FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25361

FusionGeneSummary for OCLN_CCNB1

check button Fusion gene summary
Fusion gene informationFusion gene name: OCLN_CCNB1
Fusion gene ID: 25361
HgeneTgene
Gene symbol

OCLN

CCNB1

Gene ID

100506658

891

Gene nameoccludincyclin B1
SynonymsBLCPMG|PPP1R115|PTORCH1CCNB
Cytomap

5q13.2

5q13.2

Type of geneprotein-codingprotein-coding
Descriptionoccludinphosphatase 1, regulatory subunit 115tight junction protein occludinG2/mitotic-specific cyclin-B1
Modification date2018051920180523
UniProtAcc

Q16625

P14635

Ensembl transtripts involved in fusion geneENST00000355237, ENST00000396442, 
ENST00000380766, ENST00000538151, 
ENST00000542132, ENST00000514370, 
ENST00000256442, 
Fusion gene scores* DoF score6 X 4 X 5=1203 X 3 X 3=27
# samples 63
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: OCLN [Title/Abstract] AND CCNB1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCCNB1

GO:0010971

positive regulation of G2/M transition of mitotic cell cycle

24746669

TgeneCCNB1

GO:1905448

positive regulation of mitochondrial ATP synthesis coupled electron transport

24746669


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-2F-A9KP-01AOCLNchr5

68809936

+CCNB1chr5

68467097

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000355237ENST00000256442OCLNchr5

68809936

+CCNB1chr5

68467097

+
In-frameENST00000396442ENST00000256442OCLNchr5

68809936

+CCNB1chr5

68467097

+
intron-3CDSENST00000380766ENST00000256442OCLNchr5

68809936

+CCNB1chr5

68467097

+
In-frameENST00000538151ENST00000256442OCLNchr5

68809936

+CCNB1chr5

68467097

+
intron-3CDSENST00000542132ENST00000256442OCLNchr5

68809936

+CCNB1chr5

68467097

+
intron-3CDSENST00000514370ENST00000256442OCLNchr5

68809936

+CCNB1chr5

68467097

+

Top

FusionProtFeatures for OCLN_CCNB1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
OCLN

Q16625

CCNB1

P14635

Essential for the control of the cell cycle at the G2/M(mitosis) transition. {ECO:0000269|PubMed:17495531,ECO:0000269|PubMed:17495533}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+4992_131297523Compositional biasNote=Gly/Tyr-rich
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+4992_131297523Compositional biasNote=Gly/Tyr-rich
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+4960_269297523DomainMARVEL
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+4960_269297523DomainMARVEL
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+49161_170297523Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+49196_243297523Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+491_66297523Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+4990_135297523Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+49161_170297523Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+49196_243297523Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+491_66297523Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+4990_135297523Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+49136_160297523TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+49171_195297523TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+49244_265297523TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+4967_89297523TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+49136_160297523TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+49171_195297523TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+49244_265297523TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+4967_89297523TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+49426_489297523Coiled coilOntology_term=ECO:0000255
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+18426_489-60469Coiled coilOntology_term=ECO:0000255
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+49426_489297523Coiled coilOntology_term=ECO:0000255
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+27426_48946272Coiled coilOntology_term=ECO:0000255
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+16426_489-57201Coiled coilOntology_term=ECO:0000255
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+1892_131-60469Compositional biasNote=Gly/Tyr-rich
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+2792_13146272Compositional biasNote=Gly/Tyr-rich
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+1692_131-57201Compositional biasNote=Gly/Tyr-rich
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+1860_269-60469DomainMARVEL
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+2760_26946272DomainMARVEL
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+1660_269-57201DomainMARVEL
HgeneOCLNchr5:68809936chr5:68467097ENST00000355237+49266_522297523Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+18161_170-60469Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+18196_243-60469Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+181_66-60469Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+18266_522-60469Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+1890_135-60469Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000396442+49266_522297523Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+27161_17046272Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+27196_24346272Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+271_6646272Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+27266_52246272Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+2790_13546272Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+16161_170-57201Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+16196_243-57201Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+161_66-57201Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+16266_522-57201Topological domainCytoplasmic
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+1690_135-57201Topological domainExtracellular
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+18136_160-60469TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+18171_195-60469TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+18244_265-60469TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000380766+1867_89-60469TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+27136_16046272TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+27171_19546272TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+27244_26546272TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000538151+2767_8946272TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+16136_160-57201TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+16171_195-57201TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+16244_265-57201TransmembraneHelical
HgeneOCLNchr5:68809936chr5:68467097ENST00000542132+1667_89-57201TransmembraneHelical
TgeneCCNB1chr5:68809936chr5:68467097ENST00000256442+2951_85121434Compositional biasNote=Lys-rich


Top

FusionGeneSequence for OCLN_CCNB1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_OCLN_ENST00000355237_chr5_68809936_+_CCNB1_ENST00000256442_chr5_68467097_+_610aa
MSSRPLESPPPYRPDEFKPNHTAPSNDITGGEMHVRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWD
RGTGTSLLGGSVGYPTGGSGFGSYGSGTGTGTGTGTGYGGTTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVTIMGVNPTAQSSGSLTGSQITALCNQFTTPAATGLYVDQTLTHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRK
MDRTDKSNILWDKEHITDEQPPNVEEWVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSETVKDITATLRQLEEE
QAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKTEEMYPPEIGDFAFVTD
NTTTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDTDMVHFPPSQIAAGAFCLALKILDNGEWTPT

>In-frame_OCLN_ENST00000396442_chr5_68809936_+_CCNB1_ENST00000256442_chr5_68467097_+_610aa
MSSRPLESPPPYRPDEFKPNHTAPSNDITGGEMHVRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWD
RGTGTSLLGGSVGYPTGGSGFGSYGSGTGTGTGTGTGYGGTTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVTIMGVNPTAQSSGSLTGSQITALCNQFTTPAATGLYVDQTLTHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRK
MDRTDKSNILWDKEHITDEQPPNVEEWVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSETVKDITATLRQLEEE
QAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKTEEMYPPEIGDFAFVTD
NTTTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDTDMVHFPPSQIAAGAFCLALKILDNGEWTPT

>In-frame_OCLN_ENST00000538151_chr5_68809936_+_CCNB1_ENST00000256442_chr5_68467097_+_359aa
MIIVAFALIIFFAVKTRRKMDRTDKSNILWDKEHITDEQPPNVEEWVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPN
LCSETVKDITATLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIA
SKTEEMYPPEIGDFAFVTDNTTTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDTDMVHFPPSQIA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_OCLN_ENST00000355237_chr5_68809936_+_CCNB1_ENST00000256442_chr5_68467097_+_1830nt
ATGTCATCCAGGCCTCTTGAAAGTCCACCTCCTTACAGGCCTGATGAATTCAAACCGAATCATTATGCACCAAGCAATGACATATATGGT
GGAGAGATGCATGTTCGACCAATGCTCTCTCAGCCAGCCTACTCTTTTTACCCAGAAGATGAAATTCTTCACTTCTACAAATGGACCTCT
CCTCCAGGAGTGATTCGGATCCTGTCTATGCTCATTATTGTGATGTGCATTGCCATCTTTGCCTGTGTGGCCTCCACGCTTGCCTGGGAC
AGAGGCTATGGAACTTCCCTTTTAGGAGGTAGTGTAGGCTACCCTTATGGAGGAAGTGGCTTTGGTAGCTACGGAAGTGGCTATGGCTAT
GGCTATGGTTATGGCTATGGCTACGGAGGCTATACAGACCCAAGAGCAGCAAAGGGCTTCATGTTGGCCATGGCTGCCTTTTGTTTCATT
GCCGCGTTGGTGATCTTTGTTACCAGTGTTATAAGATCTGAAATGTCCAGAACAAGAAGATACTACTTAAGTGTGATAATAGTGAGTGCT
ATCCTGGGCATCATGGTGTTTATTGCCACAATTGTCTATATAATGGGAGTGAACCCAACTGCTCAGTCTTCTGGATCTCTATATGGTTCA
CAAATATATGCCCTCTGCAACCAATTTTATACACCTGCAGCTACTGGACTCTACGTGGATCAGTATTTGTATCACTACTGTGTTGTGGAT
CCCCAGGAGGCCATTGCCATTGTACTGGGGTTCATGATTATTGTGGCTTTTGCTTTAATAATTTTCTTTGCTGTGAAAACTCGAAGAAAG
ATGGACAGGTATGACAAGTCCAATATTTTGTGGGACAAGGAACACATTTATGATGAGCAGCCCCCCAATGTCGAGGAGTGGGTTGATACT
GCCTCTCCAAGCCCAATGGAAACATCTGGATGTGCCCCTGCAGAAGAAGACCTGTGTCAGGCTTTCTCTGATGTAATTCTTGCAGTAAAT
GATGTGGATGCAGAAGATGGAGCTGATCCAAACCTTTGTAGTGAATATGTGAAAGATATTTATGCTTATCTGAGACAACTTGAGGAAGAG
CAAGCAGTCAGACCAAAATACCTACTGGGTCGGGAAGTCACTGGAAACATGAGAGCCATCCTAATTGACTGGCTAGTACAGGTTCAAATG
AAATTCAGGTTGTTGCAGGAGACCATGTACATGACTGTCTCCATTATTGATCGGTTCATGCAGAATAATTGTGTGCCCAAGAAGATGCTG
CAGCTGGTTGGTGTCACTGCCATGTTTATTGCAAGCAAATATGAAGAAATGTACCCTCCAGAAATTGGTGACTTTGCTTTTGTGACTGAC
AACACTTATACTAAGCACCAAATCAGACAGATGGAAATGAAGATTCTAAGAGCTTTAAACTTTGGTCTGGGTCGGCCTCTACCTTTGCAC
TTCCTTCGGAGAGCATCTAAGATTGGAGAGGTTGATGTCGAGCAACATACTTTGGCCAAATACCTGATGGAACTAACTATGTTGGACTAT
GACATGGTGCACTTTCCTCCTTCTCAAATTGCAGCAGGAGCTTTTTGCTTAGCACTGAAAATTCTGGATAATGGTGAATGGACACCAACT
CTACAACATTACCTGTCATATACTGAAGAATCTCTTCTTCCAGTTATGCAGCACCTGGCTAAGAATGTAGTCATGGTAAATCAAGGACTT
ACAAAGCACATGACTGTCAAGAACAAGTATGCCACATCGAAGCATGCTAAGATCAGCACTCTACCACAGCTGAATTCTGCACTAGTTCAA

>In-frame_OCLN_ENST00000396442_chr5_68809936_+_CCNB1_ENST00000256442_chr5_68467097_+_1830nt
ATGTCATCCAGGCCTCTTGAAAGTCCACCTCCTTACAGGCCTGATGAATTCAAACCGAATCATTATGCACCAAGCAATGACATATATGGT
GGAGAGATGCATGTTCGACCAATGCTCTCTCAGCCAGCCTACTCTTTTTACCCAGAAGATGAAATTCTTCACTTCTACAAATGGACCTCT
CCTCCAGGAGTGATTCGGATCCTGTCTATGCTCATTATTGTGATGTGCATTGCCATCTTTGCCTGTGTGGCCTCCACGCTTGCCTGGGAC
AGAGGCTATGGAACTTCCCTTTTAGGAGGTAGTGTAGGCTACCCTTATGGAGGAAGTGGCTTTGGTAGCTACGGAAGTGGCTATGGCTAT
GGCTATGGTTATGGCTATGGCTACGGAGGCTATACAGACCCAAGAGCAGCAAAGGGCTTCATGTTGGCCATGGCTGCCTTTTGTTTCATT
GCCGCGTTGGTGATCTTTGTTACCAGTGTTATAAGATCTGAAATGTCCAGAACAAGAAGATACTACTTAAGTGTGATAATAGTGAGTGCT
ATCCTGGGCATCATGGTGTTTATTGCCACAATTGTCTATATAATGGGAGTGAACCCAACTGCTCAGTCTTCTGGATCTCTATATGGTTCA
CAAATATATGCCCTCTGCAACCAATTTTATACACCTGCAGCTACTGGACTCTACGTGGATCAGTATTTGTATCACTACTGTGTTGTGGAT
CCCCAGGAGGCCATTGCCATTGTACTGGGGTTCATGATTATTGTGGCTTTTGCTTTAATAATTTTCTTTGCTGTGAAAACTCGAAGAAAG
ATGGACAGGTATGACAAGTCCAATATTTTGTGGGACAAGGAACACATTTATGATGAGCAGCCCCCCAATGTCGAGGAGTGGGTTGATACT
GCCTCTCCAAGCCCAATGGAAACATCTGGATGTGCCCCTGCAGAAGAAGACCTGTGTCAGGCTTTCTCTGATGTAATTCTTGCAGTAAAT
GATGTGGATGCAGAAGATGGAGCTGATCCAAACCTTTGTAGTGAATATGTGAAAGATATTTATGCTTATCTGAGACAACTTGAGGAAGAG
CAAGCAGTCAGACCAAAATACCTACTGGGTCGGGAAGTCACTGGAAACATGAGAGCCATCCTAATTGACTGGCTAGTACAGGTTCAAATG
AAATTCAGGTTGTTGCAGGAGACCATGTACATGACTGTCTCCATTATTGATCGGTTCATGCAGAATAATTGTGTGCCCAAGAAGATGCTG
CAGCTGGTTGGTGTCACTGCCATGTTTATTGCAAGCAAATATGAAGAAATGTACCCTCCAGAAATTGGTGACTTTGCTTTTGTGACTGAC
AACACTTATACTAAGCACCAAATCAGACAGATGGAAATGAAGATTCTAAGAGCTTTAAACTTTGGTCTGGGTCGGCCTCTACCTTTGCAC
TTCCTTCGGAGAGCATCTAAGATTGGAGAGGTTGATGTCGAGCAACATACTTTGGCCAAATACCTGATGGAACTAACTATGTTGGACTAT
GACATGGTGCACTTTCCTCCTTCTCAAATTGCAGCAGGAGCTTTTTGCTTAGCACTGAAAATTCTGGATAATGGTGAATGGACACCAACT
CTACAACATTACCTGTCATATACTGAAGAATCTCTTCTTCCAGTTATGCAGCACCTGGCTAAGAATGTAGTCATGGTAAATCAAGGACTT
ACAAAGCACATGACTGTCAAGAACAAGTATGCCACATCGAAGCATGCTAAGATCAGCACTCTACCACAGCTGAATTCTGCACTAGTTCAA

>In-frame_OCLN_ENST00000538151_chr5_68809936_+_CCNB1_ENST00000256442_chr5_68467097_+_1077nt
ATGATTATTGTGGCTTTTGCTTTAATAATTTTCTTTGCTGTGAAAACTCGAAGAAAGATGGACAGGTATGACAAGTCCAATATTTTGTGG
GACAAGGAACACATTTATGATGAGCAGCCCCCCAATGTCGAGGAGTGGGTTGATACTGCCTCTCCAAGCCCAATGGAAACATCTGGATGT
GCCCCTGCAGAAGAAGACCTGTGTCAGGCTTTCTCTGATGTAATTCTTGCAGTAAATGATGTGGATGCAGAAGATGGAGCTGATCCAAAC
CTTTGTAGTGAATATGTGAAAGATATTTATGCTTATCTGAGACAACTTGAGGAAGAGCAAGCAGTCAGACCAAAATACCTACTGGGTCGG
GAAGTCACTGGAAACATGAGAGCCATCCTAATTGACTGGCTAGTACAGGTTCAAATGAAATTCAGGTTGTTGCAGGAGACCATGTACATG
ACTGTCTCCATTATTGATCGGTTCATGCAGAATAATTGTGTGCCCAAGAAGATGCTGCAGCTGGTTGGTGTCACTGCCATGTTTATTGCA
AGCAAATATGAAGAAATGTACCCTCCAGAAATTGGTGACTTTGCTTTTGTGACTGACAACACTTATACTAAGCACCAAATCAGACAGATG
GAAATGAAGATTCTAAGAGCTTTAAACTTTGGTCTGGGTCGGCCTCTACCTTTGCACTTCCTTCGGAGAGCATCTAAGATTGGAGAGGTT
GATGTCGAGCAACATACTTTGGCCAAATACCTGATGGAACTAACTATGTTGGACTATGACATGGTGCACTTTCCTCCTTCTCAAATTGCA
GCAGGAGCTTTTTGCTTAGCACTGAAAATTCTGGATAATGGTGAATGGACACCAACTCTACAACATTACCTGTCATATACTGAAGAATCT
CTTCTTCCAGTTATGCAGCACCTGGCTAAGAATGTAGTCATGGTAAATCAAGGACTTACAAAGCACATGACTGTCAAGAACAAGTATGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_OCLN_ENST00000355237_chr5_68809936_+_CCNB1_ENST00000256442_chr5_68467097_+_2880nt
GCCTCTCTCCATCAGACACCCCAAGGTTCCATCCGAAGCAGGCGGAGCACCGAACGCACCCCGGGGTGGTCAGGGACCCCCATCCGTGCT
GCCCCCTAGGAGCCCGCGCCTCTCCTCTGCGCCCCGCCTCTCGGGCCGCAACGTCGCGCGGTTCCTTTAACAGCGCGCTGGCAGGGTGTG
GGAAGCAGGACCGCGTCCTCCCGCCCCCTCCCATCCGAGTTTCAGGTGAATTGGTCACCGAGGGAGGAGGCCGACACACCACACCTACAC
TCCCGCGTCCACCTCTCCCTCCCTGCTTCCTCTGGCGGAGGCGGCAGGAACCGAGAGCCAGGTCCAGAGCGCCGAGGAGCCGGTCTAGGA
CGCAGCAGATTGGTTTATCTTGGAAGCTAAAGGGCATTGCTCATCCTGAAGATCAGCTGACCATTGACAATCAGCCATGTCATCCAGGCC
TCTTGAAAGTCCACCTCCTTACAGGCCTGATGAATTCAAACCGAATCATTATGCACCAAGCAATGACATATATGGTGGAGAGATGCATGT
TCGACCAATGCTCTCTCAGCCAGCCTACTCTTTTTACCCAGAAGATGAAATTCTTCACTTCTACAAATGGACCTCTCCTCCAGGAGTGAT
TCGGATCCTGTCTATGCTCATTATTGTGATGTGCATTGCCATCTTTGCCTGTGTGGCCTCCACGCTTGCCTGGGACAGAGGCTATGGAAC
TTCCCTTTTAGGAGGTAGTGTAGGCTACCCTTATGGAGGAAGTGGCTTTGGTAGCTACGGAAGTGGCTATGGCTATGGCTATGGTTATGG
CTATGGCTACGGAGGCTATACAGACCCAAGAGCAGCAAAGGGCTTCATGTTGGCCATGGCTGCCTTTTGTTTCATTGCCGCGTTGGTGAT
CTTTGTTACCAGTGTTATAAGATCTGAAATGTCCAGAACAAGAAGATACTACTTAAGTGTGATAATAGTGAGTGCTATCCTGGGCATCAT
GGTGTTTATTGCCACAATTGTCTATATAATGGGAGTGAACCCAACTGCTCAGTCTTCTGGATCTCTATATGGTTCACAAATATATGCCCT
CTGCAACCAATTTTATACACCTGCAGCTACTGGACTCTACGTGGATCAGTATTTGTATCACTACTGTGTTGTGGATCCCCAGGAGGCCAT
TGCCATTGTACTGGGGTTCATGATTATTGTGGCTTTTGCTTTAATAATTTTCTTTGCTGTGAAAACTCGAAGAAAGATGGACAGGTATGA
CAAGTCCAATATTTTGTGGGACAAGGAACACATTTATGATGAGCAGCCCCCCAATGTCGAGGAGTGGGTTGATACTGCCTCTCCAAGCCC
AATGGAAACATCTGGATGTGCCCCTGCAGAAGAAGACCTGTGTCAGGCTTTCTCTGATGTAATTCTTGCAGTAAATGATGTGGATGCAGA
AGATGGAGCTGATCCAAACCTTTGTAGTGAATATGTGAAAGATATTTATGCTTATCTGAGACAACTTGAGGAAGAGCAAGCAGTCAGACC
AAAATACCTACTGGGTCGGGAAGTCACTGGAAACATGAGAGCCATCCTAATTGACTGGCTAGTACAGGTTCAAATGAAATTCAGGTTGTT
GCAGGAGACCATGTACATGACTGTCTCCATTATTGATCGGTTCATGCAGAATAATTGTGTGCCCAAGAAGATGCTGCAGCTGGTTGGTGT
CACTGCCATGTTTATTGCAAGCAAATATGAAGAAATGTACCCTCCAGAAATTGGTGACTTTGCTTTTGTGACTGACAACACTTATACTAA
GCACCAAATCAGACAGATGGAAATGAAGATTCTAAGAGCTTTAAACTTTGGTCTGGGTCGGCCTCTACCTTTGCACTTCCTTCGGAGAGC
ATCTAAGATTGGAGAGGTTGATGTCGAGCAACATACTTTGGCCAAATACCTGATGGAACTAACTATGTTGGACTATGACATGGTGCACTT
TCCTCCTTCTCAAATTGCAGCAGGAGCTTTTTGCTTAGCACTGAAAATTCTGGATAATGGTGAATGGACACCAACTCTACAACATTACCT
GTCATATACTGAAGAATCTCTTCTTCCAGTTATGCAGCACCTGGCTAAGAATGTAGTCATGGTAAATCAAGGACTTACAAAGCACATGAC
TGTCAAGAACAAGTATGCCACATCGAAGCATGCTAAGATCAGCACTCTACCACAGCTGAATTCTGCACTAGTTCAAGATTTAGCCAAGGC
TGTGGCAAAGGTGTAACTTGTAAACTTGAGTTGGAGTACTATATTTACAAATAAAATTGGCACCATGTGCCATCTGTACATATTACTGTT
GCATTTACTTTTAATAAAGCTTGTGGCCCCTTTTACTTTTTTATAGCTTAACTAATTTGAATGTGGTTACTTCCTACTGTAGGGTAGCGG
AAAAGTTGTCTTAAAAGGTATGGTGGGGATATTTTTAAAAACTCCTTTTGGTTTACCTGGGGATCCAATTGATGTATATGTTTATATACT
GGGTTCTTGTTTTATATACCTGGCTTTTACTTTATTAATATGAGTTACTGAAGGTGATGGAGGTATTTGAAAATTTTACTTCCATAGGAC
ATACTGCATGTAAGCCAAGTCATGGAGAATCTGCTGCATAGCTCTATTTTAAAGTAAAAGTCTACCACCGAATCCCTAGTCCCCCTGTTT
TCTGTTTCTTCTTGTGATTGCTGCCATAATTCTAAGTTATTTACTTTTACCACTATTTAAGTTATCAACTTTAGCTAGTATCTTCAAACT
TTCACTTTGAAAAATGAGAATTTTATATTCTAAGCCAGTTTTCATTTTGGTTTTGTGTTTTGGTTAATAAAACAATACTCAAATACAAAA

>In-frame_OCLN_ENST00000396442_chr5_68809936_+_CCNB1_ENST00000256442_chr5_68467097_+_2623nt
AGTCCCCGGCTGAGCGCTGGCGGTCGGTGCGGCGTCAGGTGCGCCCGCCAGGTGAGCGCGCTCCCTGGCACCGTTGGCCCCCGGAGGGTC
GGGCCCAGTTGCGGCGAGCGGATTGGTTTATCTTGGAAGCTAAAGGGCATTGCTCATCCTGAAGATCAGCTGACCATTGACAATCAGCCA
TGTCATCCAGGCCTCTTGAAAGTCCACCTCCTTACAGGCCTGATGAATTCAAACCGAATCATTATGCACCAAGCAATGACATATATGGTG
GAGAGATGCATGTTCGACCAATGCTCTCTCAGCCAGCCTACTCTTTTTACCCAGAAGATGAAATTCTTCACTTCTACAAATGGACCTCTC
CTCCAGGAGTGATTCGGATCCTGTCTATGCTCATTATTGTGATGTGCATTGCCATCTTTGCCTGTGTGGCCTCCACGCTTGCCTGGGACA
GAGGCTATGGAACTTCCCTTTTAGGAGGTAGTGTAGGCTACCCTTATGGAGGAAGTGGCTTTGGTAGCTACGGAAGTGGCTATGGCTATG
GCTATGGTTATGGCTATGGCTACGGAGGCTATACAGACCCAAGAGCAGCAAAGGGCTTCATGTTGGCCATGGCTGCCTTTTGTTTCATTG
CCGCGTTGGTGATCTTTGTTACCAGTGTTATAAGATCTGAAATGTCCAGAACAAGAAGATACTACTTAAGTGTGATAATAGTGAGTGCTA
TCCTGGGCATCATGGTGTTTATTGCCACAATTGTCTATATAATGGGAGTGAACCCAACTGCTCAGTCTTCTGGATCTCTATATGGTTCAC
AAATATATGCCCTCTGCAACCAATTTTATACACCTGCAGCTACTGGACTCTACGTGGATCAGTATTTGTATCACTACTGTGTTGTGGATC
CCCAGGAGGCCATTGCCATTGTACTGGGGTTCATGATTATTGTGGCTTTTGCTTTAATAATTTTCTTTGCTGTGAAAACTCGAAGAAAGA
TGGACAGGTATGACAAGTCCAATATTTTGTGGGACAAGGAACACATTTATGATGAGCAGCCCCCCAATGTCGAGGAGTGGGTTGATACTG
CCTCTCCAAGCCCAATGGAAACATCTGGATGTGCCCCTGCAGAAGAAGACCTGTGTCAGGCTTTCTCTGATGTAATTCTTGCAGTAAATG
ATGTGGATGCAGAAGATGGAGCTGATCCAAACCTTTGTAGTGAATATGTGAAAGATATTTATGCTTATCTGAGACAACTTGAGGAAGAGC
AAGCAGTCAGACCAAAATACCTACTGGGTCGGGAAGTCACTGGAAACATGAGAGCCATCCTAATTGACTGGCTAGTACAGGTTCAAATGA
AATTCAGGTTGTTGCAGGAGACCATGTACATGACTGTCTCCATTATTGATCGGTTCATGCAGAATAATTGTGTGCCCAAGAAGATGCTGC
AGCTGGTTGGTGTCACTGCCATGTTTATTGCAAGCAAATATGAAGAAATGTACCCTCCAGAAATTGGTGACTTTGCTTTTGTGACTGACA
ACACTTATACTAAGCACCAAATCAGACAGATGGAAATGAAGATTCTAAGAGCTTTAAACTTTGGTCTGGGTCGGCCTCTACCTTTGCACT
TCCTTCGGAGAGCATCTAAGATTGGAGAGGTTGATGTCGAGCAACATACTTTGGCCAAATACCTGATGGAACTAACTATGTTGGACTATG
ACATGGTGCACTTTCCTCCTTCTCAAATTGCAGCAGGAGCTTTTTGCTTAGCACTGAAAATTCTGGATAATGGTGAATGGACACCAACTC
TACAACATTACCTGTCATATACTGAAGAATCTCTTCTTCCAGTTATGCAGCACCTGGCTAAGAATGTAGTCATGGTAAATCAAGGACTTA
CAAAGCACATGACTGTCAAGAACAAGTATGCCACATCGAAGCATGCTAAGATCAGCACTCTACCACAGCTGAATTCTGCACTAGTTCAAG
ATTTAGCCAAGGCTGTGGCAAAGGTGTAACTTGTAAACTTGAGTTGGAGTACTATATTTACAAATAAAATTGGCACCATGTGCCATCTGT
ACATATTACTGTTGCATTTACTTTTAATAAAGCTTGTGGCCCCTTTTACTTTTTTATAGCTTAACTAATTTGAATGTGGTTACTTCCTAC
TGTAGGGTAGCGGAAAAGTTGTCTTAAAAGGTATGGTGGGGATATTTTTAAAAACTCCTTTTGGTTTACCTGGGGATCCAATTGATGTAT
ATGTTTATATACTGGGTTCTTGTTTTATATACCTGGCTTTTACTTTATTAATATGAGTTACTGAAGGTGATGGAGGTATTTGAAAATTTT
ACTTCCATAGGACATACTGCATGTAAGCCAAGTCATGGAGAATCTGCTGCATAGCTCTATTTTAAAGTAAAAGTCTACCACCGAATCCCT
AGTCCCCCTGTTTTCTGTTTCTTCTTGTGATTGCTGCCATAATTCTAAGTTATTTACTTTTACCACTATTTAAGTTATCAACTTTAGCTA
GTATCTTCAAACTTTCACTTTGAAAAATGAGAATTTTATATTCTAAGCCAGTTTTCATTTTGGTTTTGTGTTTTGGTTAATAAAACAATA

>In-frame_OCLN_ENST00000538151_chr5_68809936_+_CCNB1_ENST00000256442_chr5_68467097_+_1809nt
GGCATTGCTCATCCTGAAGATCAGCTGACCATTGACAATCAGCCATGTCATCCAGGCCTCTTGAAAGTCCACCTCCTTACAGGCCTGATG
AATTGCCATTGCCATTGTACTGGGGTTCATGATTATTGTGGCTTTTGCTTTAATAATTTTCTTTGCTGTGAAAACTCGAAGAAAGATGGA
CAGGTATGACAAGTCCAATATTTTGTGGGACAAGGAACACATTTATGATGAGCAGCCCCCCAATGTCGAGGAGTGGGTTGATACTGCCTC
TCCAAGCCCAATGGAAACATCTGGATGTGCCCCTGCAGAAGAAGACCTGTGTCAGGCTTTCTCTGATGTAATTCTTGCAGTAAATGATGT
GGATGCAGAAGATGGAGCTGATCCAAACCTTTGTAGTGAATATGTGAAAGATATTTATGCTTATCTGAGACAACTTGAGGAAGAGCAAGC
AGTCAGACCAAAATACCTACTGGGTCGGGAAGTCACTGGAAACATGAGAGCCATCCTAATTGACTGGCTAGTACAGGTTCAAATGAAATT
CAGGTTGTTGCAGGAGACCATGTACATGACTGTCTCCATTATTGATCGGTTCATGCAGAATAATTGTGTGCCCAAGAAGATGCTGCAGCT
GGTTGGTGTCACTGCCATGTTTATTGCAAGCAAATATGAAGAAATGTACCCTCCAGAAATTGGTGACTTTGCTTTTGTGACTGACAACAC
TTATACTAAGCACCAAATCAGACAGATGGAAATGAAGATTCTAAGAGCTTTAAACTTTGGTCTGGGTCGGCCTCTACCTTTGCACTTCCT
TCGGAGAGCATCTAAGATTGGAGAGGTTGATGTCGAGCAACATACTTTGGCCAAATACCTGATGGAACTAACTATGTTGGACTATGACAT
GGTGCACTTTCCTCCTTCTCAAATTGCAGCAGGAGCTTTTTGCTTAGCACTGAAAATTCTGGATAATGGTGAATGGACACCAACTCTACA
ACATTACCTGTCATATACTGAAGAATCTCTTCTTCCAGTTATGCAGCACCTGGCTAAGAATGTAGTCATGGTAAATCAAGGACTTACAAA
GCACATGACTGTCAAGAACAAGTATGCCACATCGAAGCATGCTAAGATCAGCACTCTACCACAGCTGAATTCTGCACTAGTTCAAGATTT
AGCCAAGGCTGTGGCAAAGGTGTAACTTGTAAACTTGAGTTGGAGTACTATATTTACAAATAAAATTGGCACCATGTGCCATCTGTACAT
ATTACTGTTGCATTTACTTTTAATAAAGCTTGTGGCCCCTTTTACTTTTTTATAGCTTAACTAATTTGAATGTGGTTACTTCCTACTGTA
GGGTAGCGGAAAAGTTGTCTTAAAAGGTATGGTGGGGATATTTTTAAAAACTCCTTTTGGTTTACCTGGGGATCCAATTGATGTATATGT
TTATATACTGGGTTCTTGTTTTATATACCTGGCTTTTACTTTATTAATATGAGTTACTGAAGGTGATGGAGGTATTTGAAAATTTTACTT
CCATAGGACATACTGCATGTAAGCCAAGTCATGGAGAATCTGCTGCATAGCTCTATTTTAAAGTAAAAGTCTACCACCGAATCCCTAGTC
CCCCTGTTTTCTGTTTCTTCTTGTGATTGCTGCCATAATTCTAAGTTATTTACTTTTACCACTATTTAAGTTATCAACTTTAGCTAGTAT
CTTCAAACTTTCACTTTGAAAAATGAGAATTTTATATTCTAAGCCAGTTTTCATTTTGGTTTTGTGTTTTGGTTAATAAAACAATACTCA


Top

FusionGenePPI for OCLN_CCNB1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
OCLNTJP2, RAB8B, YES1, TJP1, GJB1, ITCH, EPN1, EPS15, HGS, NEDD4L, TGFBR1, TGFBR2, LYN, TNFAIP3, CLEC7A, SYNE4, SNW1, CSNK1E, ULK1, CSNK1A1, MPZL2, CD1B, TMEM171, IGSF8, SLAMF1, DLK1, SLC18A1, TMEM17, TMEM216, FATE1, CDH1, PTPN2, FBLN1, MFAP4, CTAGE5, TMEM30B, C4A, SDC1, SIGLECL1, NEDD4, NDUFAF1, TNFSF8, ANTXR1, ACAD9, EFEMP1, SYT12, DNAJC13, PREB, MAN1A1, TNFSF9, CSNK2A1, OCLNCCNB1RALBP1, CDK2, CDK1, HERC5, CDC25A, TGFBR2, BRCA1, CDC25C, GADD45A, GADD45B, GADD45G, CCNF, CDKN1A, CDC14A, ZC3HC1, CDC27, TSPYL2, GAPDH, SET, MGMT, FOXM1, ARID4A, CDC20, UHRF2, UBE2K, FZR1, UBE3D, E2F3, PCNA, HIST1H1A, PSMA6, SP1, RPA1, SKP2, ANAPC4, CDC16, PPP1CA, PPP1CB, PPP1CC, USP37, CAND1, CKS1B, CKS2, RPTOR, CDT1, HIST1H1B, NDC80, SDHAF2, PRC1, RB1, MFN1, MARCH5, VCP, CCNB1IP1, TP73, CDC6, CDK7, TP53BP1, POLA1, ANAPC11, PTMA, SQSTM1, CDK5, RHOBTB3, SIRT1, BTRC, EP300, RELA, UBE2D2, GAS2L1, CCNB2, DIAPH3, HNRNPLL, RNASEH2C, OFD1, PCM1, CEP170, CEP162, SPICE1, CEP128, CNTRL, FBF1, NIN, DCTN1, XPO1, KIF22, LLGL2, CHST15, KLC3, CDKN1B, NCBP1, PRDX1, RPS3, KAT6A, FXR1, AKR7A2, PKMYT1, KEAP1, PDCD6, PRDX3, SLC27A2, ALKBH8, TARSL2, ANAPC10, ESPL1, FOXO1, UBE3C, PARK2, PRKDC, CCDC6, SNW1, CDC5L, OTUB1, TRIM28, CCAR1, CDK3, BCLAF1, STK38, RPS18, STAU1, GRWD1, DNMT1, HDAC1, USP22, USP14, CDC25B, PRPSAP2, IKZF5, ZADH2, LRRFIP1, NGB, PARVA, PTPDC1, PTCH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneCCNB1chr5:68809936chr5:68467097ENST00000256442+29169_177121434CDK2
TgeneCCNB1chr5:68809936chr5:68467097ENST00000256442+29258_261121434CDK2


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for OCLN_CCNB1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for OCLN_CCNB1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneOCLNC1458155Mammary Neoplasms2CTD_human
HgeneOCLNC0007621Neoplastic Cell Transformation1CTD_human
HgeneOCLNC0019156Hepatic Veno-Occlusive Disease1CTD_human
HgeneOCLNC0035309Retinal Diseases1CTD_human
HgeneOCLNC0038002Splenomegaly1CTD_human
HgeneOCLNC2609414Acute kidney injury1CTD_human
HgeneOCLNC3489725Pseudo-TORCH syndrome1CTD_human;ORPHANET;UNIPROT
TgeneCCNB1C0032460Polycystic Ovary Syndrome1CTD_human