FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25307

FusionGeneSummary for NXT2_COL4A5

check button Fusion gene summary
Fusion gene informationFusion gene name: NXT2_COL4A5
Fusion gene ID: 25307
HgeneTgene
Gene symbol

NXT2

COL4A5

Gene ID

55916

1287

Gene namenuclear transport factor 2 like export factor 2collagen type IV alpha 5 chain
SynonymsP15-2ASLN|ATS|CA54
Cytomap

Xq23

Xq22.3

Type of geneprotein-codingprotein-coding
DescriptionNTF2-related export protein 2protein p15-2collagen alpha-5(IV) chaincollagen IV, alpha-5 polypeptidecollagen of basement membrane, alpha-5 chaincollagen, type IV, alpha 5dA149D17.3dA24A23.1
Modification date2018052320180523
UniProtAcc

Q9NPJ8

P29400

Ensembl transtripts involved in fusion geneENST00000218004, ENST00000372107, 
ENST00000372106, ENST00000372103, 
ENST00000328300, ENST00000361603, 
ENST00000477429, 
Fusion gene scores* DoF score1 X 1 X 1=12 X 2 X 2=8
# samples 12
** MAII scorelog2(1/1*10)=3.32192809488736log2(2/8*10)=1.32192809488736
Context

PubMed: NXT2 [Title/Abstract] AND COL4A5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-CD-A48C-01ANXT2chrX

108784848

+COL4A5chrX

107929261

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000218004ENST00000328300NXT2chrX

108784848

+COL4A5chrX

107929261

+
In-frameENST00000218004ENST00000361603NXT2chrX

108784848

+COL4A5chrX

107929261

+
5CDS-intronENST00000218004ENST00000477429NXT2chrX

108784848

+COL4A5chrX

107929261

+
In-frameENST00000372107ENST00000328300NXT2chrX

108784848

+COL4A5chrX

107929261

+
In-frameENST00000372107ENST00000361603NXT2chrX

108784848

+COL4A5chrX

107929261

+
5CDS-intronENST00000372107ENST00000477429NXT2chrX

108784848

+COL4A5chrX

107929261

+
In-frameENST00000372106ENST00000328300NXT2chrX

108784848

+COL4A5chrX

107929261

+
In-frameENST00000372106ENST00000361603NXT2chrX

108784848

+COL4A5chrX

107929261

+
5CDS-intronENST00000372106ENST00000477429NXT2chrX

108784848

+COL4A5chrX

107929261

+
In-frameENST00000372103ENST00000328300NXT2chrX

108784848

+COL4A5chrX

107929261

+
In-frameENST00000372103ENST00000361603NXT2chrX

108784848

+COL4A5chrX

107929261

+
5CDS-intronENST00000372103ENST00000477429NXT2chrX

108784848

+COL4A5chrX

107929261

+

Top

FusionProtFeatures for NXT2_COL4A5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NXT2

Q9NPJ8

COL4A5

P29400

Type IV collagen is the major structural component ofglomerular basement membranes (GBM), forming a 'chicken-wire'meshwork together with laminins, proteoglycans andentactin/nidogen.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNXT2chrX:108784848chrX:107929261ENST00000218004+4517_136137198DomainNTF2
TgeneCOL4A5chrX:108784848chrX:107929261ENST00000328300+46531461_168514051692DomainCollagen IV NC1
TgeneCOL4A5chrX:108784848chrX:107929261ENST00000361603+44511461_168513991686DomainCollagen IV NC1

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNXT2chrX:108784848chrX:107929261ENST00000372103+3417_13654115DomainNTF2
HgeneNXT2chrX:108784848chrX:107929261ENST00000372106+3417_13682143DomainNTF2
HgeneNXT2chrX:108784848chrX:107929261ENST00000372107+4517_13654115DomainNTF2
TgeneCOL4A5chrX:108784848chrX:107929261ENST00000328300+465327_4114051692RegionNote=Nonhelical region (NC2)
TgeneCOL4A5chrX:108784848chrX:107929261ENST00000328300+465342_145614051692RegionNote=Triple-helical region
TgeneCOL4A5chrX:108784848chrX:107929261ENST00000361603+445127_4113991686RegionNote=Nonhelical region (NC2)
TgeneCOL4A5chrX:108784848chrX:107929261ENST00000361603+445142_145613991686RegionNote=Triple-helical region


Top

FusionGeneSequence for NXT2_COL4A5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NXT2_ENST00000218004_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_424aa
MRKYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRA
LTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGPPG
PDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASR
NDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLE

>In-frame_NXT2_ENST00000218004_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_424aa
MRKYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRA
LTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGPPG
PDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASR
NDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLE

>In-frame_NXT2_ENST00000372107_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_341aa
MDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTR
GLDGPPGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINN
VCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALA

>In-frame_NXT2_ENST00000372107_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_341aa
MDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTR
GLDGPPGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINN
VCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALA

>In-frame_NXT2_ENST00000372106_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_369aa
MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHGPTGPPGD
PGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGPPGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKR
AHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCP
QGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISR

>In-frame_NXT2_ENST00000372106_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_369aa
MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHGPTGPPGD
PGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGPPGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKR
AHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCP
QGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISR

>In-frame_NXT2_ENST00000372103_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_341aa
MDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTR
GLDGPPGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINN
VCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALA

>In-frame_NXT2_ENST00000372103_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_341aa
MDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTR
GLDGPPGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINN
VCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NXT2_ENST00000218004_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_1272nt
ATGAGAAAATACAGAAGCCACTGGTCTCAGGGAGACAGAGAAGGATACCAAAGAAGAAGTAACTATTATGAGGGGCCACACACCAGCCAC
TCAAGCCCTGCGGACCGGACACGTGAGGAGGTAGTGACGCCGACACTGCCAGAACACACTGCTACAAGGTCCCAGATGGCCACGTCTCTG
GATTTTAAAACTTATGTAGATCAGGCATGTAGAGCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAAAGAAGACGGGCA
CTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAATTTTTTTGACACA
TTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCTGGACGCAATGGA
CTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGATGGTCCCCCTGGT
CCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGCCAGACAACGGAT
GCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCCCACGGTCAAGAC
TTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAACTTTGCTTCAAGA
AATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAGCCATTCATTAGT
CGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAGGGATGGGATTCT
CTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGTTCCTGCTTGGAA
GAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGGCTGGCAACTGTA
GATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGTCAAGTGTGCATG

>In-frame_NXT2_ENST00000218004_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_1272nt
ATGAGAAAATACAGAAGCCACTGGTCTCAGGGAGACAGAGAAGGATACCAAAGAAGAAGTAACTATTATGAGGGGCCACACACCAGCCAC
TCAAGCCCTGCGGACCGGACACGTGAGGAGGTAGTGACGCCGACACTGCCAGAACACACTGCTACAAGGTCCCAGATGGCCACGTCTCTG
GATTTTAAAACTTATGTAGATCAGGCATGTAGAGCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAAAGAAGACGGGCA
CTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAATTTTTTTGACACA
TTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCTGGACGCAATGGA
CTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGATGGTCCCCCTGGT
CCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGCCAGACAACGGAT
GCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCCCACGGTCAAGAC
TTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAACTTTGCTTCAAGA
AATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAGCCATTCATTAGT
CGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAGGGATGGGATTCT
CTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGTTCCTGCTTGGAA
GAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGGCTGGCAACTGTA
GATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGTCAAGTGTGCATG

>In-frame_NXT2_ENST00000372107_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_1023nt
ATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCC
CTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCA
GGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGT
GGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACA
CGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAAT
AAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAAT
GTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAG
AGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCAT
TGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCC
TCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTAC
AGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATT

>In-frame_NXT2_ENST00000372107_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_1023nt
ATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCC
CTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCA
GGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGT
GGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACA
CGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAAT
AAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAAT
GTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAG
AGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCAT
TGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCC
TCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTAC
AGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATT

>In-frame_NXT2_ENST00000372106_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_1107nt
ATGGCCACGTCTCTGGATTTTAAAACTTATGTAGATCAGGCATGTAGAGCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGAT
AAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAAT
AATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGAT
CCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTG
GATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCAC
AGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGA
GCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGC
AACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATC
CAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCT
CAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCT
GGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTT
TGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGA

>In-frame_NXT2_ENST00000372106_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_1107nt
ATGGCCACGTCTCTGGATTTTAAAACTTATGTAGATCAGGCATGTAGAGCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGAT
AAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAAT
AATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGAT
CCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTG
GATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCAC
AGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGA
GCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGC
AACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATC
CAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCT
CAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCT
GGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTT
TGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGA

>In-frame_NXT2_ENST00000372103_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_1023nt
ATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCC
CTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCA
GGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGT
GGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACA
CGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAAT
AAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAAT
GTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAG
AGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCAT
TGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCC
TCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTAC
AGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATT

>In-frame_NXT2_ENST00000372103_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_1023nt
ATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCC
CTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCA
GGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGT
GGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACA
CGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAAT
AAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAAT
GTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAG
AGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCAT
TGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCC
TCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTAC
AGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NXT2_ENST00000218004_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_2537nt
AGTCAGAGGTTAACGGAAAACGGAAGCTGGCTGGCTGAGAAGAAGCTTCCGTTAGTCCTACCTTGAAGAGAAAAGAGCCAGATAAAGAGA
AAGATTAAAAGTATGAGAAAATACAGAAGCCACTGGTCTCAGGGAGACAGAGAAGGATACCAAAGAAGAAGTAACTATTATGAGGGGCCA
CACACCAGCCACTCAAGCCCTGCGGACCGGACACGTGAGGAGGTAGTGACGCCGACACTGCCAGAACACACTGCTACAAGGTCCCAGATG
GCCACGTCTCTGGATTTTAAAACTTATGTAGATCAGGCATGTAGAGCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAA
AGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAAT
TTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCT
GGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGAT
GGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGC
CAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCC
CACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAAC
TTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAG
CCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAG
GGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGT
TCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGG
CTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGT
CAAGTGTGCATGAAGAGGACATAACATTTTGAAGAATTCCTTTTGTGTTTTAAAATGTGATATATATATATATAAAATTCCTAGGATGCA
GTGTCTCATTGTCCCCAACTTTACTACTGCTGCCGTCAATGGTGCTACTATATATGATCAAGATAACATGCTGACTAGTAACCATGAAGA
TTCAGATGTACCTCAGCAATGCGCCAGAGCAAAGTCTCTATTATTTTTCTACTAAAGAAATAAGGAAGTGAATTTACTTTTTGGGTCCAG
AATGACTTTCTCCAAGAATTATAAGATGAAAATTATATATTTTGCCCAGTTACTAAAATGGTACATTAAAAATTCAATTAAGAGAAGAGT
CACATTGAGTAAAATAAAAGACTGCAGTTTGTGGGAAGAATTATTTTTCACGGTGCTACTAATCCTGCTGTATCCCGGGTTTTTAATATA
AAGGTGTTAAGCTTATTTTGCTTTGTAAGTAAAGAATGTGTATATTGTGAACAGCCTTTTAGCTCAAAATGTTGAGTCATTTACATATGA
CATAGCATGAATCACTCTTTACAGAAAATGTAGGAAACCCTAGAATACAGACAGCAATATTTTATATTCATGTTTATCAAAGTGAGAGGA
CTTATATTCCTACATCAAGTTACTACTGAGAGTAAATTTATTTTGAGTTTTATCCCGTAAGTTCTGTTTTGATTTTTTTTAAAAAACAAA
CCCTTTTAGTCACTTTAATCAGAATTTTAAATGTTCATGTTACATACCAAATTATAATATCTAATGGAGCAATTTGTCTTTTGCTATATT
CTCCAAGATTATCTCTTAAGACCATATGCCCCCTGTTTTAATGTTTCTTACATCTTGTTTTTACTCATTTCTGACTGGACAAAGTTCTTC
CAAACAATTCTGAGAAACAAAAACACACACGCAGAATTAACAATTCTTTTCCCTGTGCTTCTTATGTAAGAATCCTCCTGTGGCCTCTGC
TTGTACAGAACTGGGAAACAACACTTGGTTAGTCTCTTTTAAGTTACAAAAAGCCAATTGATGTTTCTTATTCTTTTTAAATTTTAAATA
TTTTGTTATAAATACTCACAGGATACCTTATTTCCCTAGCTATCATCTCCTGACTTAATGTTTTTTAAACCCACCAATATAAATTTAATT

>In-frame_NXT2_ENST00000218004_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_2541nt
AGTCAGAGGTTAACGGAAAACGGAAGCTGGCTGGCTGAGAAGAAGCTTCCGTTAGTCCTACCTTGAAGAGAAAAGAGCCAGATAAAGAGA
AAGATTAAAAGTATGAGAAAATACAGAAGCCACTGGTCTCAGGGAGACAGAGAAGGATACCAAAGAAGAAGTAACTATTATGAGGGGCCA
CACACCAGCCACTCAAGCCCTGCGGACCGGACACGTGAGGAGGTAGTGACGCCGACACTGCCAGAACACACTGCTACAAGGTCCCAGATG
GCCACGTCTCTGGATTTTAAAACTTATGTAGATCAGGCATGTAGAGCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAA
AGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAAT
TTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCT
GGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGAT
GGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGC
CAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCC
CACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAAC
TTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAG
CCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAG
GGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGT
TCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGG
CTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGT
CAAGTGTGCATGAAGAGGACATAACATTTTGAAGAATTCCTTTTGTGTTTTAAAATGTGATATATATATATATAAAATTCCTAGGATGCA
GTGTCTCATTGTCCCCAACTTTACTACTGCTGCCGTCAATGGTGCTACTATATATGATCAAGATAACATGCTGACTAGTAACCATGAAGA
TTCAGATGTACCTCAGCAATGCGCCAGAGCAAAGTCTCTATTATTTTTCTACTAAAGAAATAAGGAAGTGAATTTACTTTTTGGGTCCAG
AATGACTTTCTCCAAGAATTATAAGATGAAAATTATATATTTTGCCCAGTTACTAAAATGGTACATTAAAAATTCAATTAAGAGAAGAGT
CACATTGAGTAAAATAAAAGACTGCAGTTTGTGGGAAGAATTATTTTTCACGGTGCTACTAATCCTGCTGTATCCCGGGTTTTTAATATA
AAGGTGTTAAGCTTATTTTGCTTTGTAAGTAAAGAATGTGTATATTGTGAACAGCCTTTTAGCTCAAAATGTTGAGTCATTTACATATGA
CATAGCATGAATCACTCTTTACAGAAAATGTAGGAAACCCTAGAATACAGACAGCAATATTTTATATTCATGTTTATCAAAGTGAGAGGA
CTTATATTCCTACATCAAGTTACTACTGAGAGTAAATTTATTTTGAGTTTTATCCCGTAAGTTCTGTTTTGATTTTTTTTAAAAAACAAA
CCCTTTTAGTCACTTTAATCAGAATTTTAAATGTTCATGTTACATACCAAATTATAATATCTAATGGAGCAATTTGTCTTTTGCTATATT
CTCCAAGATTATCTCTTAAGACCATATGCCCCCTGTTTTAATGTTTCTTACATCTTGTTTTTACTCATTTCTGACTGGACAAAGTTCTTC
CAAACAATTCTGAGAAACAAAAACACACACGCAGAATTAACAATTCTTTTCCCTGTGCTTCTTATGTAAGAATCCTCCTGTGGCCTCTGC
TTGTACAGAACTGGGAAACAACACTTGGTTAGTCTCTTTTAAGTTACAAAAAGCCAATTGATGTTTCTTATTCTTTTTAAATTTTAAATA
TTTTGTTATAAATACTCACAGGATACCTTATTTCCCTAGCTATCATCTCCTGACTTAATGTTTTTTAAACCCACCAATATAAATTTAATT

>In-frame_NXT2_ENST00000372107_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_2492nt
CCCAGGCTTGTCGTTAGAAAAGTAGGGGACTTTCCTGTTGAGTATCATGTTTACAAAAGCAAAGTGGCTTTTAAATTTTAAACTAAGTAT
CAAACAAGTAGATAAGGTGGATGGGAGGGATCTTCAGGAACTGAAGGGAAGTGGAACTTAAGCCCTGCGGACCGGACACGTGAGGAGGTA
GTGACGCCGACACTGCCAGAACACACTGCTACAAGGTCCCAGATGGCCACGTCTCTGGATTTTAAAACTTATGTAGATCAGGCATGTAGA
GCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTA
ATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTA
GATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAA
GGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCT
GGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTC
TATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTT
AGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAG
CCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTG
ATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACA
AGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCAT
GGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCA
GAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGTCAAGTGTGCATGAAGAGGACATAACATTTTGAAGAATTCCTTTTG
TGTTTTAAAATGTGATATATATATATATAAAATTCCTAGGATGCAGTGTCTCATTGTCCCCAACTTTACTACTGCTGCCGTCAATGGTGC
TACTATATATGATCAAGATAACATGCTGACTAGTAACCATGAAGATTCAGATGTACCTCAGCAATGCGCCAGAGCAAAGTCTCTATTATT
TTTCTACTAAAGAAATAAGGAAGTGAATTTACTTTTTGGGTCCAGAATGACTTTCTCCAAGAATTATAAGATGAAAATTATATATTTTGC
CCAGTTACTAAAATGGTACATTAAAAATTCAATTAAGAGAAGAGTCACATTGAGTAAAATAAAAGACTGCAGTTTGTGGGAAGAATTATT
TTTCACGGTGCTACTAATCCTGCTGTATCCCGGGTTTTTAATATAAAGGTGTTAAGCTTATTTTGCTTTGTAAGTAAAGAATGTGTATAT
TGTGAACAGCCTTTTAGCTCAAAATGTTGAGTCATTTACATATGACATAGCATGAATCACTCTTTACAGAAAATGTAGGAAACCCTAGAA
TACAGACAGCAATATTTTATATTCATGTTTATCAAAGTGAGAGGACTTATATTCCTACATCAAGTTACTACTGAGAGTAAATTTATTTTG
AGTTTTATCCCGTAAGTTCTGTTTTGATTTTTTTTAAAAAACAAACCCTTTTAGTCACTTTAATCAGAATTTTAAATGTTCATGTTACAT
ACCAAATTATAATATCTAATGGAGCAATTTGTCTTTTGCTATATTCTCCAAGATTATCTCTTAAGACCATATGCCCCCTGTTTTAATGTT
TCTTACATCTTGTTTTTACTCATTTCTGACTGGACAAAGTTCTTCCAAACAATTCTGAGAAACAAAAACACACACGCAGAATTAACAATT
CTTTTCCCTGTGCTTCTTATGTAAGAATCCTCCTGTGGCCTCTGCTTGTACAGAACTGGGAAACAACACTTGGTTAGTCTCTTTTAAGTT
ACAAAAAGCCAATTGATGTTTCTTATTCTTTTTAAATTTTAAATATTTTGTTATAAATACTCACAGGATACCTTATTTCCCTAGCTATCA

>In-frame_NXT2_ENST00000372107_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_2496nt
CCCAGGCTTGTCGTTAGAAAAGTAGGGGACTTTCCTGTTGAGTATCATGTTTACAAAAGCAAAGTGGCTTTTAAATTTTAAACTAAGTAT
CAAACAAGTAGATAAGGTGGATGGGAGGGATCTTCAGGAACTGAAGGGAAGTGGAACTTAAGCCCTGCGGACCGGACACGTGAGGAGGTA
GTGACGCCGACACTGCCAGAACACACTGCTACAAGGTCCCAGATGGCCACGTCTCTGGATTTTAAAACTTATGTAGATCAGGCATGTAGA
GCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTA
ATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTA
GATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAA
GGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCT
GGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTC
TATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTT
AGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAG
CCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTG
ATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACA
AGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCAT
GGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCA
GAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGTCAAGTGTGCATGAAGAGGACATAACATTTTGAAGAATTCCTTTTG
TGTTTTAAAATGTGATATATATATATATAAAATTCCTAGGATGCAGTGTCTCATTGTCCCCAACTTTACTACTGCTGCCGTCAATGGTGC
TACTATATATGATCAAGATAACATGCTGACTAGTAACCATGAAGATTCAGATGTACCTCAGCAATGCGCCAGAGCAAAGTCTCTATTATT
TTTCTACTAAAGAAATAAGGAAGTGAATTTACTTTTTGGGTCCAGAATGACTTTCTCCAAGAATTATAAGATGAAAATTATATATTTTGC
CCAGTTACTAAAATGGTACATTAAAAATTCAATTAAGAGAAGAGTCACATTGAGTAAAATAAAAGACTGCAGTTTGTGGGAAGAATTATT
TTTCACGGTGCTACTAATCCTGCTGTATCCCGGGTTTTTAATATAAAGGTGTTAAGCTTATTTTGCTTTGTAAGTAAAGAATGTGTATAT
TGTGAACAGCCTTTTAGCTCAAAATGTTGAGTCATTTACATATGACATAGCATGAATCACTCTTTACAGAAAATGTAGGAAACCCTAGAA
TACAGACAGCAATATTTTATATTCATGTTTATCAAAGTGAGAGGACTTATATTCCTACATCAAGTTACTACTGAGAGTAAATTTATTTTG
AGTTTTATCCCGTAAGTTCTGTTTTGATTTTTTTTAAAAAACAAACCCTTTTAGTCACTTTAATCAGAATTTTAAATGTTCATGTTACAT
ACCAAATTATAATATCTAATGGAGCAATTTGTCTTTTGCTATATTCTCCAAGATTATCTCTTAAGACCATATGCCCCCTGTTTTAATGTT
TCTTACATCTTGTTTTTACTCATTTCTGACTGGACAAAGTTCTTCCAAACAATTCTGAGAAACAAAAACACACACGCAGAATTAACAATT
CTTTTCCCTGTGCTTCTTATGTAAGAATCCTCCTGTGGCCTCTGCTTGTACAGAACTGGGAAACAACACTTGGTTAGTCTCTTTTAAGTT
ACAAAAAGCCAATTGATGTTTCTTATTCTTTTTAAATTTTAAATATTTTGTTATAAATACTCACAGGATACCTTATTTCCCTAGCTATCA

>In-frame_NXT2_ENST00000372106_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_2401nt
GTGGAAAATTTTGTGCGTTTGGCGGGTTTCGCTCTCTTCATAAGTATTGATCATTCCGCAGCCCTGCGGACCGGACACGTGAGGAGGTAG
TGACGCCGACACTGCCAGAACACACTGCTACAAGGTCCCAGATGGCCACGTCTCTGGATTTTAAAACTTATGTAGATCAGGCATGTAGAG
CTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAA
TATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAG
ATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAG
GAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTG
GAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCT
ATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTA
GTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGC
CCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGA
TCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAA
GTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATG
GGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAG
AAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGTCAAGTGTGCATGAAGAGGACATAACATTTTGAAGAATTCCTTTTGT
GTTTTAAAATGTGATATATATATATATAAAATTCCTAGGATGCAGTGTCTCATTGTCCCCAACTTTACTACTGCTGCCGTCAATGGTGCT
ACTATATATGATCAAGATAACATGCTGACTAGTAACCATGAAGATTCAGATGTACCTCAGCAATGCGCCAGAGCAAAGTCTCTATTATTT
TTCTACTAAAGAAATAAGGAAGTGAATTTACTTTTTGGGTCCAGAATGACTTTCTCCAAGAATTATAAGATGAAAATTATATATTTTGCC
CAGTTACTAAAATGGTACATTAAAAATTCAATTAAGAGAAGAGTCACATTGAGTAAAATAAAAGACTGCAGTTTGTGGGAAGAATTATTT
TTCACGGTGCTACTAATCCTGCTGTATCCCGGGTTTTTAATATAAAGGTGTTAAGCTTATTTTGCTTTGTAAGTAAAGAATGTGTATATT
GTGAACAGCCTTTTAGCTCAAAATGTTGAGTCATTTACATATGACATAGCATGAATCACTCTTTACAGAAAATGTAGGAAACCCTAGAAT
ACAGACAGCAATATTTTATATTCATGTTTATCAAAGTGAGAGGACTTATATTCCTACATCAAGTTACTACTGAGAGTAAATTTATTTTGA
GTTTTATCCCGTAAGTTCTGTTTTGATTTTTTTTAAAAAACAAACCCTTTTAGTCACTTTAATCAGAATTTTAAATGTTCATGTTACATA
CCAAATTATAATATCTAATGGAGCAATTTGTCTTTTGCTATATTCTCCAAGATTATCTCTTAAGACCATATGCCCCCTGTTTTAATGTTT
CTTACATCTTGTTTTTACTCATTTCTGACTGGACAAAGTTCTTCCAAACAATTCTGAGAAACAAAAACACACACGCAGAATTAACAATTC
TTTTCCCTGTGCTTCTTATGTAAGAATCCTCCTGTGGCCTCTGCTTGTACAGAACTGGGAAACAACACTTGGTTAGTCTCTTTTAAGTTA
CAAAAAGCCAATTGATGTTTCTTATTCTTTTTAAATTTTAAATATTTTGTTATAAATACTCACAGGATACCTTATTTCCCTAGCTATCAT

>In-frame_NXT2_ENST00000372106_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_2405nt
GTGGAAAATTTTGTGCGTTTGGCGGGTTTCGCTCTCTTCATAAGTATTGATCATTCCGCAGCCCTGCGGACCGGACACGTGAGGAGGTAG
TGACGCCGACACTGCCAGAACACACTGCTACAAGGTCCCAGATGGCCACGTCTCTGGATTTTAAAACTTATGTAGATCAGGCATGTAGAG
CTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCCACCTTAA
TATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAATATGTTAG
ATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGGCGCAAAG
GAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGTCCCCCTG
GAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTTCAGGTCT
ATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGTCGCTTTA
GTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACCCCAGAGC
CCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCTGTGGTGA
TCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATGCATACAA
GTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAATGTCATG
GGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCTCAGTCAG
AAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGTCAAGTGTGCATGAAGAGGACATAACATTTTGAAGAATTCCTTTTGT
GTTTTAAAATGTGATATATATATATATAAAATTCCTAGGATGCAGTGTCTCATTGTCCCCAACTTTACTACTGCTGCCGTCAATGGTGCT
ACTATATATGATCAAGATAACATGCTGACTAGTAACCATGAAGATTCAGATGTACCTCAGCAATGCGCCAGAGCAAAGTCTCTATTATTT
TTCTACTAAAGAAATAAGGAAGTGAATTTACTTTTTGGGTCCAGAATGACTTTCTCCAAGAATTATAAGATGAAAATTATATATTTTGCC
CAGTTACTAAAATGGTACATTAAAAATTCAATTAAGAGAAGAGTCACATTGAGTAAAATAAAAGACTGCAGTTTGTGGGAAGAATTATTT
TTCACGGTGCTACTAATCCTGCTGTATCCCGGGTTTTTAATATAAAGGTGTTAAGCTTATTTTGCTTTGTAAGTAAAGAATGTGTATATT
GTGAACAGCCTTTTAGCTCAAAATGTTGAGTCATTTACATATGACATAGCATGAATCACTCTTTACAGAAAATGTAGGAAACCCTAGAAT
ACAGACAGCAATATTTTATATTCATGTTTATCAAAGTGAGAGGACTTATATTCCTACATCAAGTTACTACTGAGAGTAAATTTATTTTGA
GTTTTATCCCGTAAGTTCTGTTTTGATTTTTTTTAAAAAACAAACCCTTTTAGTCACTTTAATCAGAATTTTAAATGTTCATGTTACATA
CCAAATTATAATATCTAATGGAGCAATTTGTCTTTTGCTATATTCTCCAAGATTATCTCTTAAGACCATATGCCCCCTGTTTTAATGTTT
CTTACATCTTGTTTTTACTCATTTCTGACTGGACAAAGTTCTTCCAAACAATTCTGAGAAACAAAAACACACACGCAGAATTAACAATTC
TTTTCCCTGTGCTTCTTATGTAAGAATCCTCCTGTGGCCTCTGCTTGTACAGAACTGGGAAACAACACTTGGTTAGTCTCTTTTAAGTTA
CAAAAAGCCAATTGATGTTTCTTATTCTTTTTAAATTTTAAATATTTTGTTATAAATACTCACAGGATACCTTATTTCCCTAGCTATCAT

>In-frame_NXT2_ENST00000372103_chrX_108784848_+_COL4A5_ENST00000328300_chrX_107929261_+_2408nt
GTGACGAATCACGTCCCGGCTCTCTGCACTGCGGGGCGGGGCCCACGCTTTGCTGCCCGCCCTGCCGGCCCCACCCCCAGCCTGGTTAGC
AGTCGCTTTCTGATCCCGGAAAGGACCCTGAGCTGGGAAATAGCGAGAGGCGGGGATGTTGGGGATTTTAAAACTTATGTAGATCAGGCA
TGTAGAGCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCC
ACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAAT
ATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGG
CGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGT
CCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTT
CAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGT
CGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACC
CCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCT
GTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATG
CATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAA
TGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCT
CAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGTCAAGTGTGCATGAAGAGGACATAACATTTTGAAGAATTC
CTTTTGTGTTTTAAAATGTGATATATATATATATAAAATTCCTAGGATGCAGTGTCTCATTGTCCCCAACTTTACTACTGCTGCCGTCAA
TGGTGCTACTATATATGATCAAGATAACATGCTGACTAGTAACCATGAAGATTCAGATGTACCTCAGCAATGCGCCAGAGCAAAGTCTCT
ATTATTTTTCTACTAAAGAAATAAGGAAGTGAATTTACTTTTTGGGTCCAGAATGACTTTCTCCAAGAATTATAAGATGAAAATTATATA
TTTTGCCCAGTTACTAAAATGGTACATTAAAAATTCAATTAAGAGAAGAGTCACATTGAGTAAAATAAAAGACTGCAGTTTGTGGGAAGA
ATTATTTTTCACGGTGCTACTAATCCTGCTGTATCCCGGGTTTTTAATATAAAGGTGTTAAGCTTATTTTGCTTTGTAAGTAAAGAATGT
GTATATTGTGAACAGCCTTTTAGCTCAAAATGTTGAGTCATTTACATATGACATAGCATGAATCACTCTTTACAGAAAATGTAGGAAACC
CTAGAATACAGACAGCAATATTTTATATTCATGTTTATCAAAGTGAGAGGACTTATATTCCTACATCAAGTTACTACTGAGAGTAAATTT
ATTTTGAGTTTTATCCCGTAAGTTCTGTTTTGATTTTTTTTAAAAAACAAACCCTTTTAGTCACTTTAATCAGAATTTTAAATGTTCATG
TTACATACCAAATTATAATATCTAATGGAGCAATTTGTCTTTTGCTATATTCTCCAAGATTATCTCTTAAGACCATATGCCCCCTGTTTT
AATGTTTCTTACATCTTGTTTTTACTCATTTCTGACTGGACAAAGTTCTTCCAAACAATTCTGAGAAACAAAAACACACACGCAGAATTA
ACAATTCTTTTCCCTGTGCTTCTTATGTAAGAATCCTCCTGTGGCCTCTGCTTGTACAGAACTGGGAAACAACACTTGGTTAGTCTCTTT
TAAGTTACAAAAAGCCAATTGATGTTTCTTATTCTTTTTAAATTTTAAATATTTTGTTATAAATACTCACAGGATACCTTATTTCCCTAG

>In-frame_NXT2_ENST00000372103_chrX_108784848_+_COL4A5_ENST00000361603_chrX_107929261_+_2412nt
GTGACGAATCACGTCCCGGCTCTCTGCACTGCGGGGCGGGGCCCACGCTTTGCTGCCCGCCCTGCCGGCCCCACCCCCAGCCTGGTTAGC
AGTCGCTTTCTGATCCCGGAAAGGACCCTGAGCTGGGAAATAGCGAGAGGCGGGGATGTTGGGGATTTTAAAACTTATGTAGATCAGGCA
TGTAGAGCTGCTGAGGAGTTTGTCAATATTTACTATGAGACAATGGATAAAAGAAGACGGGCACTAACCAGGCTGTATCTGGACAAGGCC
ACCTTAATATGGAATGGAAATGCTGTTTCAGGGCTGGATGCCCTAAATAATTTTTTTGACACATTGCCTTCTAGTGAGTTCCAGGTCAAT
ATGTTAGATTGCCAACCAGTTCATGGTCCAACTGGCCCTCCAGGAGATCCTGGACGCAATGGACTCCCTGGCTTTGATGGTGCAGGAGGG
CGCAAAGGAGACCCAGGTCTGCCAGGACAGCCAGGTACCCGTGGTTTGGATGGTCCCCCTGGTCCAGATGGATTGCAAGGTCCCCCAGGT
CCCCCTGGAACCTCCTCTGTTGCACATGGATTTCTTATTACACGCCACAGCCAGACAACGGATGCACCACAATGCCCACAGGGAACACTT
CAGGTCTATGAAGGCTTTTCTCTCCTGTATGTACAAGGAAATAAAAGAGCCCACGGTCAAGACTTGGGGACGGCTGGCAGCTGCCTTCGT
CGCTTTAGTACCATGCCTTTCATGTTCTGCAACATCAATAATGTTTGCAACTTTGCTTCAAGAAATGACTATTCTTACTGGCTCTCTACC
CCAGAGCCCATGCCAATGAGCATGCAACCCCTAAAGGGCCAGAGCATCCAGCCATTCATTAGTCGATGTGCAGTATGTGAAGCTCCAGCT
GTGGTGATCGCAGTTCACAGTCAGACGATCCAGATTCCCCATTGTCCTCAGGGATGGGATTCTCTGTGGATTGGTTATTCCTTCATGATG
CATACAAGTGCAGGGGCAGAAGGCTCAGGTCAAGCCCTAGCCTCCCCTGGTTCCTGCTTGGAAGAGTTTCGTTCAGCTCCCTTCATCGAA
TGTCATGGGAGGGGTACCTGTAACTACTATGCCAACTCCTACAGCTTTTGGCTGGCAACTGTAGATGTGTCAGACATGTTCAGTAAACCT
CAGTCAGAAACGCTGAAAGCAGGAGACTTGAGGACACGAATTAGCCGATGTCAAGTGTGCATGAAGAGGACATAACATTTTGAAGAATTC
CTTTTGTGTTTTAAAATGTGATATATATATATATAAAATTCCTAGGATGCAGTGTCTCATTGTCCCCAACTTTACTACTGCTGCCGTCAA
TGGTGCTACTATATATGATCAAGATAACATGCTGACTAGTAACCATGAAGATTCAGATGTACCTCAGCAATGCGCCAGAGCAAAGTCTCT
ATTATTTTTCTACTAAAGAAATAAGGAAGTGAATTTACTTTTTGGGTCCAGAATGACTTTCTCCAAGAATTATAAGATGAAAATTATATA
TTTTGCCCAGTTACTAAAATGGTACATTAAAAATTCAATTAAGAGAAGAGTCACATTGAGTAAAATAAAAGACTGCAGTTTGTGGGAAGA
ATTATTTTTCACGGTGCTACTAATCCTGCTGTATCCCGGGTTTTTAATATAAAGGTGTTAAGCTTATTTTGCTTTGTAAGTAAAGAATGT
GTATATTGTGAACAGCCTTTTAGCTCAAAATGTTGAGTCATTTACATATGACATAGCATGAATCACTCTTTACAGAAAATGTAGGAAACC
CTAGAATACAGACAGCAATATTTTATATTCATGTTTATCAAAGTGAGAGGACTTATATTCCTACATCAAGTTACTACTGAGAGTAAATTT
ATTTTGAGTTTTATCCCGTAAGTTCTGTTTTGATTTTTTTTAAAAAACAAACCCTTTTAGTCACTTTAATCAGAATTTTAAATGTTCATG
TTACATACCAAATTATAATATCTAATGGAGCAATTTGTCTTTTGCTATATTCTCCAAGATTATCTCTTAAGACCATATGCCCCCTGTTTT
AATGTTTCTTACATCTTGTTTTTACTCATTTCTGACTGGACAAAGTTCTTCCAAACAATTCTGAGAAACAAAAACACACACGCAGAATTA
ACAATTCTTTTCCCTGTGCTTCTTATGTAAGAATCCTCCTGTGGCCTCTGCTTGTACAGAACTGGGAAACAACACTTGGTTAGTCTCTTT
TAAGTTACAAAAAGCCAATTGATGTTTCTTATTCTTTTTAAATTTTAAATATTTTGTTATAAATACTCACAGGATACCTTATTTCCCTAG


Top

FusionGenePPI for NXT2_COL4A5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NXT2NXF3, ELAVL1, APP, SRPK2, SRPK1, TRIM23, GOLGA2, PKM, PTPN3, REL, SSBP3, CCDC102B, CEP63, LNX1, USP54, KRAS, STAT3, INPP4A, NXF1, PTAR1, RGS8, NXF2, PTPN11COL4A5DAZAP2, TK1, CDKN1A, SMN1, NR1H2, ANXA7, VHL, ELAVL1, ANTXR2, STRN3, PDK1, DAP3, KIF21B, CASC5, VPS26B, CEP170P1, PLOD1, COL8A2, COLGALT2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NXT2_COL4A5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NXT2_COL4A5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCOL4A5C1567742Alport Syndrome, X-Linked17CTD_human;ORPHANET;UNIPROT
TgeneCOL4A5C0086533Leiomyoma, Epithelioid1CTD_human