AGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAAAGCTTGCATTGGAC
ACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATC
TGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTG
ACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCCAGACTAAGAGCCAG

>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000375645_chr13_113459271_+_3486nt
ATGTGTTTCCCCAGATCATCTGTTACTACAGATGATCACCAATTGGATGGTATTAAAAGCACACGTGCCCCTGCTCCGGGTTGTTGCTGT
TGTCCTTCAGAAACTCTGAGGTCTGGAGAGGTTGCCCGAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAA
AACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTACACATTTTGGAACTTTATACCCAAG
AATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCACAAGTCCA
GTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGCAGACAAT
GCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACATTGTCATG
GTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGCCAGCTTG
GATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCACGCCACC
ATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGTGAGGCCC
TTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAATGGAAACC
AAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCTCTGCATT
CTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCAGAAAACG
GAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCCTGTGTCC
ATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGGCGAGGGG
CCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGAAAACAAC
ATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATC
GACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTG
AAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGAGGTGGCG
CTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCACATCGAA
AGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAATTTATCTG
TTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTG
GAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTG
GCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGTTGAGGAC
CGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGATGGAGACG
GCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCAGAGCCTG
CACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGCAGATATG
CAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAGGGAGCTC
TTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAATCAAATTT
TCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGGTGTCATC
GGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCACGGGCAT
TTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCAGTTCTTC
TGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCTGTACAGC
CTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGC
GTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAACTGTGACA
AGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAAAGCTTGCATTGGAC
ACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATC
TGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTG
ACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCCAGACTAAGAGCCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000283558_chr13_113459271_+_4150nt
GAGATTGGTGCAGCCCCGGAGGAAGAAAAAAGGGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTG
CGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTA
GTGACTCTAAATAAAGTAACAGCAGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAA
TGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCG
GACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCC
CAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGCCAGTACTTAGCCGCGGAGCGGAAAGCAGTGCTCATGAAGGTGG
AGGCACACCCAGAGACTGCATGGAGGTGGAACCGGGAAGTCCGGGGTCTGAGGTCCTGCCTGCAGGGTTGAAAGGCATGCCTGCCAGCAG
ACACATTTGGGAGCCAGAGTGTGCTGTGGTCTGAATGTGTTTCCCCAGATCATCTGTTACTACAGATGATCACCAATTGGATGGTATTAA
AAGCACACGTGCCCCTGCTCCGGGTTGTTGCTGTTGTCCTTCAGAAACTCTGAGGTCTGGAGAGGTTGCCCGAAGCTCAGCAGAGAGTCG
GAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGG
AACACAGTACACATTTTGGAACTTTATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCT
GGTGCAGTTGATTATTGATACACCCACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGG
TTATGAAGACTGGCTTCGACATAAAGCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACA
AAGTCGAAAGCTGCGAGTTGGGGACATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGG
AGATGGGACGTGCCACGTCACCACCGCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCA
CACAGAGGAGGATATCGGCGGACTTCACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGT
TTACAGTGACCTGAATGACCCCGTGGTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAAT
CTTTGGTGTGGCTATTTACACGGGAATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATC
GATGAATGCGTTCCTCATTGTGTATCTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCC
CTTTCGGGATGAGCCGTGGTATAATCAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTT
CATGGTCCTCTTTAACTACATCATCCCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGA
CGAAGACATGTTTGACGAGGAGACTGGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTT
CACAGACAAGACCGGCACCCTCACGGAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTG
CAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTT
CCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTG
TGTGTACATCTCATCCTCGCCCGACGAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTA
CATGGAGATATTAAACAGGGAGAACCACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGT
AATTGTAAAATCTGCTACAGGAGAAATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGA
CCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGA
AGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGA
TCTTACTCTGCTTGGTGCTACAGCTGTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAA
AGTCTGGGTTCTCACGGGAGACAAGATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGA
GCTGACCACCAAGAGGATCGAGGAGCAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGAC
CAGAGACAACCTGTCCGGACTTTCAGCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCG
AGAAGACGGGAGTTCCGGCAACTACAGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTT
GCAGAAGGCTCAGATTGTTAAATTAATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCAT
GATTCTGGAAGCGCACGTGGGCATAGGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAA
GCATTTGAAGAAGATGCTGCTTGTTCACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTG
CTTCATCTTCCCTCAGTTTTTATACCAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACAT
CAGCTTCACCTCCCTCCCCATCCTCCTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAG
GGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGG
TGCTTATTTCGTGTTTGAAAATACAACTGTGACAAGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGAT
GGTGTTCACAGTTACACTAAAGCTTGCATTGGACACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTA
CGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATCTGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAG
CGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTGACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCC
AACAGCAACAGAGAGAGTCCAGACTAAGAGCCAGTGCCTTTCTGTCGAGCAGTCAACCATCTTTATGCTTTCTCAGACTTCCAGCAGCCT

>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000375630_chr13_113459271_+_9425nt
GAGATTGGTGCAGCCCCGGAGGAAGAAAAAAGGGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTG
CGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTA
GTGACTCTAAATAAAGTAACAGCAGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAA
TGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCG
GACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCC
CAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGCCAGTACTTAGCCGCGGAGCGGAAAGCAGTGCTCATGAAGGTGG
AGGCACACCCAGAGACTGCATGGAGGTGGAACCGGGAAGTCCGGGGTCTGAGGTCCTGCCTGCAGGGTTGAAAGGCATGCCTGCCAGCAG
ACACATTTGGGAGCCAGAGTGTGCTGTGGTCTGAATGTGTTTCCCCAGATCATCTGTTACTACAGATGATCACCAATTGGATGGTATTAA
AAGCACACGTGCCCCTGCTCCGGGTTGTTGCTGTTGTCCTTCAGAAACTCTGAGGTCTGGAGAGGTTGCCCGAAGCTCAGCAGAGAGTCG
GAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGG
AACACAGTACACATTTTGGAACTTTATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCT
GGTGCAGTTGATTATTGATACACCCACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGG
TTATGAAGACTGGCTTCGACATAAAGCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACA
AAGTCGAAAGCTGCGAGTTGGGGACATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGG
AGATGGGACGTGCCACGTCACCACCGCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCA
CACAGAGGAGGATATCGGCGGACTTCACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGT
TTACAGTGACCTGAATGACCCCGTGGTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAAT
CTTTGGTGTGGCTATTTACACGGGAATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATC
GATGAATGCGTTCCTCATTGTGTATCTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCC
CTTTCGGGATGAGCCGTGGTATAATCAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTT
CATGGTCCTCTTTAACTACATCATCCCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGA
CGAAGACATGTTTGACGAGGAGACTGGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTT
CACAGACAAGACCGGCACCCTCACGGAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTG
CAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTT
CCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTG
TGTGTACATCTCATCCTCGCCCGACGAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTA
CATGGAGATATTAAACAGGGAGAACCACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGT
AATTGTAAAATCTGCTACAGGAGAAATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGA
CCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGA
AGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGA
TCTTACTCTGCTTGGTGCTACAGCTGTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAA
AGTCTGGGTTCTCACGGGAGACAAGATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGA
GCTGACCACCAAGAGGATCGAGGAGCAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGAC
CAGAGACAACCTGTCCGGACTTTCAGCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCG
AGAAGACGGGAGTTCCGGCAACTACAGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTT
GCAGAAGGCTCAGATTGTTAAATTAATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCAT
GATTCTGGAAGCGCACGTGGGCATAGGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAA
GCATTTGAAGAAGATGCTGCTTGTTCACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTG
CTTCATCTTCCCTCAGTTTTTATACCAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACAT
CAGCTTCACCTCCCTCCCCATCCTCCTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAG
GGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGG
TGCTTATTTCGTGTTTGAAAATACAACTGTGACAAGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGAT
GGTGTTCACAGTTACACTAAAGCTTGCATTGGACACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTA
CGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATCTGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAG
CGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTGACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCC
AACAGCAACAGAGAGAGTCCAGAATGGGTGCGCACAGCCTCGGGACCGCGACTCAGAATTCACCCCTCTTGCCTCTCTGCAGAGCCCAGG
CTACCAGAGCACCTGTCCCTCGGCCGCCTGGTACAGCTCCCACTCTCAGCAGGTGACACTCGCGGCCTGGAAGGAGAAGGTGTCCACGGA
GCCCCCACCCATCCTCGGCGGTTCCCATCACCACTGCAGTTCCATCCCAAGTCACAGCTGCCCTAGGTCCCGTGTGGGAATGCTCGTGTG
ATGGATGGTCCTAAGCCTGTGGAGACTGTGCACGTGCCTCTTCCTGGCCCCCAGCAGGCAAGGAGGGGGGTCACAGGCCTTGCCCTCGAG
CATGGCACCCTGGCCGCCTGGACCCAGCACTGTGGTTGTTGAGCCACACCAGTGGCCTCTGGGCATTCGGCTCAACGCAGGAGGGACATT
CTGCTGGCCCACCCTGCGCGCTGTCATGCAGAGGCCATTCCCCCAGGCCTGTGTCTTCACCCACCTGCCATCATTGGCCTTTGCTGTCAC
TGGGAGAGAAGAGCCGTCCAGGGACCCATGGTGGCCCACATGTGGATGCCACATGCTGCTGTTTCCTGCTTGCCCGGCCACCACCCATGC
CCTCCATAGGGTGAGGTGGAGCCATGGTGGTGCGTCCTTTACTCAACAACCCTCCAATCCGGATGCTGTGGGAAGGGCCGGGTCACTCGG
ATACCATCATCCCTGCGGATGCACCGCCGTACCCTGCTCATCTGGGAGTGGTTTCCCTGCGGTTACGTCCAAGCCCGCCTGCCCTGTGTG
TTGGGGCTGGCTGAGTTTCGGTCTCCCCATCACCGGCCGCCTCGTGGAGAAGGCAGTGCCACGTGGGAGGACAAGGCCACGCCGGCAGCT
TCCAGCCCTGCCGCAGAAGTGCCAGGATGTCCATCAGCCACTCGCCAGGGCACGGAGCCGTCAGTCCACTGTTACGGGAGAATGTTGATT
TCGCGGGTGCGAGGGCCGGGAGACAGATACTTGGCTGTGATGAGCAGACATCCTCTGTCCCCGTGGAGGGGTCAACACCAAGGTGGTGTT
CGTGCACCAGAACCTGTCTCGGGCTGACGGGGGTGGCACACAGGACACGGGTGGATCCCAACAGGCAGCACCGCACCTCTGCCCGCCTCC
CGCACTGCAGCTCCGCCCGCCGGGCTCTGCGTCCCCACGTCCCCTCGTCCCATCCCCACGTCCCCTCATCCCGTCACCTCGTCCCCACAT
CCCCTTGCCCCGTCACCTCGTCCTCATGTCCCCTTGTCCTGTCACCTCGTCCCCACGTCCCCTCGTCTCCTCATCCCCACGTCCTCTCGT
CCCCTTGTCCCGTCCCCACATACCCTCGTCCCCATGTCCCCACGCAGGGCTCTCCTTCGTCTTAGGATCTGTCCAGCGCTGCTCTGGGTG
GGTTAGCAACCCCAGGGCTGCTGTGATAGGAAGTCCCTGTTGTTCTCCGTACTGGCATTTCTATTTCTAGAAATAATATTTGACATAGCC
TTAATGGTCCTTAAAGAAGACATTTCAGTGTGAGATTCAGACTTCAGACGCTGAAACTGCTGCCTTTCAGGAAAGCACCACCAACGCTGG
AGGAGGAGCCGGCCCTCACGCCCGCCCCGCGCCACGCTGTGGAACGGGGCTCCGGCAAGTGAAACCCAGAGGGTGTTTCCGAGGTGCTCG
ACAGTAGGTATTTTTGGAAGCTCAGATTTCACCATTTGATTGTATAATCTTTTACCTATAAAATATTTATTTGAAGTAGAGGGTAAATCA
GCGGTAAGAACAGTGAACACAGTGGTTGGGATAAAATAAGGTGACAAACATCACACCAAAGATGAGGGTAGCGAGCAACTGGCTTGAGCA
GACAGAACGGGGAAGACTCCACTCTGTCCCGAGGGGCCAGCCGCAGGCGTCCCCAGGGCCACCCTGCCCTGAGGTCCTTGTGTGGCCGCC
CTGGCTTGGCAGCCCTGCCCACGCTGCCCCCGCAAACAATGGTGTGTGCGTTTTTACAGCCCTTTTTAGGAACCCAATATGGGCATAAAT
GTAACACCTGTAGCGGGGGCAGATTCTCTGTATGTTCAGTTAACAAATTATTTGTAATGTATTTTTTTAGAAATCTTAAAATTGCCTTTG
CACTGAAGTATTTTCATAGCTGTTTATATCTCTTTTATTCATTTATTTAACATACTGTCTAATTTTAAAAATAGGTTTTTAAAGCTTTCA
TTTTTAAGTTTATGAAATTTTGGCCACTTTACATTTAGATTCTGGTGAGAGTTTTGACTGAATGTTCCAATCTCTGATGAATGCGAATTT
TCAGATTTGATTTTATTCTCTACACACACCTCTTCTTTTCTTGGTATTTCTGGTGGCAGTGATTAGTTGAACAGCACATTTAAGGCACGA
TAATTTGCTACACTTTTTCTTTACAATTTGTTGCAATTTCATCTGCTTTCTATGTTTCATTGTTAATTGCCATCCTTCAGCCTTAAAAAT
AGAAGATTCTCACGTGAAGGTTTAGTAAGTTGGGTCCCAGCTCTGCCTGTGTGGAGATAGTCACCATGTACCTCTGACAACAAGTTTTAG
TGTGAAAGTCACTAAACTTTTACACACTCCCAAACGTCTTTTTAAAAATTGCTTGGGAAATTATTAAATGAATGTGCCTGATGATTTGAA
ATAGACAAGGGGCACGAGATAAAAAAGAAAAGGATGAGAAGATCCTCAGTGAATGACGTTGCAGGGTCTTCATGCAATTTTCCACCTCGC
AGTAGTTAGTATTTACTTGCCTTAAACTAACTTTGAAGCAAGTAATGTCAACTTTGAGCACTTTGTTGAGTTTTGAAAAATCTTATTTGT
TGCTGCACAGGTTAATAAATTATCAATTTGTAATTCAGCATGTTGGTCAGAGACACGGTCACTGATTCACACCCAGTCCCTGCCACAGAC
CGTCTCAGACACGCACAGTGGGCCTGCTGCATGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCA
TGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGCGTGTTACCTGGCTTTTGGCTCCACGCTC
ACTCATAGCCATGTCCACATGGGGGCTTGCACACAGGATCACTCACATATGTACATGTACCCACCACAAACGTGCAAGCTCCTGCACACA
TGCATGCACACAAACGTGTACACAAGTGTGAGCTCCTACACGCATACACACACACACGTGTACATGCACCAAAGCATGTGTGACCTACAG
ACATGCAGAACATGCACGTGTACACATACCACAGACACGCGTGTGCATGCTCCTACACAATACATATGCACATATCATGAACAGCGTAAG
TTCCTACACACGGACGTGTGATACACACATGCATGTACAGGTAAGCACACATGTACAAGCTCCTACAGGCTTGCTCTCACACACGTGTAT
GCACAGCAGAGAGACGTATGAGCTTCTACTGCACACATGCACACACACACGCACACGTACATTCACTACAAACGTGCAGCCTCCTGCACA
CGTGCACATTCATGTGTACACCACAAATGAGTTCCCAGACGTGTAAACACACGTGCACACATCGTACACATGTGAGCTCCCACACGTACA
CACAGATGCACATGGACACACCCCAAACACGCACAGGCTCCTACACACATGCACACACGTGTACACCACAAACGAGCTCCCAGACATGTA
AACACACGTCTCCCACACGTGAGCTCCCACACGTACACATGCACATGTACGCACCACAAACACATGCGCAGGCTCCTGCAGGCGTGAATA
CACACATGCACACACATATACACACATGTGCCACAAACAAGTGCACACTGTCCTGGTGTCCTGCACTGCATCCTGCCTCCTTGCTGAGGG
GCCCCTGTGAGAGGCCTCTGGATGGGCATGGGAAGATGGGCTCCCTGGCCCCCAGCCCATGCCTCCCTGGGATGAAGAGTCCCCCTCCTG
GCAGAATGTCTGGGCTTTGCAGAGCAGGCCCCGGGGGTGAAGTCGCAGCTTCACTTACACCAGCTGCTCTGTGAGCAAGGCTTGGTGCCC
TGGACAAGGCCCTTCCCCTTTAGGGAGGTCCAGCCTCGCAAGCTGAAACCTCCCCTCGGCTCAGCCCTATACCAGGCGGCCACAGCAGGA
CTGGCCACACCCACGCCGCACCTCATCCGTGCACGCGTCGGAGCACGGCCAGCCTTCCGCCACGAGCCAGCTGGGAAGGGCCGCGGCCGC
CTAAAGCCCCAGTCAACCCAGCCTGTGTCTGAGCAGACAGGGCGAACAAGCAGGCCACACCGTCTCGAGGGAGGAGGCCAGATGCGGCCA
GCGTCTCCAACAGGGTGACCATCCGCTCGGCTTGCTGAGCGTTTAAACAAATGTTTAGACAGGCTGTGGGGACTCCCCTGAGTTGAGCCT
TGGCCAGGGGTCCGGTGCTGTCGCGGGAAACCTCCAGCCTTGTTCTTCAAACCACTCAGCTCATGTGTTTTGCACTGACTAGTACTGAAT
AATACAACCACTCTTATTTAATGTTAGTATTATTTATTTGACAACTCAGTGTCTAACAGCTTGATATGCAGGTCCTTGCATCCTACATTT
CTTTAGGAAGTTACCCATTTGTAACTTTAAAAACAGGAAAAATATCAGTTGGCAAATGCAATCTTTTTTTTTTTTAAGCTAAAGGTGGGT
GAACTGGAATGAAAATCTTTCTGATGTTGTGTCTATAAGCAGCCTTGATGGGATATGTTAGAAGTGTCATGAAAGTGTGATTCTACTTTT
GCAGAAAAATCTAAAGATCAATTTATATAGCTTTATTTTTTACTTTATCAAAGTATACAGAATTTTAATATGCATATATTGTGTCTGACT
TAAAATTATAATGTCTGCGTCACCATTTAAAATGTCTGTTCATTATGTAATGTAATAAAAGAAGGTCTTCAAAAATGTATTTAACATGAA
TGGTATCCATAGTTGTCATCATCATAAATACTGGAGTTTATTTTTAAATTATTAAACATAGTAGGTGCATTAACATAAATCAGTCTCCAC
ACAGTAACATTTAACTGATAATTCATTAATCAGCTTTGAAAAATTAAATTGTTAATTAAACCAATCTAACATTTCAGTAAAGTTTATTTT
GTATGCTTCTGTTTTTAACTTTTATTTCTGTAGATAAACTGACTGGATAATATTATATTGGACTTTTCTCTAGATTATCTAAGCAGGAGA

>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000487903_chr13_113459271_+_9515nt
GAGATTGGTGCAGCCCCGGAGGAAGAAAAAAGGGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTG
CGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTA
GTGACTCTAAATAAAGTAACAGCAGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAA
TGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCG
GACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCC
CAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGCCAGTACTTAGCCGCGGAGCGGAAAGCAGTGCTCATGAAGGTGG
AGGCACACCCAGAGACTGCATGGAGGTGGAACCGGGAAGTCCGGGGTCTGAGGTCCTGCCTGCAGGGTTGAAAGGCATGCCTGCCAGCAG
ACACATTTGGGAGCCAGAGTGTGCTGTGGTCTGAATGTGTTTCCCCAGATCATCTGTTACTACAGATGATCACCAATTGGATGGTATTAA
AAGCACACGTGCCCCTGCTCCGGGTTGTTGCTGTTGTCCTTCAGAAACTCTGAGGTCTGGAGAGGTTGCCCGAAGCTCAGCAGAGAGTCG
GAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGG
AACACAGTACACATTTTGGAACTTTATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCT
GGTGCAGTTGATTATTGATACACCCACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGG
TTATGAAGACTGGCTTCGACATAAAGCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACA
AAGTCGAAAGCTGCGAGTTGGGGACATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGG
AGATGGGACGTGCCACGTCACCACCGCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCA
CACAGAGGAGGATATCGGCGGACTTCACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGT
TTACAGTGACCTGAATGACCCCGTGGTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAAT
CTTTGGTGTGGCTATTTACACGGGAATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATC
GATGAATGCGTTCCTCATTGTGTATCTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCC
CTTTCGGGATGAGCCGTGGTATAATCAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTT
CATGGTCCTCTTTAACTACATCATCCCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGA
CGAAGACATGTTTGACGAGGAGACTGGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTT
CACAGACAAGACCGGCACCCTCACGGAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTG
CAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTT
CCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTG
TGTGTACATCTCATCCTCGCCCGACGAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTA
CATGGAGATATTAAACAGGGAGAACCACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGT
AATTGTAAAATCTGCTACAGGAGAAATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGA
CCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGA
AGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGA
TCTTACTCTGCTTGGTGCTACAGCTGTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAA
AGTCTGGGTTCTCACGGGAGACAAGATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGA
GCTGACCACCAAGAGGATCGAGGAGCAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGAC
CAGAGACAACCTGTCCGGACTTTCAGCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCG
AGAAGACGGGAGTTCCGGCAACTACAGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTT
GCAGAAGGCTCAGATTGTTAAATTAATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCAT
GATTCTGGAAGCGCACGTGGGCATAGGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAA
GCATTTGAAGAAGATGCTGCTTGTTCACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTG
CTTCATCTTCCCTCAGTTTTTATACCAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACAT
CAGCTTCACCTCCCTCCCCATCCTCCTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAG
GGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGG
TGCTTATTTCGTGTTTGAAAATACAACTGTGACAAGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGAT
GGTGTTCACAGTTACACTAAAGCTTGCATTGGACACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTA
CGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATCTGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAG
CGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTGACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCC
AACAGCAACAGAGAGAGTCCAGACTAAGAGCCAGTGCCTTTCTGTCGAGCAGTCAACCATCTTTATGCTTTCTCAGACTTCCAGCAGCCT
GAGTTTCTGATGGAACAAGCAGAATGGGTGCGCACAGCCTCGGGACCGCGACTCAGAATTCACCCCTCTTGCCTCTCTGCAGAGCCCAGG
CTACCAGAGCACCTGTCCCTCGGCCGCCTGGTACAGCTCCCACTCTCAGCAGGTGACACTCGCGGCCTGGAAGGAGAAGGTGTCCACGGA
GCCCCCACCCATCCTCGGCGGTTCCCATCACCACTGCAGTTCCATCCCAAGTCACAGCTGCCCTAGGTCCCGTGTGGGAATGCTCGTGTG
ATGGATGGTCCTAAGCCTGTGGAGACTGTGCACGTGCCTCTTCCTGGCCCCCAGCAGGCAAGGAGGGGGGTCACAGGCCTTGCCCTCGAG
CATGGCACCCTGGCCGCCTGGACCCAGCACTGTGGTTGTTGAGCCACACCAGTGGCCTCTGGGCATTCGGCTCAACGCAGGAGGGACATT
CTGCTGGCCCACCCTGCGCGCTGTCATGCAGAGGCCATTCCCCCAGGCCTGTGTCTTCACCCACCTGCCATCATTGGCCTTTGCTGTCAC
TGGGAGAGAAGAGCCGTCCAGGGACCCATGGTGGCCCACATGTGGATGCCACATGCTGCTGTTTCCTGCTTGCCCGGCCACCACCCATGC
CCTCCATAGGGTGAGGTGGAGCCATGGTGGTGCGTCCTTTACTCAACAACCCTCCAATCCGGATGCTGTGGGAAGGGCCGGGTCACTCGG
ATACCATCATCCCTGCGGATGCACCGCCGTACCCTGCTCATCTGGGAGTGGTTTCCCTGCGGTTACGTCCAAGCCCGCCTGCCCTGTGTG
TTGGGGCTGGCTGAGTTTCGGTCTCCCCATCACCGGCCGCCTCGTGGAGAAGGCAGTGCCACGTGGGAGGACAAGGCCACGCCGGCAGCT
TCCAGCCCTGCCGCAGAAGTGCCAGGATGTCCATCAGCCACTCGCCAGGGCACGGAGCCGTCAGTCCACTGTTACGGGAGAATGTTGATT
TCGCGGGTGCGAGGGCCGGGAGACAGATACTTGGCTGTGATGAGCAGACATCCTCTGTCCCCGTGGAGGGGTCAACACCAAGGTGGTGTT
CGTGCACCAGAACCTGTCTCGGGCTGACGGGGGTGGCACACAGGACACGGGTGGATCCCAACAGGCAGCACCGCACCTCTGCCCGCCTCC
CGCACTGCAGCTCCGCCCGCCGGGCTCTGCGTCCCCACGTCCCCTCGTCCCATCCCCACGTCCCCTCATCCCGTCACCTCGTCCCCACAT
CCCCTTGCCCCGTCACCTCGTCCTCATGTCCCCTTGTCCTGTCACCTCGTCCCCACGTCCCCTCGTCTCCTCATCCCCACGTCCTCTCGT
CCCCTTGTCCCGTCCCCACATACCCTCGTCCCCATGTCCCCACGCAGGGCTCTCCTTCGTCTTAGGATCTGTCCAGCGCTGCTCTGGGTG
GGTTAGCAACCCCAGGGCTGCTGTGATAGGAAGTCCCTGTTGTTCTCCGTACTGGCATTTCTATTTCTAGAAATAATATTTGACATAGCC
TTAATGGTCCTTAAAGAAGACATTTCAGTGTGAGATTCAGACTTCAGACGCTGAAACTGCTGCCTTTCAGGAAAGCACCACCAACGCTGG
AGGAGGAGCCGGCCCTCACGCCCGCCCCGCGCCACGCTGTGGAACGGGGCTCCGGCAAGTGAAACCCAGAGGGTGTTTCCGAGGTGCTCG
ACAGTAGGTATTTTTGGAAGCTCAGATTTCACCATTTGATTGTATAATCTTTTACCTATAAAATATTTATTTGAAGTAGAGGGTAAATCA
GCGGTAAGAACAGTGAACACAGTGGTTGGGATAAAATAAGGTGACAAACATCACACCAAAGATGAGGGTAGCGAGCAACTGGCTTGAGCA
GACAGAACGGGGAAGACTCCACTCTGTCCCGAGGGGCCAGCCGCAGGCGTCCCCAGGGCCACCCTGCCCTGAGGTCCTTGTGTGGCCGCC
CTGGCTTGGCAGCCCTGCCCACGCTGCCCCCGCAAACAATGGTGTGTGCGTTTTTACAGCCCTTTTTAGGAACCCAATATGGGCATAAAT
GTAACACCTGTAGCGGGGGCAGATTCTCTGTATGTTCAGTTAACAAATTATTTGTAATGTATTTTTTTAGAAATCTTAAAATTGCCTTTG
CACTGAAGTATTTTCATAGCTGTTTATATCTCTTTTATTCATTTATTTAACATACTGTCTAATTTTAAAAATAGGTTTTTAAAGCTTTCA
TTTTTAAGTTTATGAAATTTTGGCCACTTTACATTTAGATTCTGGTGAGAGTTTTGACTGAATGTTCCAATCTCTGATGAATGCGAATTT
TCAGATTTGATTTTATTCTCTACACACACCTCTTCTTTTCTTGGTATTTCTGGTGGCAGTGATTAGTTGAACAGCACATTTAAGGCACGA
TAATTTGCTACACTTTTTCTTTACAATTTGTTGCAATTTCATCTGCTTTCTATGTTTCATTGTTAATTGCCATCCTTCAGCCTTAAAAAT
AGAAGATTCTCACGTGAAGGTTTAGTAAGTTGGGTCCCAGCTCTGCCTGTGTGGAGATAGTCACCATGTACCTCTGACAACAAGTTTTAG
TGTGAAAGTCACTAAACTTTTACACACTCCCAAACGTCTTTTTAAAAATTGCTTGGGAAATTATTAAATGAATGTGCCTGATGATTTGAA
ATAGACAAGGGGCACGAGATAAAAAAGAAAAGGATGAGAAGATCCTCAGTGAATGACGTTGCAGGGTCTTCATGCAATTTTCCACCTCGC
AGTAGTTAGTATTTACTTGCCTTAAACTAACTTTGAAGCAAGTAATGTCAACTTTGAGCACTTTGTTGAGTTTTGAAAAATCTTATTTGT
TGCTGCACAGGTTAATAAATTATCAATTTGTAATTCAGCATGTTGGTCAGAGACACGGTCACTGATTCACACCCAGTCCCTGCCACAGAC
CGTCTCAGACACGCACAGTGGGCCTGCTGCATGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCA
TGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGCGTGTTACCTGGCTTTTGGCTCCACGCTC
ACTCATAGCCATGTCCACATGGGGGCTTGCACACAGGATCACTCACATATGTACATGTACCCACCACAAACGTGCAAGCTCCTGCACACA
TGCATGCACACAAACGTGTACACAAGTGTGAGCTCCTACACGCATACACACACACACGTGTACATGCACCAAAGCATGTGTGACCTACAG
ACATGCAGAACATGCACGTGTACACATACCACAGACACGCGTGTGCATGCTCCTACACAATACATATGCACATATCATGAACAGCGTAAG
TTCCTACACACGGACGTGTGATACACACATGCATGTACAGGTAAGCACACATGTACAAGCTCCTACAGGCTTGCTCTCACACACGTGTAT
GCACAGCAGAGAGACGTATGAGCTTCTACTGCACACATGCACACACACACGCACACGTACATTCACTACAAACGTGCAGCCTCCTGCACA
CGTGCACATTCATGTGTACACCACAAATGAGTTCCCAGACGTGTAAACACACGTGCACACATCGTACACATGTGAGCTCCCACACGTACA
CACAGATGCACATGGACACACCCCAAACACGCACAGGCTCCTACACACATGCACACACGTGTACACCACAAACGAGCTCCCAGACATGTA
AACACACGTCTCCCACACGTGAGCTCCCACACGTACACATGCACATGTACGCACCACAAACACATGCGCAGGCTCCTGCAGGCGTGAATA
CACACATGCACACACATATACACACATGTGCCACAAACAAGTGCACACTGTCCTGGTGTCCTGCACTGCATCCTGCCTCCTTGCTGAGGG
GCCCCTGTGAGAGGCCTCTGGATGGGCATGGGAAGATGGGCTCCCTGGCCCCCAGCCCATGCCTCCCTGGGATGAAGAGTCCCCCTCCTG
GCAGAATGTCTGGGCTTTGCAGAGCAGGCCCCGGGGGTGAAGTCGCAGCTTCACTTACACCAGCTGCTCTGTGAGCAAGGCTTGGTGCCC
TGGACAAGGCCCTTCCCCTTTAGGGAGGTCCAGCCTCGCAAGCTGAAACCTCCCCTCGGCTCAGCCCTATACCAGGCGGCCACAGCAGGA
CTGGCCACACCCACGCCGCACCTCATCCGTGCACGCGTCGGAGCACGGCCAGCCTTCCGCCACGAGCCAGCTGGGAAGGGCCGCGGCCGC
CTAAAGCCCCAGTCAACCCAGCCTGTGTCTGAGCAGACAGGGCGAACAAGCAGGCCACACCGTCTCGAGGGAGGAGGCCAGATGCGGCCA
GCGTCTCCAACAGGGTGACCATCCGCTCGGCTTGCTGAGCGTTTAAACAAATGTTTAGACAGGCTGTGGGGACTCCCCTGAGTTGAGCCT
TGGCCAGGGGTCCGGTGCTGTCGCGGGAAACCTCCAGCCTTGTTCTTCAAACCACTCAGCTCATGTGTTTTGCACTGACTAGTACTGAAT
AATACAACCACTCTTATTTAATGTTAGTATTATTTATTTGACAACTCAGTGTCTAACAGCTTGATATGCAGGTCCTTGCATCCTACATTT
CTTTAGGAAGTTACCCATTTGTAACTTTAAAAACAGGAAAAATATCAGTTGGCAAATGCAATCTTTTTTTTTTTTAAGCTAAAGGTGGGT
GAACTGGAATGAAAATCTTTCTGATGTTGTGTCTATAAGCAGCCTTGATGGGATATGTTAGAAGTGTCATGAAAGTGTGATTCTACTTTT
GCAGAAAAATCTAAAGATCAATTTATATAGCTTTATTTTTTACTTTATCAAAGTATACAGAATTTTAATATGCATATATTGTGTCTGACT
TAAAATTATAATGTCTGCGTCACCATTTAAAATGTCTGTTCATTATGTAATGTAATAAAAGAAGGTCTTCAAAAATGTATTTAACATGAA
TGGTATCCATAGTTGTCATCATCATAAATACTGGAGTTTATTTTTAAATTATTAAACATAGTAGGTGCATTAACATAAATCAGTCTCCAC
ACAGTAACATTTAACTGATAATTCATTAATCAGCTTTGAAAAATTAAATTGTTAATTAAACCAATCTAACATTTCAGTAAAGTTTATTTT
GTATGCTTCTGTTTTTAACTTTTATTTCTGTAGATAAACTGACTGGATAATATTATATTGGACTTTTCTCTAGATTATCTAAGCAGGAGA

>In-frame_ARHGEF7_ENST00000544132_chr13_111920017_+_ATP11A_ENST00000375645_chr13_113459271_+_9452nt
GAGATTGGTGCAGCCCCGGAGGAAGAAAAAAGGGTCTACCCCGAGCCCCGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTG
CGCGGCTGCGGGGCTTCCCTGCGGCTGGAGACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAGGTCCTCAGTTCCTTA
GTGACTCTAAATAAAGTAACAGCAGGACATGACCGATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAA
TGAGGACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGCTGGTGGGAGGGCACACTCAACGGCCG
GACCGGCTGGTTCCCCAGCAACTACGTGCGCGAGGTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCC
CAAAGGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGCCAGTACTTAGCCGCGGAGCGGAAAGCAGTGCTCATGAAGGTGG
AGGCACACCCAGAGACTGCATGGAGGTGGAACCGGGAAGTCCGGGGTCTGAGGTCCTGCCTGCAGGGTTGAAAGGCATGCCTGCCAGCAG
ACACATTTGGGAGCCAGAGTGTGCTGTGGTCTGAATGTGTTTCCCCAGATCATCTGTTACTACAGATGATCACCAATTGGATGGTATTAA
AAGCACACGTGCCCCTGCTCCGGGTTGTTGCTGTTGTCCTTCAGAAACTCTGAGGTCTGGAGAGGTTGCCCGAAGCTCAGCAGAGAGTCG
GAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTGTACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGG
AACACAGTACACATTTTGGAACTTTATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCT
GGTGCAGTTGATTATTGATACACCCACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGG
TTATGAAGACTGGCTTCGACATAAAGCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACA
AAGTCGAAAGCTGCGAGTTGGGGACATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGG
AGATGGGACGTGCCACGTCACCACCGCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCA
CACAGAGGAGGATATCGGCGGACTTCACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGT
TTACAGTGACCTGAATGACCCCGTGGTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAAT
CTTTGGTGTGGCTATTTACACGGGAATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATC
GATGAATGCGTTCCTCATTGTGTATCTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCC
CTTTCGGGATGAGCCGTGGTATAATCAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTT
CATGGTCCTCTTTAACTACATCATCCCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGA
CGAAGACATGTTTGACGAGGAGACTGGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTT
CACAGACAAGACCGGCACCCTCACGGAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTG
CAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTT
CCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTG
TGTGTACATCTCATCCTCGCCCGACGAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTA
CATGGAGATATTAAACAGGGAGAACCACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGT
AATTGTAAAATCTGCTACAGGAGAAATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGA
CCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGA
AGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGA
TCTTACTCTGCTTGGTGCTACAGCTGTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAA
AGTCTGGGTTCTCACGGGAGACAAGATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGA
GCTGACCACCAAGAGGATCGAGGAGCAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGAC
CAGAGACAACCTGTCCGGACTTTCAGCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCG
AGAAGACGGGAGTTCCGGCAACTACAGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTT
GCAGAAGGCTCAGATTGTTAAATTAATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCAT
GATTCTGGAAGCGCACGTGGGCATAGGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAA
GCATTTGAAGAAGATGCTGCTTGTTCACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTG
CTTCATCTTCCCTCAGTTTTTATACCAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACAT
CAGCTTCACCTCCCTCCCCATCCTCCTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAG
GGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGG
TGCTTATTTCGTGTTTGAAAATACAACTGTGACAAGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGAT
GGTGTTCACAGTTACACTAAAGCTTGCATTGGACACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTA
CGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATCTGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAG
CGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTGACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCC
AACAGCAACAGAGAGAGTCCAGACTAAGAGCCAGTGCCTTTCTGTCGAGCAGTCAACCATCTTTATGCTTTCTCAGACTTCCAGCAGCCT
GAGTTTCTGATGGAACAAGAGCCCAGGCTACCAGAGCACCTGTCCCTCGGCCGCCTGGTACAGCTCCCACTCTCAGCAGGTGACACTCGC
GGCCTGGAAGGAGAAGGTGTCCACGGAGCCCCCACCCATCCTCGGCGGTTCCCATCACCACTGCAGTTCCATCCCAAGTCACAGCTGCCC
TAGGTCCCGTGTGGGAATGCTCGTGTGATGGATGGTCCTAAGCCTGTGGAGACTGTGCACGTGCCTCTTCCTGGCCCCCAGCAGGCAAGG
AGGGGGGTCACAGGCCTTGCCCTCGAGCATGGCACCCTGGCCGCCTGGACCCAGCACTGTGGTTGTTGAGCCACACCAGTGGCCTCTGGG
CATTCGGCTCAACGCAGGAGGGACATTCTGCTGGCCCACCCTGCGCGCTGTCATGCAGAGGCCATTCCCCCAGGCCTGTGTCTTCACCCA
CCTGCCATCATTGGCCTTTGCTGTCACTGGGAGAGAAGAGCCGTCCAGGGACCCATGGTGGCCCACATGTGGATGCCACATGCTGCTGTT
TCCTGCTTGCCCGGCCACCACCCATGCCCTCCATAGGGTGAGGTGGAGCCATGGTGGTGCGTCCTTTACTCAACAACCCTCCAATCCGGA
TGCTGTGGGAAGGGCCGGGTCACTCGGATACCATCATCCCTGCGGATGCACCGCCGTACCCTGCTCATCTGGGAGTGGTTTCCCTGCGGT
TACGTCCAAGCCCGCCTGCCCTGTGTGTTGGGGCTGGCTGAGTTTCGGTCTCCCCATCACCGGCCGCCTCGTGGAGAAGGCAGTGCCACG
TGGGAGGACAAGGCCACGCCGGCAGCTTCCAGCCCTGCCGCAGAAGTGCCAGGATGTCCATCAGCCACTCGCCAGGGCACGGAGCCGTCA
GTCCACTGTTACGGGAGAATGTTGATTTCGCGGGTGCGAGGGCCGGGAGACAGATACTTGGCTGTGATGAGCAGACATCCTCTGTCCCCG
TGGAGGGGTCAACACCAAGGTGGTGTTCGTGCACCAGAACCTGTCTCGGGCTGACGGGGGTGGCACACAGGACACGGGTGGATCCCAACA
GGCAGCACCGCACCTCTGCCCGCCTCCCGCACTGCAGCTCCGCCCGCCGGGCTCTGCGTCCCCACGTCCCCTCGTCCCATCCCCACGTCC
CCTCATCCCGTCACCTCGTCCCCACATCCCCTTGCCCCGTCACCTCGTCCTCATGTCCCCTTGTCCTGTCACCTCGTCCCCACGTCCCCT
CGTCTCCTCATCCCCACGTCCTCTCGTCCCCTTGTCCCGTCCCCACATACCCTCGTCCCCATGTCCCCACGCAGGGCTCTCCTTCGTCTT
AGGATCTGTCCAGCGCTGCTCTGGGTGGGTTAGCAACCCCAGGGCTGCTGTGATAGGAAGTCCCTGTTGTTCTCCGTACTGGCATTTCTA
TTTCTAGAAATAATATTTGACATAGCCTTAATGGTCCTTAAAGAAGACATTTCAGTGTGAGATTCAGACTTCAGACGCTGAAACTGCTGC
CTTTCAGGAAAGCACCACCAACGCTGGAGGAGGAGCCGGCCCTCACGCCCGCCCCGCGCCACGCTGTGGAACGGGGCTCCGGCAAGTGAA
ACCCAGAGGGTGTTTCCGAGGTGCTCGACAGTAGGTATTTTTGGAAGCTCAGATTTCACCATTTGATTGTATAATCTTTTACCTATAAAA
TATTTATTTGAAGTAGAGGGTAAATCAGCGGTAAGAACAGTGAACACAGTGGTTGGGATAAAATAAGGTGACAAACATCACACCAAAGAT
GAGGGTAGCGAGCAACTGGCTTGAGCAGACAGAACGGGGAAGACTCCACTCTGTCCCGAGGGGCCAGCCGCAGGCGTCCCCAGGGCCACC
CTGCCCTGAGGTCCTTGTGTGGCCGCCCTGGCTTGGCAGCCCTGCCCACGCTGCCCCCGCAAACAATGGTGTGTGCGTTTTTACAGCCCT
TTTTAGGAACCCAATATGGGCATAAATGTAACACCTGTAGCGGGGGCAGATTCTCTGTATGTTCAGTTAACAAATTATTTGTAATGTATT
TTTTTAGAAATCTTAAAATTGCCTTTGCACTGAAGTATTTTCATAGCTGTTTATATCTCTTTTATTCATTTATTTAACATACTGTCTAAT
TTTAAAAATAGGTTTTTAAAGCTTTCATTTTTAAGTTTATGAAATTTTGGCCACTTTACATTTAGATTCTGGTGAGAGTTTTGACTGAAT
GTTCCAATCTCTGATGAATGCGAATTTTCAGATTTGATTTTATTCTCTACACACACCTCTTCTTTTCTTGGTATTTCTGGTGGCAGTGAT
TAGTTGAACAGCACATTTAAGGCACGATAATTTGCTACACTTTTTCTTTACAATTTGTTGCAATTTCATCTGCTTTCTATGTTTCATTGT
TAATTGCCATCCTTCAGCCTTAAAAATAGAAGATTCTCACGTGAAGGTTTAGTAAGTTGGGTCCCAGCTCTGCCTGTGTGGAGATAGTCA
CCATGTACCTCTGACAACAAGTTTTAGTGTGAAAGTCACTAAACTTTTACACACTCCCAAACGTCTTTTTAAAAATTGCTTGGGAAATTA
TTAAATGAATGTGCCTGATGATTTGAAATAGACAAGGGGCACGAGATAAAAAAGAAAAGGATGAGAAGATCCTCAGTGAATGACGTTGCA
GGGTCTTCATGCAATTTTCCACCTCGCAGTAGTTAGTATTTACTTGCCTTAAACTAACTTTGAAGCAAGTAATGTCAACTTTGAGCACTT
TGTTGAGTTTTGAAAAATCTTATTTGTTGCTGCACAGGTTAATAAATTATCAATTTGTAATTCAGCATGTTGGTCAGAGACACGGTCACT
GATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGATTCACACCCAGTCCCTGCCACAGACCGTC
TCAGACACGCACAGTGGGCCTGCTGCATGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGCG
TGTTACCTGGCTTTTGGCTCCACGCTCACTCATAGCCATGTCCACATGGGGGCTTGCACACAGGATCACTCACATATGTACATGTACCCA
CCACAAACGTGCAAGCTCCTGCACACATGCATGCACACAAACGTGTACACAAGTGTGAGCTCCTACACGCATACACACACACACGTGTAC
ATGCACCAAAGCATGTGTGACCTACAGACATGCAGAACATGCACGTGTACACATACCACAGACACGCGTGTGCATGCTCCTACACAATAC
ATATGCACATATCATGAACAGCGTAAGTTCCTACACACGGACGTGTGATACACACATGCATGTACAGGTAAGCACACATGTACAAGCTCC
TACAGGCTTGCTCTCACACACGTGTATGCACAGCAGAGAGACGTATGAGCTTCTACTGCACACATGCACACACACACGCACACGTACATT
CACTACAAACGTGCAGCCTCCTGCACACGTGCACATTCATGTGTACACCACAAATGAGTTCCCAGACGTGTAAACACACGTGCACACATC
GTACACATGTGAGCTCCCACACGTACACACAGATGCACATGGACACACCCCAAACACGCACAGGCTCCTACACACATGCACACACGTGTA
CACCACAAACGAGCTCCCAGACATGTAAACACACGTCTCCCACACGTGAGCTCCCACACGTACACATGCACATGTACGCACCACAAACAC
ATGCGCAGGCTCCTGCAGGCGTGAATACACACATGCACACACATATACACACATGTGCCACAAACAAGTGCACACTGTCCTGGTGTCCTG
CACTGCATCCTGCCTCCTTGCTGAGGGGCCCCTGTGAGAGGCCTCTGGATGGGCATGGGAAGATGGGCTCCCTGGCCCCCAGCCCATGCC
TCCCTGGGATGAAGAGTCCCCCTCCTGGCAGAATGTCTGGGCTTTGCAGAGCAGGCCCCGGGGGTGAAGTCGCAGCTTCACTTACACCAG
CTGCTCTGTGAGCAAGGCTTGGTGCCCTGGACAAGGCCCTTCCCCTTTAGGGAGGTCCAGCCTCGCAAGCTGAAACCTCCCCTCGGCTCA
GCCCTATACCAGGCGGCCACAGCAGGACTGGCCACACCCACGCCGCACCTCATCCGTGCACGCGTCGGAGCACGGCCAGCCTTCCGCCAC
GAGCCAGCTGGGAAGGGCCGCGGCCGCCTAAAGCCCCAGTCAACCCAGCCTGTGTCTGAGCAGACAGGGCGAACAAGCAGGCCACACCGT
CTCGAGGGAGGAGGCCAGATGCGGCCAGCGTCTCCAACAGGGTGACCATCCGCTCGGCTTGCTGAGCGTTTAAACAAATGTTTAGACAGG
CTGTGGGGACTCCCCTGAGTTGAGCCTTGGCCAGGGGTCCGGTGCTGTCGCGGGAAACCTCCAGCCTTGTTCTTCAAACCACTCAGCTCA
TGTGTTTTGCACTGACTAGTACTGAATAATACAACCACTCTTATTTAATGTTAGTATTATTTATTTGACAACTCAGTGTCTAACAGCTTG
ATATGCAGGTCCTTGCATCCTACATTTCTTTAGGAAGTTACCCATTTGTAACTTTAAAAACAGGAAAAATATCAGTTGGCAAATGCAATC
TTTTTTTTTTTTAAGCTAAAGGTGGGTGAACTGGAATGAAAATCTTTCTGATGTTGTGTCTATAAGCAGCCTTGATGGGATATGTTAGAA
GTGTCATGAAAGTGTGATTCTACTTTTGCAGAAAAATCTAAAGATCAATTTATATAGCTTTATTTTTTACTTTATCAAAGTATACAGAAT
TTTAATATGCATATATTGTGTCTGACTTAAAATTATAATGTCTGCGTCACCATTTAAAATGTCTGTTCATTATGTAATGTAATAAAAGAA
GGTCTTCAAAAATGTATTTAACATGAATGGTATCCATAGTTGTCATCATCATAAATACTGGAGTTTATTTTTAAATTATTAAACATAGTA
GGTGCATTAACATAAATCAGTCTCCACACAGTAACATTTAACTGATAATTCATTAATCAGCTTTGAAAAATTAAATTGTTAATTAAACCA
ATCTAACATTTCAGTAAAGTTTATTTTGTATGCTTCTGTTTTTAACTTTTATTTCTGTAGATAAACTGACTGGATAATATTATATTGGAC
TTTTCTCTAGATTATCTAAGCAGGAGACCTGAATCTGCTTGCAATAAAGAATAAAAGTCTGCTTCAGTTTCTTTATAAAGAAACTCACAC


Top

FusionGenePPI for ARHGEF7_ATP11A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARHGEF7SHANK2, SHANK1, CBL, SHANK3, TUBB3, GIT1, PPM1E, PPM1F, PAK1, PAK3, CDC42, CBLB, CALM1, ITCH, LRRK2, PAK2, ADAM15, ARHGEF6, GRB2, ERBB2IP, MEOX2, EGFR, RAC1, NCK2, HSPB1, KDM2A, NTRK1, MED4, SLC33A1, SCRIB, GIT2, FBXO28, LPXN, NCKIPSD, ICAM1, EXOC1, KLHL2, CAMK4, SYNC, C1orf106, POTEB3ATP11ATMEM30A, NPDC1, PICK1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARHGEF7_ATP11A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARHGEF7_ATP11A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneATP11AC1800706Idiopathic Pulmonary Fibrosis1CTD_human;ORPHANET