FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25529

FusionGeneSummary for OSBPL1A_MYO16

check button Fusion gene summary
Fusion gene informationFusion gene name: OSBPL1A_MYO16
Fusion gene ID: 25529
HgeneTgene
Gene symbol

OSBPL1A

MYO16

Gene ID

114876

23026

Gene nameoxysterol binding protein like 1Amyosin XVI
SynonymsORP-1|ORP1|OSBPL1BMYAP3|MYR8|Myo16b|NYAP3|PPP1R107
Cytomap

18q11.2

13q33.3

Type of geneprotein-codingprotein-coding
Descriptionoxysterol-binding protein-related protein 1OSBP-related protein 1oxysterol binding protein-like 1Boxysterol-binding protein-related protein 1 variant 1oxysterol-binding protein-related protein 1 variant 2unconventional myosin-XVIMYO16 variant proteinmyosin heavy chain Myr 8neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 3protein phosphatase 1, regulatory subunit 10
Modification date2018052320180519
UniProtAcc

Q9BXW6

Q9Y6X6

Ensembl transtripts involved in fusion geneENST00000319481, ENST00000399443, 
ENST00000357041, ENST00000399441, 
ENST00000582618, 
ENST00000356711, 
ENST00000251041, ENST00000357550, 
ENST00000457511, ENST00000467639, 
Fusion gene scores* DoF score8 X 6 X 6=28810 X 8 X 9=720
# samples 710
** MAII scorelog2(7/288*10)=-2.04064198449735
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/720*10)=-2.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: OSBPL1A [Title/Abstract] AND MYO16 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-T3-A92M-01AOSBPL1Achr18

21819184

-MYO16chr13

109772718

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000319481ENST00000356711OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5CDS-intronENST00000319481ENST00000251041OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5CDS-intronENST00000319481ENST00000357550OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5CDS-intronENST00000319481ENST00000457511OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5CDS-intronENST00000319481ENST00000467639OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5UTR-3CDSENST00000399443ENST00000356711OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5UTR-intronENST00000399443ENST00000251041OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5UTR-intronENST00000399443ENST00000357550OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5UTR-intronENST00000399443ENST00000457511OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5UTR-intronENST00000399443ENST00000467639OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
In-frameENST00000357041ENST00000356711OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5CDS-intronENST00000357041ENST00000251041OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5CDS-intronENST00000357041ENST00000357550OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5CDS-intronENST00000357041ENST00000457511OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
5CDS-intronENST00000357041ENST00000467639OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-3CDSENST00000399441ENST00000356711OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-intronENST00000399441ENST00000251041OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-intronENST00000399441ENST00000357550OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-intronENST00000399441ENST00000457511OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-intronENST00000399441ENST00000467639OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-3CDSENST00000582618ENST00000356711OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-intronENST00000582618ENST00000251041OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-intronENST00000582618ENST00000357550OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-intronENST00000582618ENST00000457511OSBPL1Achr18

21819184

-MYO16chr13

109772718

+
intron-intronENST00000582618ENST00000467639OSBPL1Achr18

21819184

-MYO16chr13

109772718

+

Top

FusionProtFeatures for OSBPL1A_MYO16


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
OSBPL1A

Q9BXW6

MYO16

Q9Y6X6

Binds phospholipids; exhibits strong binding tophosphatidic acid and weak binding to phosphatidylinositol 3-phosphate (By similarity). Stabilizes GTP-bound RAB7A on lateendosomes/lysosomes and alters functional properties of lateendocytic compartments via its interaction with RAB7A(PubMed:16176980). Binds 25-hydroxycholesterol and cholesterol(PubMed:17428193). {ECO:0000250, ECO:0000269|PubMed:16176980,ECO:0000269|PubMed:17428193}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000319481-1628430_463481951Coiled coilOntology_term=ECO:0000255
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000319481-1628235_334481951DomainPH
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000319481-1628175_204481951RepeatNote=ANK 3
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000319481-162847_76481951RepeatNote=ANK 1
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000319481-162880_109481951RepeatNote=ANK 2
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000357041-41647_7699569RepeatNote=ANK 1
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+0241389_1671-14941Compositional biasPro-rich
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+27351389_167111241859Compositional biasPro-rich
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+26341389_167111241859Compositional biasPro-rich
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+0241147_1176-14941DomainIQ
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+024401_1145-14941DomainMyosin motor
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+27351147_117611241859DomainIQ
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+26341147_117611241859DomainIQ
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+024497_504-14941Nucleotide bindingATP
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+0241111_1377-14941RegionInvolved in CYFIP1- and NCKAP1-binding
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+024125_154-14941RepeatANK 3
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+024158_189-14941RepeatANK 4
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+024191_217-14941RepeatANK 5
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+024221_250-14941RepeatANK 6
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+024254_283-14941RepeatANK 7
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+02459_88-14941RepeatANK 1
TgeneMYO16chr18:21819184chr13:109772718ENST00000251041+02492_121-14941RepeatANK 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000319481-1628877_913481951Coiled coilOntology_term=ECO:0000255
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000357041-416430_46399569Coiled coilOntology_term=ECO:0000255
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000357041-416877_91399569Coiled coilOntology_term=ECO:0000255
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000399443-214430_463-32438Coiled coilOntology_term=ECO:0000255
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000399443-214877_913-32438Coiled coilOntology_term=ECO:0000255
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000357041-416235_33499569DomainPH
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000399443-214235_334-32438DomainPH
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000357041-416175_20499569RepeatNote=ANK 3
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000357041-41680_10999569RepeatNote=ANK 2
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000399443-214175_204-32438RepeatNote=ANK 3
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000399443-21447_76-32438RepeatNote=ANK 1
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000399443-21480_109-32438RepeatNote=ANK 2
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+2735401_114511241859DomainMyosin motor
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+2634401_114511241859DomainMyosin motor
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+2735497_50411241859Nucleotide bindingATP
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+2634497_50411241859Nucleotide bindingATP
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+27351111_137711241859RegionInvolved in CYFIP1- and NCKAP1-binding
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+26341111_137711241859RegionInvolved in CYFIP1- and NCKAP1-binding
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+2735125_15411241859RepeatANK 3
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+2735158_18911241859RepeatANK 4
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+2735191_21711241859RepeatANK 5
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+2735221_25011241859RepeatANK 6
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+2735254_28311241859RepeatANK 7
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+273559_8811241859RepeatANK 1
TgeneMYO16chr18:21819184chr13:109772718ENST00000356711+273592_12111241859RepeatANK 2
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+2634125_15411241859RepeatANK 3
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+2634158_18911241859RepeatANK 4
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+2634191_21711241859RepeatANK 5
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+2634221_25011241859RepeatANK 6
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+2634254_28311241859RepeatANK 7
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+263459_8811241859RepeatANK 1
TgeneMYO16chr18:21819184chr13:109772718ENST00000357550+263492_12111241859RepeatANK 2


Top

FusionGeneSequence for OSBPL1A_MYO16


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_OSBPL1A_ENST00000319481_chr18_21819184_-_MYO16_ENST00000356711_chr13_109772718_+_1216aa
MNTEAEQQLLHHARNGNAEEVRQLLETMARNEVIADINCKGRSKSNLGWTPLHLACTFGHRQVVQDLLKAGAEVNVLNDMGDTPLHRAAF
TGRKELVMLLLETNADTTIVNGSGQTAKEVTHAEEIRSMLEAVERTQQRKLEELLLAAAREGKTTELTALLNRPNPPDVNCSDQLGNTPL
HCAAYRAHKQCALKLLRSGADPNLKNKNDQKPLDLAQGAEMKHILVGNKVIYKALKRTEGPLWKSSRFFGWRLFWVVLEHGVLSWTRKQP
DAVHNITRQGCKHLTQAVCTVKSTDSCLFFIKCFDDTIHGFRVPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLK
KSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEASRETCVALTDCLNLFTKQEGVRNFKLEQEQEKNKILSEALETL
ATEHHELEQSLVKGSPPASILSEDEFTDALSDGSPKSVSKILAC_PTQ_FVPTVAEKNTNLPKSTQRIFSTPAPASENKHQTTRGDFTQ_
LSAEHRGHGAENLRCPGHSECFRHCPGK_PAP__NERSLP_REVRGQEHARGRKQKNR_QEWTQAFPPQLHVSLRGRGWPGPVPRWPVHL
VSFAALGVQHG_QQQPPVSTETAPAQAKEGPQHPAECFL_GCERLPLRGQGSGQRSSGPAQTAQRRLQHHEEDSSSKAQAQPQHQAQRLL
RGDIGVPARGREARGRPGGSSARSDPRDSAVRAAPGGASG_RGRQRACVHRDAGARGQAR_PGPRGVRVRGDEVLPARRRRPGRGLLPAP
RRIAAPAPPRAGGRGGGAPRGRVRHPAALPQPAAAPAAPAGVPPDPRHLLPRLRRVAPDTPGGEEAASPGDQPQVPRAAGGVEPAVPAVL
QEPEGRRRQARVPRPGAVQRVRPSLPAVHAAPAPAPARAAPRALQALRALGLPAGARPGERGESGAERRGAQGSPKAKLCPRGRALQLLP
QDPIFPREGHQGGRQEGRLQCLAPRALQPSQLQASQQPPGRARQPLQLGEECASEIRGGKKNQGSRRF_N_HEHK_PR_P_YVRNYFRDS
RQKCK_PWNSVI_FTI_CTNC_KWKFHLKWFT_RRWILTVVTKWHRDFDISKTQGQSHHSGNPSAEALRE_KCGPAGTLGLEEKAL_GRT

>In-frame_OSBPL1A_ENST00000357041_chr18_21819184_-_MYO16_ENST00000356711_chr13_109772718_+_834aa
MIKECDMAKEMLPSFLQKVEVVSEASRETCVALTDCLNLFTKQEGVRNFKLEQEQEKNKILSEALETLATEHHELEQSLVKGSPPASILS
EDEFTDALSDGSPKSVSKILAC_PTQ_FVPTVAEKNTNLPKSTQRIFSTPAPASENKHQTTRGDFTQ_LSAEHRGHGAENLRCPGHSECF
RHCPGK_PAP__NERSLP_REVRGQEHARGRKQKNR_QEWTQAFPPQLHVSLRGRGWPGPVPRWPVHLVSFAALGVQHG_QQQPPVSTET
APAQAKEGPQHPAECFL_GCERLPLRGQGSGQRSSGPAQTAQRRLQHHEEDSSSKAQAQPQHQAQRLLRGDIGVPARGREARGRPGGSSA
RSDPRDSAVRAAPGGASG_RGRQRACVHRDAGARGQAR_PGPRGVRVRGDEVLPARRRRPGRGLLPAPRRIAAPAPPRAGGRGGGAPRGR
VRHPAALPQPAAAPAAPAGVPPDPRHLLPRLRRVAPDTPGGEEAASPGDQPQVPRAAGGVEPAVPAVLQEPEGRRRQARVPRPGAVQRVR
PSLPAVHAAPAPAPARAAPRALQALRALGLPAGARPGERGESGAERRGAQGSPKAKLCPRGRALQLLPQDPIFPREGHQGGRQEGRLQCL
APRALQPSQLQASQQPPGRARQPLQLGEECASEIRGGKKNQGSRRF_N_HEHK_PR_P_YVRNYFRDSRQKCK_PWNSVI_FTI_CTNC_
KWKFHLKWFT_RRWILTVVTKWHRDFDISKTQGQSHHSGNPSAEALRE_KCGPAGTLGLEEKAL_GRTRLAADPAPR_AQGASPTTLQEA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_OSBPL1A_ENST00000319481_chr18_21819184_-_MYO16_ENST00000356711_chr13_109772718_+_3649nt
ATGAACACAGAAGCGGAGCAACAGCTTCTCCATCACGCCAGAAATGGCAATGCTGAAGAAGTAAGACAACTATTAGAGACCATGGCGAGG
AATGAAGTGATTGCTGACATTAATTGCAAAGGAAGAAGTAAGTCTAACTTGGGCTGGACACCTCTACATCTGGCATGCTATTTTGGACAC
AGACAAGTGGTCCAGGATCTGTTGAAGGCTGGTGCAGAAGTGAATGTGTTGAATGACATGGGAGACACGCCGCTTCATCGAGCTGCCTTT
ACAGGACGAAAGGAGTTGGTAATGCTTCTCTTAGAATATAATGCTGATACTACTATTGTTAATGGGAGTGGACAGACAGCAAAAGAAGTT
ACTCATGCTGAAGAAATCAGAAGCATGCTTGAAGCTGTAGAAAGGACTCAACAAAGAAAGCTTGAAGAATTACTTTTAGCAGCAGCAAGA
GAAGGCAAAACAACAGAACTCACAGCTCTGCTCAACAGGCCCAATCCTCCTGATGTTAACTGTTCGGATCAGTTAGGAAATACACCCTTG
CATTGTGCAGCTTACCGGGCCCATAAACAATGTGCCTTAAAGCTTCTAAGAAGTGGAGCAGACCCTAATCTGAAGAACAAAAATGATCAG
AAACCTCTTGACCTTGCCCAGGGTGCTGAAATGAAACACATTCTTGTTGGTAATAAGGTCATCTACAAAGCATTGAAACGATATGAGGGC
CCTCTCTGGAAGAGTTCAAGATTTTTTGGCTGGAGATTATTCTGGGTAGTGTTAGAGCATGGAGTCCTTTCATGGTATAGGAAACAGCCT
GATGCAGTTCATAATATTTATCGCCAGGGATGCAAACACCTGACTCAAGCAGTATGCACGGTAAAATCCACTGATAGCTGCCTCTTCTTT
ATTAAATGCTTTGATGACACCATTCATGGCTTCCGGGTTCCTAAGAATAGCCTTCAGCAGTCAAGAGAGGACTGGCTGGAAGCAATAGAA
GAACATTCTGCTTACAGCACTCACTACTGTTCCCAGGACCAGCTGACTGATGAGGAGGAGGAAGATACGGTTTCTGCTGCAGACCTGAAG
AAATCATTAGAGAAAGCACAGTCATGCCAACAGCGACTAGATAGGGAAATTTCCAACTTTCTCAAAATGATTAAGGAGTGTGACATGGCT
AAAGAAATGCTTCCATCATTTCTTCAGAAAGTTGAAGTTGTCTCAGAAGCTTCTAGAGAAACTTGTGTAGCTTTGACTGATTGCCTTAAT
CTCTTCACCAAACAAGAAGGGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTG
GCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTG
TCAGATGGGAGTCCGAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAAC
CTGCCAAAAAGTTATCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAG
CTTTCTGCAGAACACAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCG
GCTCCGTAGTGAAATGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAA
GAGTGGACCCAGGCATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTG
GTCTCCTTCGCTGCACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGA
CCCCAACACCCGGCTGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCC
CAGACCGCACAGCGACGACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTA
CGAGGAGATATCGGGGTCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCA
GTGCGCGCTGCCCCCGGCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGA
TAGCCCGGACCCCGGGGAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCA
CGGCGCATCGCCGCCCCTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCC
CAACCTGCTGCCGCACCGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACC
CCTGGAGGTGAAGAAGCTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTC
CAAGAGCCAGAAGGGCGACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCC
GCCCCCGCCCCCGCCCCCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAA
CGCGGGGAAAGCGGGGCCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCC
CAAGATCCCATATTCCCCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCC
CAGCTCCAGGCCTCTCAGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAG
AAAAATCAGGGAAGCAGAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCA
AGACAGAAATGCAAATAACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGG
TTTACCTGAAGAAGATGGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCA
GGTAATCCATCAGCTGAGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACA
AGACTGGCAGCAGATCCTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGG

>In-frame_OSBPL1A_ENST00000357041_chr18_21819184_-_MYO16_ENST00000356711_chr13_109772718_+_2503nt
ATGATTAAGGAGTGTGACATGGCTAAAGAAATGCTTCCATCATTTCTTCAGAAAGTTGAAGTTGTCTCAGAAGCTTCTAGAGAAACTTGT
GTAGCTTTGACTGATTGCCTTAATCTCTTCACCAAACAAGAAGGGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATC
TTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGC
GAGGACGAGTTCTATGATGCGCTGTCAGATGGGAGTCCGAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCT
ACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTTATCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACA
ACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAACACAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTC
AGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAAATGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGA
AGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGGCATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCA
GTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTGCACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACA
GCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGGCTGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGC
GGCCAACGAAGCTCTGGCCCGGCCCAGACCGCACAGCGACGACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCC
CAACACCAAGCTCAGCGGCTCCTACGAGGAGATATCGGGGTCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCG
CGTTCTGACCCCCGGGACTCCGCAGTGCGCGCTGCCCCCGGCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGAT
GCTGGGGCACGCGGCCAGGCCCGATAGCCCGGACCCCGGGGAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCC
GGGCGCGGGCTCCTTCCTGCTCCACGGCGCATCGCCGCCCCTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGC
GTGCGACATCCCGCCGCCCTTCCCCAACCTGCTGCCGCACCGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGC
CTCCGACGAGTCGCCCCTGACACCCCTGGAGGTGAAGAAGCTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTC
GAGCCCGCTGTCCCCGCAGTACTCCAAGAGCCAGAAGGGCGACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGG
CCGAGCCTCCCCGCCGTCCACGCCGCCCCCGCCCCCGCCCCCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTT
CCCGCCGGAGCCCGCCCCGGTGAACGCGGGGAAAGCGGGGCCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGT
GGCCGGGCCCTGCAGCTCCTTCCCCAAGATCCCATATTCCCCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTC
GCCCCCCGCGCCCTACAGCCCTCCCAGCTCCAGGCCTCTCAGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGT
GCTTCGGAAATCCGCGGCGGGAAGAAAAATCAGGGAAGCAGAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTAC
GTCAGAAATTACTTCCGAGACTCAAGACAGAAATGCAAATAACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGA
AAATGGAAATTCCATCTCAAATGGTTTACCTGAAGAAGATGGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAG
ACACAGGGACAGTCACACCACTCAGGTAATCCATCAGCTGAGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAG
GAGAAAGCTCTGTGAGGAAGGACAAGACTGGCAGCAGATCCTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_OSBPL1A_ENST00000319481_chr18_21819184_-_MYO16_ENST00000356711_chr13_109772718_+_5027nt
CTGCGGGGAGGGGCGGCGCCACCTCGCGCTCCGCCGTGGTCCCGGCGCCGGGTCCCGGAGACAGACGTTACGCGGGCTCGAGCGTCCTCG
GGGAGTGCCAGCCAGAGTTGGTGACGACCACTTCCTCGACGTGGGGCGGGCGGACGGGAAGCCTGGGGTCGTGGCCACCGCCTCGGGAGC
TCTGGGAGCCCGGGTGACCGCGTAGAAATGAACACAGAAGCGGAGCAACAGCTTCTCCATCACGCCAGAAATGGCAATGCTGAAGAAGTA
AGACAACTATTAGAGACCATGGCGAGGAATGAAGTGATTGCTGACATTAATTGCAAAGGAAGAAGTAAGTCTAACTTGGGCTGGACACCT
CTACATCTGGCATGCTATTTTGGACACAGACAAGTGGTCCAGGATCTGTTGAAGGCTGGTGCAGAAGTGAATGTGTTGAATGACATGGGA
GACACGCCGCTTCATCGAGCTGCCTTTACAGGACGAAAGGAGTTGGTAATGCTTCTCTTAGAATATAATGCTGATACTACTATTGTTAAT
GGGAGTGGACAGACAGCAAAAGAAGTTACTCATGCTGAAGAAATCAGAAGCATGCTTGAAGCTGTAGAAAGGACTCAACAAAGAAAGCTT
GAAGAATTACTTTTAGCAGCAGCAAGAGAAGGCAAAACAACAGAACTCACAGCTCTGCTCAACAGGCCCAATCCTCCTGATGTTAACTGT
TCGGATCAGTTAGGAAATACACCCTTGCATTGTGCAGCTTACCGGGCCCATAAACAATGTGCCTTAAAGCTTCTAAGAAGTGGAGCAGAC
CCTAATCTGAAGAACAAAAATGATCAGAAACCTCTTGACCTTGCCCAGGGTGCTGAAATGAAACACATTCTTGTTGGTAATAAGGTCATC
TACAAAGCATTGAAACGATATGAGGGCCCTCTCTGGAAGAGTTCAAGATTTTTTGGCTGGAGATTATTCTGGGTAGTGTTAGAGCATGGA
GTCCTTTCATGGTATAGGAAACAGCCTGATGCAGTTCATAATATTTATCGCCAGGGATGCAAACACCTGACTCAAGCAGTATGCACGGTA
AAATCCACTGATAGCTGCCTCTTCTTTATTAAATGCTTTGATGACACCATTCATGGCTTCCGGGTTCCTAAGAATAGCCTTCAGCAGTCA
AGAGAGGACTGGCTGGAAGCAATAGAAGAACATTCTGCTTACAGCACTCACTACTGTTCCCAGGACCAGCTGACTGATGAGGAGGAGGAA
GATACGGTTTCTGCTGCAGACCTGAAGAAATCATTAGAGAAAGCACAGTCATGCCAACAGCGACTAGATAGGGAAATTTCCAACTTTCTC
AAAATGATTAAGGAGTGTGACATGGCTAAAGAAATGCTTCCATCATTTCTTCAGAAAGTTGAAGTTGTCTCAGAAGCTTCTAGAGAAACT
TGTGTAGCTTTGACTGATTGCCTTAATCTCTTCACCAAACAAGAAGGGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAA
ATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTT
AGCGAGGACGAGTTCTATGATGCGCTGTCAGATGGGAGTCCGAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTG
CCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTTATCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAG
ACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAACACAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGC
TTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAAATGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGA
GGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGGCATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGG
CCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTGCACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAA
ACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGGCTGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGA
AGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCGCACAGCGACGACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAG
CCCCAACACCAAGCTCAGCGGCTCCTACGAGGAGATATCGGGGTCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGC
GCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCGCTGCCCCCGGCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGA
GATGCTGGGGCACGCGGCCAGGCCCGATAGCCCGGACCCCGGGGAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGG
CCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCATCGCCGCCCCTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGA
CGCGTGCGACATCCCGCCGCCCTTCCCCAACCTGCTGCCGCACCGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCC
CGCCTCCGACGAGTCGCCCCTGACACCCCTGGAGGTGAAGAAGCTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGG
GTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGCCAGAAGGGCGACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTC
CGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCGCCCCCGCCCCCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGC
CTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGGAAAGCGGGGCCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCC
CGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATCCCATATTCCCCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGC
CTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCCAGGCCTCTCAGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAG
TGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATCAGGGAAGCAGAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAG
TACGTCAGAAATTACTTCCGAGACTCAAGACAGAAATGCAAATAACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGC
TGAAAATGGAAATTCCATCTCAAATGGTTTACCTGAAGAAGATGGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCA
AAGACACAGGGACAGTCACACCACTCAGGTAATCCATCAGCTGAGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTG
GAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGGCAGCAGATCCTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAA
GCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCCTGCAACAGGCTGCCGTCTGAGCTCTGGGACACCACCATTTGATGTGGCCTGAACTG
CAGACTTACAAAATAGAACTGCCTACTGATTCCGGGCTGCAACAACAGAAGGCTGCCTTCTGACATGCGCTGGGGCTTCTCTCCACGCAT
TTAGACAAAAAAAGCACAGGACACAGACACTAAATATATGAGATCCCGTGTGTGTGTGTGTGTGTTTGTGTGTGTGTGTGTGGGTTCTTT
CTTATCCATCTCGTGGTGATACACTCTGATTTTCAAGCTCCTCATTTACGGCTCTGTGCTACCCCTAGGTAGCAAGAGAGAGGCTGGGAA
AAGTGTGGACGTGGCCAGAGCGAGAGAGTAGCGGAGGAAAGGAGCAATCCATGCACACTCTGTACAGTTGTTTTTCTACGGTTCAACAGT
CTGTTTATTGTACTTCCAATGGTTTTATTATAATACAGTATACGGGACATATATTTTATTTCTTTGTAGCTACTTGTGTTTTATTGGTAT
TATAAACCTGATAATTATTTACATGTTTATTACTGTAATTTTATAAATTTATGCAATTGGTGGTGCTTCCTTTCTTCAAAATACAGATTT
TAAAAAATCATTTCTAGATTATTTTTTTCCTCCACAGTCCTTTTTTTTCACCTAACGCACCTAAATCTTGAAACTACATTGTTGTTTTAG
CTTCGCCAGTGTCACCCCTTGCAAAACTATGAATTGAGCCCCATGTTTTAGGTGTTACTCATGGATGAGGAGGCTGTTCTTTCCTATGCC
CTGTATTTCTGGATAAGTGGATTGTGTACCCTTTAGTTAAATTTCACCTCCCGACTTCAGCATAGATCACAGGAAATCACATGGCACACG
GTTAAACACGTATGGCTTCAAATCCATAGCCGGTGGTGTAAAATGATCATATTCATTCAAAGGCCTACACAGTACAAATGAGCACGCTGC
CATGTACTGGTTTGAGCAGTAGGGGCTGCATCGCACAGCGCTCGTCCCCCGGGACTTACACTGCATGATTCCCTCACTGTATATCCTCAA
CCCTCCCATAATGCAAGGCCTTGTTCATTGATGTGCTTTCGTCGGCTGTCGGAAAGTTCTGAGCAGTGGCTCCAGACCACCTTGTCTTGC

>In-frame_OSBPL1A_ENST00000357041_chr18_21819184_-_MYO16_ENST00000356711_chr13_109772718_+_3791nt
AATGAATGGAGAAGTCTTCTGAAGTGACACCAGTGCCTTATCCCTAGAGGAATATCAGCATAGAAAGCACAGTCATGCCAACAGCGACTA
GATAGGGAAATTTCCAACTTTCTCAAAATGATTAAGGAGTGTGACATGGCTAAAGAAATGCTTCCATCATTTCTTCAGAAAGTTGAAGTT
GTCTCAGAAGCTTCTAGAGAAACTTGTGTAGCTTTGACTGATTGCCTTAATCTCTTCACCAAACAAGAAGGGGTGAGGAATTTTAAATTG
GAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAA
GGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATGGGAGTCCGAAAAGTGTTTCTAAAATACTGGCA
TGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTTATCAGAGGATTTTTAGCACGCCAGCA
CCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAACACAGAGGACATGGGGCTGAAAACCTA
CGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAAATGAACGCTCCCTACCATAAAGAGAA
GTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGGCATTTCCACCCCAGCTCCATGTCAGT
CTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTGCACTCGGTGTTCAGCATGGATGACAG
CAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGGCTGAGTGCTTCCTATGAGGCTGTGAG
CGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCGCACAGCGACGACTACAGCACCATGAAGAAGAT
TCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTACGAGGAGATATCGGGGTCCCGGCCCGGGGACGCGAGGCC
CGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCGCTGCCCCCGGCGGCGCCTCCGGGTGACGAGGA
CGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGATAGCCCGGACCCCGGGGAGTCCGTGTACGAGGAGATGAA
GTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCATCGCCGCCCCTGCTCCACCGCGCGCCGGAGGA
CGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCCCAACCTGCTGCCGCACCGGCCGCCCCTGCTGGTGTTCCC
CCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACCCCTGGAGGTGAAGAAGCTGCCAGTCCTGGAGACCAACCT
CAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGCCAGAAGGGCGACGGCGACAGGCCCGCGTCCCC
CGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCGCCCCCGCCCCCGCCCGGGCCGCCCCCCGCGCC
CTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGGAAAGCGGGGCCGAGCGCAGAGGCGCCCAAGGT
TCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATCCCATATTCCCCCGTGAAGGCCACCAGGGCGGA
CGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCCAGGCCTCTCAGCAGCCCCCTGGACGAGCTCGC
CAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATCAGGGAAGCAGAAGGTTTTGAAACTAACATGAA
CATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCAAGACAGAAATGCAAATAACCATGGAATTCAGTTATCTAA
TTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGGTTTACCTGAAGAAGATGGATACTCACGGTTGTCTATAAG
TGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCAGGTAATCCATCAGCTGAGGCTCTCAGAGAATGAAAGTGT
GGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGGCAGCAGATCCTGCACCACGCTGAGCCCAGGGT
GCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCCTGCAACAGGCTGCCGTCTGAGCTCTGGGACAC
CACCATTTGATGTGGCCTGAACTGCAGACTTACAAAATAGAACTGCCTACTGATTCCGGGCTGCAACAACAGAAGGCTGCCTTCTGACAT
GCGCTGGGGCTTCTCTCCACGCATTTAGACAAAAAAAGCACAGGACACAGACACTAAATATATGAGATCCCGTGTGTGTGTGTGTGTGTT
TGTGTGTGTGTGTGTGGGTTCTTTCTTATCCATCTCGTGGTGATACACTCTGATTTTCAAGCTCCTCATTTACGGCTCTGTGCTACCCCT
AGGTAGCAAGAGAGAGGCTGGGAAAAGTGTGGACGTGGCCAGAGCGAGAGAGTAGCGGAGGAAAGGAGCAATCCATGCACACTCTGTACA
GTTGTTTTTCTACGGTTCAACAGTCTGTTTATTGTACTTCCAATGGTTTTATTATAATACAGTATACGGGACATATATTTTATTTCTTTG
TAGCTACTTGTGTTTTATTGGTATTATAAACCTGATAATTATTTACATGTTTATTACTGTAATTTTATAAATTTATGCAATTGGTGGTGC
TTCCTTTCTTCAAAATACAGATTTTAAAAAATCATTTCTAGATTATTTTTTTCCTCCACAGTCCTTTTTTTTCACCTAACGCACCTAAAT
CTTGAAACTACATTGTTGTTTTAGCTTCGCCAGTGTCACCCCTTGCAAAACTATGAATTGAGCCCCATGTTTTAGGTGTTACTCATGGAT
GAGGAGGCTGTTCTTTCCTATGCCCTGTATTTCTGGATAAGTGGATTGTGTACCCTTTAGTTAAATTTCACCTCCCGACTTCAGCATAGA
TCACAGGAAATCACATGGCACACGGTTAAACACGTATGGCTTCAAATCCATAGCCGGTGGTGTAAAATGATCATATTCATTCAAAGGCCT
ACACAGTACAAATGAGCACGCTGCCATGTACTGGTTTGAGCAGTAGGGGCTGCATCGCACAGCGCTCGTCCCCCGGGACTTACACTGCAT
GATTCCCTCACTGTATATCCTCAACCCTCCCATAATGCAAGGCCTTGTTCATTGATGTGCTTTCGTCGGCTGTCGGAAAGTTCTGAGCAG
TGGCTCCAGACCACCTTGTCTTGCTACTTGGAACTTTTTATTCATACCAGCCTTTGAAAAGTTACTGTGCCAATAAAGAGGTACAACTGT


Top

FusionGenePPI for OSBPL1A_MYO16


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
OSBPL1ABCL6, NPM1, BIN3, HEXIM1, C9orf41, VAPB, POLG2, KIFAP3, TSC22D2, VAPA, HIF1AN, DMD, CTNNA3, ZNF331, BSPRY, PRPF31, TRIM25, BAALCMYO16NRXN1, NCKAP1, CYFIP2, CYFIP1, PIK3R1, ARHGAP26, ACOT9


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000319481-16281_237481951RAB7A


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000357041-4161_23799569RAB7A
HgeneOSBPL1Achr18:21819184chr13:109772718ENST00000399443-2141_237-32438RAB7A


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for OSBPL1A_MYO16


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for OSBPL1A_MYO16


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMYO16C0036341Schizophrenia1PSYGENET