FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25220

FusionGeneSummary for NUP214_ABL1

check button Fusion gene summary
Fusion gene informationFusion gene name: NUP214_ABL1
Fusion gene ID: 25220
HgeneTgene
Gene symbol

NUP214

ABL1

Gene ID

8021

25

Gene namenucleoporin 214ABL proto-oncogene 1, non-receptor tyrosine kinase
SynonymsCAIN|CANABL|CHDSKM|JTK7|bcr/abl|c-ABL|c-ABL1|p150|v-abl
Cytomap

9q34.13

9q34.12

Type of geneprotein-codingprotein-coding
Descriptionnuclear pore complex protein Nup214CAN protein, putative oncogenenucleoporin 214kDatyrosine-protein kinase ABL1Abelson tyrosine-protein kinase 1bcr/c-abl oncogene proteinc-abl oncogene 1, receptor tyrosine kinaseproto-oncogene c-Ablproto-oncogene tyrosine-protein kinase ABL1v-abl Abelson murine leukemia viral oncogene homolog 1
Modification date2018052320180527
UniProtAcc

P35658

P00519

Ensembl transtripts involved in fusion geneENST00000359428, ENST00000411637, 
ENST00000451030, ENST00000483497, 
ENST00000465486, 
ENST00000318560, 
Fusion gene scores* DoF score11 X 11 X 4=48410 X 38 X 4=1520
# samples 1162
** MAII scorelog2(11/484*10)=-2.13750352374993
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(62/1520*10)=-1.29373120305671
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NUP214 [Title/Abstract] AND ABL1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneABL1

GO:0006974

cellular response to DNA damage stimulus

15657060

TgeneABL1

GO:0006975

DNA damage induced protein phosphorylation

18280240

TgeneABL1

GO:0018108

peptidyl-tyrosine phosphorylation

7590236|9144171|10713049|11121037

TgeneABL1

GO:0038083

peptidyl-tyrosine autophosphorylation

10518561

TgeneABL1

GO:0042770

signal transduction in response to DNA damage

9037071|15657060

TgeneABL1

GO:0043065

positive regulation of apoptotic process

9037071

TgeneABL1

GO:0046777

protein autophosphorylation

10713049

TgeneABL1

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

15657060

TgeneABL1

GO:0051353

positive regulation of oxidoreductase activity

12893824

TgeneABL1

GO:0051444

negative regulation of ubiquitin-protein transferase activity

20823226

TgeneABL1

GO:0070301

cellular response to hydrogen peroxide

10713049

TgeneABL1

GO:0071901

negative regulation of protein serine/threonine kinase activity

11121037

TgeneABL1

GO:1990051

activation of protein kinase C activity

10713049

TgeneABL1

GO:2001020

regulation of response to DNA damage stimulus

9461559


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVESCATCGA-L5-A4OQ-01ANUP214chr9

134027281

+ABL1chr9

133747516

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000359428ENST00000318560NUP214chr9

134027281

+ABL1chr9

133747516

+
In-frameENST00000411637ENST00000318560NUP214chr9

134027281

+ABL1chr9

133747516

+
In-frameENST00000451030ENST00000318560NUP214chr9

134027281

+ABL1chr9

133747516

+
intron-3CDSENST00000483497ENST00000318560NUP214chr9

134027281

+ABL1chr9

133747516

+
intron-3CDSENST00000465486ENST00000318560NUP214chr9

134027281

+ABL1chr9

133747516

+

Top

FusionProtFeatures for NUP214_ABL1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NUP214

P35658

ABL1

P00519

May serve as a docking site in the receptor-mediatedimport of substrates across the nuclear pore complex.{ECO:0000303|PubMed:8108440}. Non-receptor tyrosine-protein kinase that plays a rolein many key processes linked to cell growth and survival such ascytoskeleton remodeling in response to extracellular stimuli, cellmotility and adhesion, receptor endocytosis, autophagy, DNA damageresponse and apoptosis. Coordinates actin remodeling throughtyrosine phosphorylation of proteins controlling cytoskeletondynamics like WASF3 (involved in branch formation); ANXA1(involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH(involved in signaling); or MAPT and PXN (microtubule-bindingproteins). Phosphorylation of WASF3 is critical for thestimulation of lamellipodia formation and cell migration. Involvedin the regulation of cell adhesion and motility throughphosphorylation of key regulators of these processes such asBCAR1, CRK, CRKL, DOK1, EFS or NEDD9. Phosphorylates multiplereceptor tyrosine kinases and more particularly promotesendocytosis of EGFR, facilitates the formation of neuromuscularsynapses through MUSK, inhibits PDGFRB-mediated chemotaxis andmodulates the endocytosis of activated B-cell receptor complexes.Other substrates which are involved in endocytosis regulation arethe caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBLfamily of ubiquitin ligases that drive receptor down-regulationand actin remodeling. Phosphorylation of CBL leads to increasedEGFR stability. Involved in late-stage autophagy by regulatingpositively the trafficking and function of lysosomal components.ABL1 targets to mitochondria in response to oxidative stress andthereby mediates mitochondrial dysfunction and cell death. Inresponse to oxidative stress, phosphorylates serine/threoninekinase PRKD2 at 'Tyr-717' (PubMed:28428613). ABL1 is alsotranslocated in the nucleus where it has DNA-binding activity andis involved in DNA-damage response and apoptosis. Many substratesare known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6,RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathwaywhen the DNA damage is too severe to be repaired. PhosphorylatesTP73, a primary regulator for this type of damage-inducedapoptosis. Phosphorylates the caspase CASP9 on 'Tyr-153' andregulates its processing in the apoptotic response to DNA damage.Phosphorylates PSMA7 that leads to an inhibition of proteasomalactivity and cell cycle transition blocks. ABL1 acts also as aregulator of multiple pathological signaling cascades duringinfection. Several known tyrosine-phosphorylated microbialproteins have been identified as ABL1 substrates. This is the caseof A36R of Vaccinia virus, Tir (translocated intimin receptor) ofpathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containingprotein A) of A.phagocytophilum. Pathogens can highjack ABL1kinase signaling to reorganize the host actin cytoskeleton formultiple purposes, like facilitating intracellular movement andhost cell exit. Finally, functions as its own regulator throughautocatalytic activity as well as through phosphorylation of itsinhibitor, ABI1. Regulates T-cell differentiation in a TBX21-dependent manner. Phosphorylates TBX21 on tyrosine residuesleading to an enhancement of its transcriptional activatoractivity (By similarity). {ECO:0000250|UniProtKB:P00520,ECO:0000269|PubMed:10391250, ECO:0000269|PubMed:11971963,ECO:0000269|PubMed:12379650, ECO:0000269|PubMed:12531427,ECO:0000269|PubMed:12672821, ECO:0000269|PubMed:15031292,ECO:0000269|PubMed:15556646, ECO:0000269|PubMed:15657060,ECO:0000269|PubMed:15886098, ECO:0000269|PubMed:16424036,ECO:0000269|PubMed:16678104, ECO:0000269|PubMed:16943190,ECO:0000269|PubMed:17306540, ECO:0000269|PubMed:17623672,ECO:0000269|PubMed:18328268, ECO:0000269|PubMed:18945674,ECO:0000269|PubMed:19891780, ECO:0000269|PubMed:20357770,ECO:0000269|PubMed:20417104, ECO:0000269|PubMed:28428613,ECO:0000269|PubMed:9037071, ECO:0000269|PubMed:9144171,ECO:0000269|PubMed:9461559}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+173641_4048122091RegionNote=Seven-bladed beta propeller
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+1736740_7688122091RegionNote=Leucine-zipper 1
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+173641_4048022081RegionNote=Seven-bladed beta propeller
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+1736740_7688022081RegionNote=Leucine-zipper 1
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+173641_4048132092RegionNote=Seven-bladed beta propeller
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+1736740_7688132092RegionNote=Leucine-zipper 1
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+1736151_1938122091RepeatNote=Blade 3
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+1736194_2398122091RepeatNote=Blade 4
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+1736240_3038122091RepeatNote=Blade 5
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+1736304_3598122091RepeatNote=Blade 6
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+1736360_4048122091RepeatNote=Blade 7
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+173641_938122091RepeatNote=Blade 1
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+173694_1508122091RepeatNote=Blade 2
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+1736151_1938022081RepeatNote=Blade 3
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+1736194_2398022081RepeatNote=Blade 4
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+1736240_3038022081RepeatNote=Blade 5
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+1736304_3598022081RepeatNote=Blade 6
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+1736360_4048022081RepeatNote=Blade 7
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+173641_938022081RepeatNote=Blade 1
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+173694_1508022081RepeatNote=Blade 2
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+1736151_1938132092RepeatNote=Blade 3
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+1736194_2398132092RepeatNote=Blade 4
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+1736240_3038132092RepeatNote=Blade 5
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+1736304_3598132092RepeatNote=Blade 6
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+1736360_4048132092RepeatNote=Blade 7
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+173641_938132092RepeatNote=Blade 1
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+173694_1508132092RepeatNote=Blade 2
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311605_6092741131Compositional biasNote=Poly-Lys
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311782_10192741131Compositional biasNote=Pro-rich
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311897_9032741131Compositional biasNote=Poly-Pro
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+3111090_11002741131MotifNuclear export signal
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311381_4052741131MotifNote=Kinase activation loop
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311709_7152741131MotifNuclear localization signal 2
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311762_7692741131MotifNuclear localization signal 3
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311316_3222741131Nucleotide bindingNote=ATP
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311869_9682741131RegionDNA-binding
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311953_11302741131RegionNote=F-actin-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+1736680_12098122091Coiled coilOntology_term=ECO:0000269
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+1736680_12098022081Coiled coilOntology_term=ECO:0000269
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+1736680_12098132092Coiled coilOntology_term=ECO:0000269
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+17361213_20908122091Compositional biasNote=Pro/Ser/Thr-rich
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+17361213_20908022081Compositional biasNote=Pro/Ser/Thr-rich
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+17361213_20908132092Compositional biasNote=Pro/Ser/Thr-rich
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+17361409_20848122091RegionNote=18 X 4 AA approximate repeats
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+17361427_20858122091RegionNote=11 X 3 AA approximate repeats
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+1736481_20768122091RegionNote=11 X 5 AA approximate repeats
HgeneNUP214chr9:134027281chr9:133747516ENST00000359428+1736861_8828122091RegionNote=Leucine-zipper 2
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+17361409_20848022081RegionNote=18 X 4 AA approximate repeats
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+17361427_20858022081RegionNote=11 X 3 AA approximate repeats
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+1736481_20768022081RegionNote=11 X 5 AA approximate repeats
HgeneNUP214chr9:134027281chr9:133747516ENST00000411637+1736861_8828022081RegionNote=Leucine-zipper 2
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+17361409_20848132092RegionNote=18 X 4 AA approximate repeats
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+17361427_20858132092RegionNote=11 X 3 AA approximate repeats
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+1736481_20768132092RegionNote=11 X 5 AA approximate repeats
HgeneNUP214chr9:134027281chr9:133747516ENST00000451030+1736861_8828132092RegionNote=Leucine-zipper 2
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+31118_222741131Compositional biasNote=Poly-Ser
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311127_2172741131DomainSH2
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311242_4932741131DomainProtein kinase
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+31161_1212741131DomainSH3
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+311248_2562741131Nucleotide bindingNote=ATP
TgeneABL1chr9:134027281chr9:133747516ENST00000318560+3111_602741131RegionNote=CAP


Top

FusionGeneSequence for NUP214_ABL1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NUP214_ENST00000359428_chr9_134027281_+_ABL1_ENST00000318560_chr9_133747516_+_1669aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFTIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHR
DLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATTGMSPYPGIDLSQVTELL
EKDYRMERPEGCPEKVTELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHR
DTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRG
AGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCV
PHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPN
LTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPP
PAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSAL
AGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSTVDSIQQMRNKFA

>In-frame_NUP214_ENST00000411637_chr9_134027281_+_ABL1_ENST00000318560_chr9_133747516_+_1659aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEDTMEVEE
FLKEAAVMKEIKHPNLVQLLGVCTREPPFTIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVG
ENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATTGMSPYPGIDLSQVTELLEKDYRMERPE
GCPEKVTELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPH
SKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDIS
NGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCVPHGAKDTEWR
SVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQV
TVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGG
KPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAF
IPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSTVDSIQQMRNKFAFREAINKLEN

>In-frame_NUP214_ENST00000451030_chr9_134027281_+_ABL1_ENST00000318560_chr9_133747516_+_1670aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFTIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIH
RDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATTGMSPYPGIDLSQVTEL
LEKDYRMERPEGCPEKVTELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEH
RDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERR
GAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASC
VPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPP
NLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPP
PPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSA
LAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSTVDSIQQMRNKF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NUP214_ENST00000359428_chr9_134027281_+_ABL1_ENST00000318560_chr9_133747516_+_5007nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAGGACACCATGGAGGTGGAAGAGTTCTTGAAAGAAGCTGCAGTCATGAAAGAGATCAAACACCCTAACCTGGTGCAGCTCCTT
GGGGTCTGCACCCGGGAGCCCCCGTTCTATATCATCACTGAGTTCATGACCTACGGGAACCTCCTGGACTACCTGAGGGAGTGCAACCGG
CAGGAGGTGAACGCCGTGGTGCTGCTGTACATGGCCACTCAGATCTCGTCAGCCATGGAGTACCTGGAGAAGAAAAACTTCATCCACAGA
GATCTTGCTGCCCGAAACTGCCTGGTAGGGGAGAACCACTTGGTGAAGGTAGCTGATTTTGGCCTGAGCAGGTTGATGACAGGGGACACC
TACACAGCCCATGCTGGAGCCAAGTTCCCCATCAAATGGACTGCACCCGAGAGCCTGGCCTACAACAAGTTCTCCATCAAGTCCGACGTC
TGGGCATTTGGAGTATTGCTTTGGGAAATTGCTACCTATGGCATGTCCCCTTACCCGGGAATTGACCTGTCCCAGGTGTATGAGCTGCTA
GAGAAGGACTACCGCATGGAGCGCCCAGAAGGCTGCCCAGAGAAGGTCTATGAACTCATGCGAGCATGTTGGCAGTGGAATCCCTCTGAC
CGGCCCTCCTTTGCTGAAATCCACCAAGCCTTTGAAACAATGTTCCAGGAATCCAGTATCTCAGACGAAGTGGAAAAGGAGCTGGGGAAA
CAAGGCGTCCGTGGGGCTGTGAGTACCTTGCTGCAGGCCCCAGAGCTGCCCACCAAGACGAGGACCTCCAGGAGAGCTGCAGAGCACAGA
GACACCACTGACGTGCCTGAGATGCCTCACTCCAAGGGCCAGGGAGAGAGCGATCCTCTGGACCATGAGCCTGCCGTGTCTCCATTGCTC
CCTCGAAAAGAGCGAGGTCCCCCGGAGGGCGGCCTGAATGAAGATGAGCGCCTTCTCCCCAAAGACAAAAAGACCAACTTGTTCAGCGCC
TTGATCAAGAAGAAGAAGAAGACAGCCCCAACCCCTCCCAAACGCAGCAGCTCCTTCCGGGAGATGGACGGCCAGCCGGAGCGCAGAGGG
GCCGGCGAGGAAGAGGGCCGAGACATCAGCAACGGGGCACTGGCTTTCACCCCCTTGGACACAGCTGACCCAGCCAAGTCCCCAAAGCCC
AGCAATGGGGCTGGGGTCCCCAATGGAGCCCTCCGGGAGTCCGGGGGCTCAGGCTTCCGGTCTCCCCACCTGTGGAAGAAGTCCAGCACG
CTGACCAGCAGCCGCCTAGCCACCGGCGAGGAGGAGGGCGGTGGCAGCTCCAGCAAGCGCTTCCTGCGCTCTTGCTCCGCCTCCTGCGTT
CCCCATGGGGCCAAGGACACGGAGTGGAGGTCAGTCACGCTGCCTCGGGACTTGCAGTCCACGGGAAGACAGTTTGACTCGTCCACATTT
GGAGGGCACAAAAGTGAGAAGCCGGCTCTGCCTCGGAAGAGGGCAGGGGAGAACAGGTCTGACCAGGTGACCCGAGGCACAGTAACGCCT
CCCCCCAGGCTGGTGAAAAAGAATGAGGAAGCTGCTGATGAGGTCTTCAAAGACATCATGGAGTCCAGCCCGGGCTCCAGCCCGCCCAAC
CTGACTCCAAAACCCCTCCGGCGGCAGGTCACCGTGGCCCCTGCCTCGGGCCTCCCCCACAAGGAAGAAGCTGGAAAGGGCAGTGCCTTA
GGGACCCCTGCTGCAGCTGAGCCAGTGACCCCCACCAGCAAAGCAGGCTCAGGTGCACCAGGGGGCACCAGCAAGGGCCCCGCCGAGGAG
TCCAGAGTGAGGAGGCACAAGCACTCCTCTGAGTCGCCAGGGAGGGACAAGGGGAAATTGTCCAGGCTCAAACCTGCCCCGCCGCCCCCA
CCAGCAGCCTCTGCAGGGAAGGCTGGAGGAAAGCCCTCGCAGAGCCCGAGCCAGGAGGCGGCCGGGGAGGCAGTCCTGGGCGCAAAGACA
AAAGCCACGAGTCTGGTTGATGCTGTGAACAGTGACGCTGCCAAGCCCAGCCAGCCGGGAGAGGGCCTCAAAAAGCCCGTGCTCCCGGCC
ACTCCAAAGCCACAGTCCGCCAAGCCGTCGGGGACCCCCATCAGCCCAGCCCCCGTTCCCTCCACGTTGCCATCAGCATCCTCGGCCCTG
GCAGGGGACCAGCCGTCTTCCACCGCCTTCATCCCTCTCATATCAACCCGAGTGTCTCTTCGGAAAACCCGCCAGCCTCCAGAGCGGATC
GCCAGCGGCGCCATCACCAAGGGCGTGGTCCTGGACAGCACCGAGGCGCTGTGCCTCGCCATCTCTAGGAACTCCGAGCAGATGGCCAGC
CACAGCGCAGTGCTGGAGGCCGGCAAAAACCTCTACACGTTCTGCGTGAGCTATGTGGATTCCATCCAGCAAATGAGGAACAAGTTTGCC
TTCCGAGAGGCCATCAACAAACTGGAGAATAATCTCCGGGAGCTTCAGATCTGCCCGGCGACAGCAGGCAGTGGTCCAGCGGCCACTCAG

>In-frame_NUP214_ENST00000411637_chr9_134027281_+_ABL1_ENST00000318560_chr9_133747516_+_4977nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAGGACACCATGGAGGTGGAAGAG
TTCTTGAAAGAAGCTGCAGTCATGAAAGAGATCAAACACCCTAACCTGGTGCAGCTCCTTGGGGTCTGCACCCGGGAGCCCCCGTTCTAT
ATCATCACTGAGTTCATGACCTACGGGAACCTCCTGGACTACCTGAGGGAGTGCAACCGGCAGGAGGTGAACGCCGTGGTGCTGCTGTAC
ATGGCCACTCAGATCTCGTCAGCCATGGAGTACCTGGAGAAGAAAAACTTCATCCACAGAGATCTTGCTGCCCGAAACTGCCTGGTAGGG
GAGAACCACTTGGTGAAGGTAGCTGATTTTGGCCTGAGCAGGTTGATGACAGGGGACACCTACACAGCCCATGCTGGAGCCAAGTTCCCC
ATCAAATGGACTGCACCCGAGAGCCTGGCCTACAACAAGTTCTCCATCAAGTCCGACGTCTGGGCATTTGGAGTATTGCTTTGGGAAATT
GCTACCTATGGCATGTCCCCTTACCCGGGAATTGACCTGTCCCAGGTGTATGAGCTGCTAGAGAAGGACTACCGCATGGAGCGCCCAGAA
GGCTGCCCAGAGAAGGTCTATGAACTCATGCGAGCATGTTGGCAGTGGAATCCCTCTGACCGGCCCTCCTTTGCTGAAATCCACCAAGCC
TTTGAAACAATGTTCCAGGAATCCAGTATCTCAGACGAAGTGGAAAAGGAGCTGGGGAAACAAGGCGTCCGTGGGGCTGTGAGTACCTTG
CTGCAGGCCCCAGAGCTGCCCACCAAGACGAGGACCTCCAGGAGAGCTGCAGAGCACAGAGACACCACTGACGTGCCTGAGATGCCTCAC
TCCAAGGGCCAGGGAGAGAGCGATCCTCTGGACCATGAGCCTGCCGTGTCTCCATTGCTCCCTCGAAAAGAGCGAGGTCCCCCGGAGGGC
GGCCTGAATGAAGATGAGCGCCTTCTCCCCAAAGACAAAAAGACCAACTTGTTCAGCGCCTTGATCAAGAAGAAGAAGAAGACAGCCCCA
ACCCCTCCCAAACGCAGCAGCTCCTTCCGGGAGATGGACGGCCAGCCGGAGCGCAGAGGGGCCGGCGAGGAAGAGGGCCGAGACATCAGC
AACGGGGCACTGGCTTTCACCCCCTTGGACACAGCTGACCCAGCCAAGTCCCCAAAGCCCAGCAATGGGGCTGGGGTCCCCAATGGAGCC
CTCCGGGAGTCCGGGGGCTCAGGCTTCCGGTCTCCCCACCTGTGGAAGAAGTCCAGCACGCTGACCAGCAGCCGCCTAGCCACCGGCGAG
GAGGAGGGCGGTGGCAGCTCCAGCAAGCGCTTCCTGCGCTCTTGCTCCGCCTCCTGCGTTCCCCATGGGGCCAAGGACACGGAGTGGAGG
TCAGTCACGCTGCCTCGGGACTTGCAGTCCACGGGAAGACAGTTTGACTCGTCCACATTTGGAGGGCACAAAAGTGAGAAGCCGGCTCTG
CCTCGGAAGAGGGCAGGGGAGAACAGGTCTGACCAGGTGACCCGAGGCACAGTAACGCCTCCCCCCAGGCTGGTGAAAAAGAATGAGGAA
GCTGCTGATGAGGTCTTCAAAGACATCATGGAGTCCAGCCCGGGCTCCAGCCCGCCCAACCTGACTCCAAAACCCCTCCGGCGGCAGGTC
ACCGTGGCCCCTGCCTCGGGCCTCCCCCACAAGGAAGAAGCTGGAAAGGGCAGTGCCTTAGGGACCCCTGCTGCAGCTGAGCCAGTGACC
CCCACCAGCAAAGCAGGCTCAGGTGCACCAGGGGGCACCAGCAAGGGCCCCGCCGAGGAGTCCAGAGTGAGGAGGCACAAGCACTCCTCT
GAGTCGCCAGGGAGGGACAAGGGGAAATTGTCCAGGCTCAAACCTGCCCCGCCGCCCCCACCAGCAGCCTCTGCAGGGAAGGCTGGAGGA
AAGCCCTCGCAGAGCCCGAGCCAGGAGGCGGCCGGGGAGGCAGTCCTGGGCGCAAAGACAAAAGCCACGAGTCTGGTTGATGCTGTGAAC
AGTGACGCTGCCAAGCCCAGCCAGCCGGGAGAGGGCCTCAAAAAGCCCGTGCTCCCGGCCACTCCAAAGCCACAGTCCGCCAAGCCGTCG
GGGACCCCCATCAGCCCAGCCCCCGTTCCCTCCACGTTGCCATCAGCATCCTCGGCCCTGGCAGGGGACCAGCCGTCTTCCACCGCCTTC
ATCCCTCTCATATCAACCCGAGTGTCTCTTCGGAAAACCCGCCAGCCTCCAGAGCGGATCGCCAGCGGCGCCATCACCAAGGGCGTGGTC
CTGGACAGCACCGAGGCGCTGTGCCTCGCCATCTCTAGGAACTCCGAGCAGATGGCCAGCCACAGCGCAGTGCTGGAGGCCGGCAAAAAC
CTCTACACGTTCTGCGTGAGCTATGTGGATTCCATCCAGCAAATGAGGAACAAGTTTGCCTTCCGAGAGGCCATCAACAAACTGGAGAAT
AATCTCCGGGAGCTTCAGATCTGCCCGGCGACAGCAGGCAGTGGTCCAGCGGCCACTCAGGACTTCAGCAAGCTCCTCAGTTCGGTGAAG

>In-frame_NUP214_ENST00000451030_chr9_134027281_+_ABL1_ENST00000318560_chr9_133747516_+_5010nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAGGACACCATGGAGGTGGAAGAGTTCTTGAAAGAAGCTGCAGTCATGAAAGAGATCAAACACCCTAACCTGGTGCAGCTC
CTTGGGGTCTGCACCCGGGAGCCCCCGTTCTATATCATCACTGAGTTCATGACCTACGGGAACCTCCTGGACTACCTGAGGGAGTGCAAC
CGGCAGGAGGTGAACGCCGTGGTGCTGCTGTACATGGCCACTCAGATCTCGTCAGCCATGGAGTACCTGGAGAAGAAAAACTTCATCCAC
AGAGATCTTGCTGCCCGAAACTGCCTGGTAGGGGAGAACCACTTGGTGAAGGTAGCTGATTTTGGCCTGAGCAGGTTGATGACAGGGGAC
ACCTACACAGCCCATGCTGGAGCCAAGTTCCCCATCAAATGGACTGCACCCGAGAGCCTGGCCTACAACAAGTTCTCCATCAAGTCCGAC
GTCTGGGCATTTGGAGTATTGCTTTGGGAAATTGCTACCTATGGCATGTCCCCTTACCCGGGAATTGACCTGTCCCAGGTGTATGAGCTG
CTAGAGAAGGACTACCGCATGGAGCGCCCAGAAGGCTGCCCAGAGAAGGTCTATGAACTCATGCGAGCATGTTGGCAGTGGAATCCCTCT
GACCGGCCCTCCTTTGCTGAAATCCACCAAGCCTTTGAAACAATGTTCCAGGAATCCAGTATCTCAGACGAAGTGGAAAAGGAGCTGGGG
AAACAAGGCGTCCGTGGGGCTGTGAGTACCTTGCTGCAGGCCCCAGAGCTGCCCACCAAGACGAGGACCTCCAGGAGAGCTGCAGAGCAC
AGAGACACCACTGACGTGCCTGAGATGCCTCACTCCAAGGGCCAGGGAGAGAGCGATCCTCTGGACCATGAGCCTGCCGTGTCTCCATTG
CTCCCTCGAAAAGAGCGAGGTCCCCCGGAGGGCGGCCTGAATGAAGATGAGCGCCTTCTCCCCAAAGACAAAAAGACCAACTTGTTCAGC
GCCTTGATCAAGAAGAAGAAGAAGACAGCCCCAACCCCTCCCAAACGCAGCAGCTCCTTCCGGGAGATGGACGGCCAGCCGGAGCGCAGA
GGGGCCGGCGAGGAAGAGGGCCGAGACATCAGCAACGGGGCACTGGCTTTCACCCCCTTGGACACAGCTGACCCAGCCAAGTCCCCAAAG
CCCAGCAATGGGGCTGGGGTCCCCAATGGAGCCCTCCGGGAGTCCGGGGGCTCAGGCTTCCGGTCTCCCCACCTGTGGAAGAAGTCCAGC
ACGCTGACCAGCAGCCGCCTAGCCACCGGCGAGGAGGAGGGCGGTGGCAGCTCCAGCAAGCGCTTCCTGCGCTCTTGCTCCGCCTCCTGC
GTTCCCCATGGGGCCAAGGACACGGAGTGGAGGTCAGTCACGCTGCCTCGGGACTTGCAGTCCACGGGAAGACAGTTTGACTCGTCCACA
TTTGGAGGGCACAAAAGTGAGAAGCCGGCTCTGCCTCGGAAGAGGGCAGGGGAGAACAGGTCTGACCAGGTGACCCGAGGCACAGTAACG
CCTCCCCCCAGGCTGGTGAAAAAGAATGAGGAAGCTGCTGATGAGGTCTTCAAAGACATCATGGAGTCCAGCCCGGGCTCCAGCCCGCCC
AACCTGACTCCAAAACCCCTCCGGCGGCAGGTCACCGTGGCCCCTGCCTCGGGCCTCCCCCACAAGGAAGAAGCTGGAAAGGGCAGTGCC
TTAGGGACCCCTGCTGCAGCTGAGCCAGTGACCCCCACCAGCAAAGCAGGCTCAGGTGCACCAGGGGGCACCAGCAAGGGCCCCGCCGAG
GAGTCCAGAGTGAGGAGGCACAAGCACTCCTCTGAGTCGCCAGGGAGGGACAAGGGGAAATTGTCCAGGCTCAAACCTGCCCCGCCGCCC
CCACCAGCAGCCTCTGCAGGGAAGGCTGGAGGAAAGCCCTCGCAGAGCCCGAGCCAGGAGGCGGCCGGGGAGGCAGTCCTGGGCGCAAAG
ACAAAAGCCACGAGTCTGGTTGATGCTGTGAACAGTGACGCTGCCAAGCCCAGCCAGCCGGGAGAGGGCCTCAAAAAGCCCGTGCTCCCG
GCCACTCCAAAGCCACAGTCCGCCAAGCCGTCGGGGACCCCCATCAGCCCAGCCCCCGTTCCCTCCACGTTGCCATCAGCATCCTCGGCC
CTGGCAGGGGACCAGCCGTCTTCCACCGCCTTCATCCCTCTCATATCAACCCGAGTGTCTCTTCGGAAAACCCGCCAGCCTCCAGAGCGG
ATCGCCAGCGGCGCCATCACCAAGGGCGTGGTCCTGGACAGCACCGAGGCGCTGTGCCTCGCCATCTCTAGGAACTCCGAGCAGATGGCC
AGCCACAGCGCAGTGCTGGAGGCCGGCAAAAACCTCTACACGTTCTGCGTGAGCTATGTGGATTCCATCCAGCAAATGAGGAACAAGTTT
GCCTTCCGAGAGGCCATCAACAAACTGGAGAATAATCTCCGGGAGCTTCAGATCTGCCCGGCGACAGCAGGCAGTGGTCCAGCGGCCACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NUP214_ENST00000359428_chr9_134027281_+_ABL1_ENST00000318560_chr9_133747516_+_7143nt
CGTCACCAAAGCGCGCCGGAAATGCGAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGT
GGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGG
GAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTT
GCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAA
CCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGT
GATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCT
AAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCC
TCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACG
GTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACT
TTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTAC
GTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAG
CACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAA
TGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTA
CTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAA
GTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTAT
ATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGA
AGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCA
CCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCT
GCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTT
GTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGT
TTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCT
GTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTC
TCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCA
GTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCA
GCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTA
ATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGC
ACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCAT
GGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCT
GGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAGGACACCATGGAGGTGGAAGAGTTCTTG
AAAGAAGCTGCAGTCATGAAAGAGATCAAACACCCTAACCTGGTGCAGCTCCTTGGGGTCTGCACCCGGGAGCCCCCGTTCTATATCATC
ACTGAGTTCATGACCTACGGGAACCTCCTGGACTACCTGAGGGAGTGCAACCGGCAGGAGGTGAACGCCGTGGTGCTGCTGTACATGGCC
ACTCAGATCTCGTCAGCCATGGAGTACCTGGAGAAGAAAAACTTCATCCACAGAGATCTTGCTGCCCGAAACTGCCTGGTAGGGGAGAAC
CACTTGGTGAAGGTAGCTGATTTTGGCCTGAGCAGGTTGATGACAGGGGACACCTACACAGCCCATGCTGGAGCCAAGTTCCCCATCAAA
TGGACTGCACCCGAGAGCCTGGCCTACAACAAGTTCTCCATCAAGTCCGACGTCTGGGCATTTGGAGTATTGCTTTGGGAAATTGCTACC
TATGGCATGTCCCCTTACCCGGGAATTGACCTGTCCCAGGTGTATGAGCTGCTAGAGAAGGACTACCGCATGGAGCGCCCAGAAGGCTGC
CCAGAGAAGGTCTATGAACTCATGCGAGCATGTTGGCAGTGGAATCCCTCTGACCGGCCCTCCTTTGCTGAAATCCACCAAGCCTTTGAA
ACAATGTTCCAGGAATCCAGTATCTCAGACGAAGTGGAAAAGGAGCTGGGGAAACAAGGCGTCCGTGGGGCTGTGAGTACCTTGCTGCAG
GCCCCAGAGCTGCCCACCAAGACGAGGACCTCCAGGAGAGCTGCAGAGCACAGAGACACCACTGACGTGCCTGAGATGCCTCACTCCAAG
GGCCAGGGAGAGAGCGATCCTCTGGACCATGAGCCTGCCGTGTCTCCATTGCTCCCTCGAAAAGAGCGAGGTCCCCCGGAGGGCGGCCTG
AATGAAGATGAGCGCCTTCTCCCCAAAGACAAAAAGACCAACTTGTTCAGCGCCTTGATCAAGAAGAAGAAGAAGACAGCCCCAACCCCT
CCCAAACGCAGCAGCTCCTTCCGGGAGATGGACGGCCAGCCGGAGCGCAGAGGGGCCGGCGAGGAAGAGGGCCGAGACATCAGCAACGGG
GCACTGGCTTTCACCCCCTTGGACACAGCTGACCCAGCCAAGTCCCCAAAGCCCAGCAATGGGGCTGGGGTCCCCAATGGAGCCCTCCGG
GAGTCCGGGGGCTCAGGCTTCCGGTCTCCCCACCTGTGGAAGAAGTCCAGCACGCTGACCAGCAGCCGCCTAGCCACCGGCGAGGAGGAG
GGCGGTGGCAGCTCCAGCAAGCGCTTCCTGCGCTCTTGCTCCGCCTCCTGCGTTCCCCATGGGGCCAAGGACACGGAGTGGAGGTCAGTC
ACGCTGCCTCGGGACTTGCAGTCCACGGGAAGACAGTTTGACTCGTCCACATTTGGAGGGCACAAAAGTGAGAAGCCGGCTCTGCCTCGG
AAGAGGGCAGGGGAGAACAGGTCTGACCAGGTGACCCGAGGCACAGTAACGCCTCCCCCCAGGCTGGTGAAAAAGAATGAGGAAGCTGCT
GATGAGGTCTTCAAAGACATCATGGAGTCCAGCCCGGGCTCCAGCCCGCCCAACCTGACTCCAAAACCCCTCCGGCGGCAGGTCACCGTG
GCCCCTGCCTCGGGCCTCCCCCACAAGGAAGAAGCTGGAAAGGGCAGTGCCTTAGGGACCCCTGCTGCAGCTGAGCCAGTGACCCCCACC
AGCAAAGCAGGCTCAGGTGCACCAGGGGGCACCAGCAAGGGCCCCGCCGAGGAGTCCAGAGTGAGGAGGCACAAGCACTCCTCTGAGTCG
CCAGGGAGGGACAAGGGGAAATTGTCCAGGCTCAAACCTGCCCCGCCGCCCCCACCAGCAGCCTCTGCAGGGAAGGCTGGAGGAAAGCCC
TCGCAGAGCCCGAGCCAGGAGGCGGCCGGGGAGGCAGTCCTGGGCGCAAAGACAAAAGCCACGAGTCTGGTTGATGCTGTGAACAGTGAC
GCTGCCAAGCCCAGCCAGCCGGGAGAGGGCCTCAAAAAGCCCGTGCTCCCGGCCACTCCAAAGCCACAGTCCGCCAAGCCGTCGGGGACC
CCCATCAGCCCAGCCCCCGTTCCCTCCACGTTGCCATCAGCATCCTCGGCCCTGGCAGGGGACCAGCCGTCTTCCACCGCCTTCATCCCT
CTCATATCAACCCGAGTGTCTCTTCGGAAAACCCGCCAGCCTCCAGAGCGGATCGCCAGCGGCGCCATCACCAAGGGCGTGGTCCTGGAC
AGCACCGAGGCGCTGTGCCTCGCCATCTCTAGGAACTCCGAGCAGATGGCCAGCCACAGCGCAGTGCTGGAGGCCGGCAAAAACCTCTAC
ACGTTCTGCGTGAGCTATGTGGATTCCATCCAGCAAATGAGGAACAAGTTTGCCTTCCGAGAGGCCATCAACAAACTGGAGAATAATCTC
CGGGAGCTTCAGATCTGCCCGGCGACAGCAGGCAGTGGTCCAGCGGCCACTCAGGACTTCAGCAAGCTCCTCAGTTCGGTGAAGGAAATC
AGTGACATAGTGCAGAGGTAGCAGCAGTCAGGGGTCAGGTGTCAGGCCCGTCGGAGCTGCCTGCAGCACATGCGGGCTCGCCCATACCCG
TGACAGTGGCTGACAAGGGACTAGTGAGTCAGCACCTTGGCCCAGGAGCTCTGCGCCAGGCAGAGCTGAGGGCCCTGTGGAGTCCAGCTC
TACTACCTACGTTTGCACCGCCTGCCCTCCCGCACCTTCCTCCTCCCCGCTCCGTCTCTGTCCTCGAATTTTATCTGTGGAGTTCCTGCT
CCGTGGACTGCAGTCGGCATGCCAGGACCCGCCAGCCCCGCTCCCACCTAGTGCCCCAGACTGAGCTCTCCAGGCCAGGTGGGAACGGCT
GATGTGGACTGTCTTTTTCATTTTTTTCTCTCTGGAGCCCCTCCTCCCCCGGCTGGGCCTCCTTCTTCCACTTCTCCAAGAATGGAAGCC
TGAACTGAGGCCTTGTGTGTCAGGCCCTCTGCCTGCACTCCCTGGCCTTGCCCGTCGTGTGCTGAAGACATGTTTCAAGAACCGCATTTC
GGGAAGGGCATGCACGGGCATGCACACGGCTGGTCACTCTGCCCTCTGCTGCTGCCCGGGGTGGGGTGCACTCGCCATTTCCTCACGTGC
AGGACAGCTCTTGATTTGGGTGGAAAACAGGGTGCTAAAGCCAACCAGCCTTTGGGTCCTGGGCAGGTGGGAGCTGAAAAGGATCGAGGC
ATGGGGCATGTCCTTTCCATCTGTCCACATCCCCAGAGCCCAGCTCTTGCTCTCTTGTGACGTGCACTGTGAATCCTGGCAAGAAAGCTT
GAGTCTCAAGGGTGGCAGGTCACTGTCACTGCCGACATCCCTCCCCCAGCAGAATGGAGGCAGGGGACAAGGGAGGCAGTGGCTAGTGGG
GTGAACAGCTGGTGCCAAATAGCCCCAGACTGGGCCCAGGCAGGTCTGCAAGGGCCCAGAGTGAACCGTCCTTTCACACATCTGGGTGCC
CTGAAAGGGCCCTTCCCCTCCCCCACTCCTCTAAGACAAAGTAGATTCTTACAAGGCCCTTTCCTTTGGAACAAGACAGCCTTCACTTTT
CTGAGTTCTTGAAGCATTTCAAAGCCCTGCCTCTGTGTAGCCGCCCTGAGAGAGAATAGAGCTGCCACTGGGCACCTGCGCACAGGTGGG
AGGAAAGGGCCTGGCCAGTCCTGGTCCTGGCTGCACTCTTGAACTGGGCGAATGTCTTATTTAATTACCGTGAGTGACATAGCCTCATGT
TCTGTGGGGGTCATCAGGGAGGGTTAGGAAAACCACAAACGGAGCCCCTGAAAGCCTCACGTATTTCACAGAGCACGCCTGCCATCTTCT
CCCCGAGGCTGCCCCAGGCCGGAGCCCAGATACGGGGGCTGTGACTCTGGGCAGGGACCCGGGGTCTCCTGGACCTTGACAGAGCAGCTA
ACTCCGAGAGCAGTGGGCAGGTGGCCGCCCCTGAGGCTTCACGCCGGGAGAAGCCACCTTCCCACCCCTTCATACCGCCTCGTGCCAGCA
GCCTCGCACAGGCCCTAGCTTTACGCTCATCACCTAAACTTGTACTTTATTTTTCTGATAGAAATGGTTTCCTCTGGATCGTTTTATGCG
GTTCTTACAGCACATCACCTCTTTGCCCCCGACGGCTGTGACGCAGCCGGAGGGAGGCACTAGTCACCGACAGCGGCCTTGAAGACAGAG
CAAAGCGCCCACCCAGGTCCCCCGACTGCCTGTCTCCATGAGGTACTGGTCCCTTCCTTTTGTTAACGTGATGTGCCACTATATTTTACA
CGTATCTCTTGGTATGCATCTTTTATAGACGCTCTTTTCTAAGTGGCGTGTGCATAGCGTCCTGCCCTGCCCCCTCGGGGGCCTGTGGTG
GCTCCCCCTCTGCTTCTCGGGGTCCAGTGCATTTTGTTTCTGTATATGATTCTCTGTGGTTTTTTTTGAATCCAAATCTGTCCTCTGTAG

>In-frame_NUP214_ENST00000411637_chr9_134027281_+_ABL1_ENST00000318560_chr9_133747516_+_7088nt
GAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTT
GGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAG
CGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGG
TCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAG
TTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCA
TGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCT
ATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTG
ATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGA
GCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTT
GTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTG
CAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTA
TGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTG
CGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAAT
TGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAA
AGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTA
AGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCT
CTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTT
CTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTT
CATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAG
CCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACAC
CAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATA
GCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCT
CAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAA
AGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAA
AAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTC
TTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGG
AAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGC
TTCAGGAGGACACCATGGAGGTGGAAGAGTTCTTGAAAGAAGCTGCAGTCATGAAAGAGATCAAACACCCTAACCTGGTGCAGCTCCTTG
GGGTCTGCACCCGGGAGCCCCCGTTCTATATCATCACTGAGTTCATGACCTACGGGAACCTCCTGGACTACCTGAGGGAGTGCAACCGGC
AGGAGGTGAACGCCGTGGTGCTGCTGTACATGGCCACTCAGATCTCGTCAGCCATGGAGTACCTGGAGAAGAAAAACTTCATCCACAGAG
ATCTTGCTGCCCGAAACTGCCTGGTAGGGGAGAACCACTTGGTGAAGGTAGCTGATTTTGGCCTGAGCAGGTTGATGACAGGGGACACCT
ACACAGCCCATGCTGGAGCCAAGTTCCCCATCAAATGGACTGCACCCGAGAGCCTGGCCTACAACAAGTTCTCCATCAAGTCCGACGTCT
GGGCATTTGGAGTATTGCTTTGGGAAATTGCTACCTATGGCATGTCCCCTTACCCGGGAATTGACCTGTCCCAGGTGTATGAGCTGCTAG
AGAAGGACTACCGCATGGAGCGCCCAGAAGGCTGCCCAGAGAAGGTCTATGAACTCATGCGAGCATGTTGGCAGTGGAATCCCTCTGACC
GGCCCTCCTTTGCTGAAATCCACCAAGCCTTTGAAACAATGTTCCAGGAATCCAGTATCTCAGACGAAGTGGAAAAGGAGCTGGGGAAAC
AAGGCGTCCGTGGGGCTGTGAGTACCTTGCTGCAGGCCCCAGAGCTGCCCACCAAGACGAGGACCTCCAGGAGAGCTGCAGAGCACAGAG
ACACCACTGACGTGCCTGAGATGCCTCACTCCAAGGGCCAGGGAGAGAGCGATCCTCTGGACCATGAGCCTGCCGTGTCTCCATTGCTCC
CTCGAAAAGAGCGAGGTCCCCCGGAGGGCGGCCTGAATGAAGATGAGCGCCTTCTCCCCAAAGACAAAAAGACCAACTTGTTCAGCGCCT
TGATCAAGAAGAAGAAGAAGACAGCCCCAACCCCTCCCAAACGCAGCAGCTCCTTCCGGGAGATGGACGGCCAGCCGGAGCGCAGAGGGG
CCGGCGAGGAAGAGGGCCGAGACATCAGCAACGGGGCACTGGCTTTCACCCCCTTGGACACAGCTGACCCAGCCAAGTCCCCAAAGCCCA
GCAATGGGGCTGGGGTCCCCAATGGAGCCCTCCGGGAGTCCGGGGGCTCAGGCTTCCGGTCTCCCCACCTGTGGAAGAAGTCCAGCACGC
TGACCAGCAGCCGCCTAGCCACCGGCGAGGAGGAGGGCGGTGGCAGCTCCAGCAAGCGCTTCCTGCGCTCTTGCTCCGCCTCCTGCGTTC
CCCATGGGGCCAAGGACACGGAGTGGAGGTCAGTCACGCTGCCTCGGGACTTGCAGTCCACGGGAAGACAGTTTGACTCGTCCACATTTG
GAGGGCACAAAAGTGAGAAGCCGGCTCTGCCTCGGAAGAGGGCAGGGGAGAACAGGTCTGACCAGGTGACCCGAGGCACAGTAACGCCTC
CCCCCAGGCTGGTGAAAAAGAATGAGGAAGCTGCTGATGAGGTCTTCAAAGACATCATGGAGTCCAGCCCGGGCTCCAGCCCGCCCAACC
TGACTCCAAAACCCCTCCGGCGGCAGGTCACCGTGGCCCCTGCCTCGGGCCTCCCCCACAAGGAAGAAGCTGGAAAGGGCAGTGCCTTAG
GGACCCCTGCTGCAGCTGAGCCAGTGACCCCCACCAGCAAAGCAGGCTCAGGTGCACCAGGGGGCACCAGCAAGGGCCCCGCCGAGGAGT
CCAGAGTGAGGAGGCACAAGCACTCCTCTGAGTCGCCAGGGAGGGACAAGGGGAAATTGTCCAGGCTCAAACCTGCCCCGCCGCCCCCAC
CAGCAGCCTCTGCAGGGAAGGCTGGAGGAAAGCCCTCGCAGAGCCCGAGCCAGGAGGCGGCCGGGGAGGCAGTCCTGGGCGCAAAGACAA
AAGCCACGAGTCTGGTTGATGCTGTGAACAGTGACGCTGCCAAGCCCAGCCAGCCGGGAGAGGGCCTCAAAAAGCCCGTGCTCCCGGCCA
CTCCAAAGCCACAGTCCGCCAAGCCGTCGGGGACCCCCATCAGCCCAGCCCCCGTTCCCTCCACGTTGCCATCAGCATCCTCGGCCCTGG
CAGGGGACCAGCCGTCTTCCACCGCCTTCATCCCTCTCATATCAACCCGAGTGTCTCTTCGGAAAACCCGCCAGCCTCCAGAGCGGATCG
CCAGCGGCGCCATCACCAAGGGCGTGGTCCTGGACAGCACCGAGGCGCTGTGCCTCGCCATCTCTAGGAACTCCGAGCAGATGGCCAGCC
ACAGCGCAGTGCTGGAGGCCGGCAAAAACCTCTACACGTTCTGCGTGAGCTATGTGGATTCCATCCAGCAAATGAGGAACAAGTTTGCCT
TCCGAGAGGCCATCAACAAACTGGAGAATAATCTCCGGGAGCTTCAGATCTGCCCGGCGACAGCAGGCAGTGGTCCAGCGGCCACTCAGG
ACTTCAGCAAGCTCCTCAGTTCGGTGAAGGAAATCAGTGACATAGTGCAGAGGTAGCAGCAGTCAGGGGTCAGGTGTCAGGCCCGTCGGA
GCTGCCTGCAGCACATGCGGGCTCGCCCATACCCGTGACAGTGGCTGACAAGGGACTAGTGAGTCAGCACCTTGGCCCAGGAGCTCTGCG
CCAGGCAGAGCTGAGGGCCCTGTGGAGTCCAGCTCTACTACCTACGTTTGCACCGCCTGCCCTCCCGCACCTTCCTCCTCCCCGCTCCGT
CTCTGTCCTCGAATTTTATCTGTGGAGTTCCTGCTCCGTGGACTGCAGTCGGCATGCCAGGACCCGCCAGCCCCGCTCCCACCTAGTGCC
CCAGACTGAGCTCTCCAGGCCAGGTGGGAACGGCTGATGTGGACTGTCTTTTTCATTTTTTTCTCTCTGGAGCCCCTCCTCCCCCGGCTG
GGCCTCCTTCTTCCACTTCTCCAAGAATGGAAGCCTGAACTGAGGCCTTGTGTGTCAGGCCCTCTGCCTGCACTCCCTGGCCTTGCCCGT
CGTGTGCTGAAGACATGTTTCAAGAACCGCATTTCGGGAAGGGCATGCACGGGCATGCACACGGCTGGTCACTCTGCCCTCTGCTGCTGC
CCGGGGTGGGGTGCACTCGCCATTTCCTCACGTGCAGGACAGCTCTTGATTTGGGTGGAAAACAGGGTGCTAAAGCCAACCAGCCTTTGG
GTCCTGGGCAGGTGGGAGCTGAAAAGGATCGAGGCATGGGGCATGTCCTTTCCATCTGTCCACATCCCCAGAGCCCAGCTCTTGCTCTCT
TGTGACGTGCACTGTGAATCCTGGCAAGAAAGCTTGAGTCTCAAGGGTGGCAGGTCACTGTCACTGCCGACATCCCTCCCCCAGCAGAAT
GGAGGCAGGGGACAAGGGAGGCAGTGGCTAGTGGGGTGAACAGCTGGTGCCAAATAGCCCCAGACTGGGCCCAGGCAGGTCTGCAAGGGC
CCAGAGTGAACCGTCCTTTCACACATCTGGGTGCCCTGAAAGGGCCCTTCCCCTCCCCCACTCCTCTAAGACAAAGTAGATTCTTACAAG
GCCCTTTCCTTTGGAACAAGACAGCCTTCACTTTTCTGAGTTCTTGAAGCATTTCAAAGCCCTGCCTCTGTGTAGCCGCCCTGAGAGAGA
ATAGAGCTGCCACTGGGCACCTGCGCACAGGTGGGAGGAAAGGGCCTGGCCAGTCCTGGTCCTGGCTGCACTCTTGAACTGGGCGAATGT
CTTATTTAATTACCGTGAGTGACATAGCCTCATGTTCTGTGGGGGTCATCAGGGAGGGTTAGGAAAACCACAAACGGAGCCCCTGAAAGC
CTCACGTATTTCACAGAGCACGCCTGCCATCTTCTCCCCGAGGCTGCCCCAGGCCGGAGCCCAGATACGGGGGCTGTGACTCTGGGCAGG
GACCCGGGGTCTCCTGGACCTTGACAGAGCAGCTAACTCCGAGAGCAGTGGGCAGGTGGCCGCCCCTGAGGCTTCACGCCGGGAGAAGCC
ACCTTCCCACCCCTTCATACCGCCTCGTGCCAGCAGCCTCGCACAGGCCCTAGCTTTACGCTCATCACCTAAACTTGTACTTTATTTTTC
TGATAGAAATGGTTTCCTCTGGATCGTTTTATGCGGTTCTTACAGCACATCACCTCTTTGCCCCCGACGGCTGTGACGCAGCCGGAGGGA
GGCACTAGTCACCGACAGCGGCCTTGAAGACAGAGCAAAGCGCCCACCCAGGTCCCCCGACTGCCTGTCTCCATGAGGTACTGGTCCCTT
CCTTTTGTTAACGTGATGTGCCACTATATTTTACACGTATCTCTTGGTATGCATCTTTTATAGACGCTCTTTTCTAAGTGGCGTGTGCAT
AGCGTCCTGCCCTGCCCCCTCGGGGGCCTGTGGTGGCTCCCCCTCTGCTTCTCGGGGTCCAGTGCATTTTGTTTCTGTATATGATTCTCT

>In-frame_NUP214_ENST00000451030_chr9_134027281_+_ABL1_ENST00000318560_chr9_133747516_+_7113nt
CTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTT
CGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAG
AAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCT
GGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAA
GTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCC
AGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAG
CTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGT
ATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAA
GGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCG
TTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGG
ACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCC
TGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCA
ACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTG
ACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTT
CCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTC
ATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCC
CCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTT
CCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCC
AGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACC
CCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCA
AGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCT
GCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCA
CTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCT
CAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAG
TCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACAC
TTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACA
GAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTA
CTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCA
CTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAGGACACCATGGAGGTGGAAGAGTTCTTGAAAGAAGCTGCAGTCATGAAAGAGATCAAA
CACCCTAACCTGGTGCAGCTCCTTGGGGTCTGCACCCGGGAGCCCCCGTTCTATATCATCACTGAGTTCATGACCTACGGGAACCTCCTG
GACTACCTGAGGGAGTGCAACCGGCAGGAGGTGAACGCCGTGGTGCTGCTGTACATGGCCACTCAGATCTCGTCAGCCATGGAGTACCTG
GAGAAGAAAAACTTCATCCACAGAGATCTTGCTGCCCGAAACTGCCTGGTAGGGGAGAACCACTTGGTGAAGGTAGCTGATTTTGGCCTG
AGCAGGTTGATGACAGGGGACACCTACACAGCCCATGCTGGAGCCAAGTTCCCCATCAAATGGACTGCACCCGAGAGCCTGGCCTACAAC
AAGTTCTCCATCAAGTCCGACGTCTGGGCATTTGGAGTATTGCTTTGGGAAATTGCTACCTATGGCATGTCCCCTTACCCGGGAATTGAC
CTGTCCCAGGTGTATGAGCTGCTAGAGAAGGACTACCGCATGGAGCGCCCAGAAGGCTGCCCAGAGAAGGTCTATGAACTCATGCGAGCA
TGTTGGCAGTGGAATCCCTCTGACCGGCCCTCCTTTGCTGAAATCCACCAAGCCTTTGAAACAATGTTCCAGGAATCCAGTATCTCAGAC
GAAGTGGAAAAGGAGCTGGGGAAACAAGGCGTCCGTGGGGCTGTGAGTACCTTGCTGCAGGCCCCAGAGCTGCCCACCAAGACGAGGACC
TCCAGGAGAGCTGCAGAGCACAGAGACACCACTGACGTGCCTGAGATGCCTCACTCCAAGGGCCAGGGAGAGAGCGATCCTCTGGACCAT
GAGCCTGCCGTGTCTCCATTGCTCCCTCGAAAAGAGCGAGGTCCCCCGGAGGGCGGCCTGAATGAAGATGAGCGCCTTCTCCCCAAAGAC
AAAAAGACCAACTTGTTCAGCGCCTTGATCAAGAAGAAGAAGAAGACAGCCCCAACCCCTCCCAAACGCAGCAGCTCCTTCCGGGAGATG
GACGGCCAGCCGGAGCGCAGAGGGGCCGGCGAGGAAGAGGGCCGAGACATCAGCAACGGGGCACTGGCTTTCACCCCCTTGGACACAGCT
GACCCAGCCAAGTCCCCAAAGCCCAGCAATGGGGCTGGGGTCCCCAATGGAGCCCTCCGGGAGTCCGGGGGCTCAGGCTTCCGGTCTCCC
CACCTGTGGAAGAAGTCCAGCACGCTGACCAGCAGCCGCCTAGCCACCGGCGAGGAGGAGGGCGGTGGCAGCTCCAGCAAGCGCTTCCTG
CGCTCTTGCTCCGCCTCCTGCGTTCCCCATGGGGCCAAGGACACGGAGTGGAGGTCAGTCACGCTGCCTCGGGACTTGCAGTCCACGGGA
AGACAGTTTGACTCGTCCACATTTGGAGGGCACAAAAGTGAGAAGCCGGCTCTGCCTCGGAAGAGGGCAGGGGAGAACAGGTCTGACCAG
GTGACCCGAGGCACAGTAACGCCTCCCCCCAGGCTGGTGAAAAAGAATGAGGAAGCTGCTGATGAGGTCTTCAAAGACATCATGGAGTCC
AGCCCGGGCTCCAGCCCGCCCAACCTGACTCCAAAACCCCTCCGGCGGCAGGTCACCGTGGCCCCTGCCTCGGGCCTCCCCCACAAGGAA
GAAGCTGGAAAGGGCAGTGCCTTAGGGACCCCTGCTGCAGCTGAGCCAGTGACCCCCACCAGCAAAGCAGGCTCAGGTGCACCAGGGGGC
ACCAGCAAGGGCCCCGCCGAGGAGTCCAGAGTGAGGAGGCACAAGCACTCCTCTGAGTCGCCAGGGAGGGACAAGGGGAAATTGTCCAGG
CTCAAACCTGCCCCGCCGCCCCCACCAGCAGCCTCTGCAGGGAAGGCTGGAGGAAAGCCCTCGCAGAGCCCGAGCCAGGAGGCGGCCGGG
GAGGCAGTCCTGGGCGCAAAGACAAAAGCCACGAGTCTGGTTGATGCTGTGAACAGTGACGCTGCCAAGCCCAGCCAGCCGGGAGAGGGC
CTCAAAAAGCCCGTGCTCCCGGCCACTCCAAAGCCACAGTCCGCCAAGCCGTCGGGGACCCCCATCAGCCCAGCCCCCGTTCCCTCCACG
TTGCCATCAGCATCCTCGGCCCTGGCAGGGGACCAGCCGTCTTCCACCGCCTTCATCCCTCTCATATCAACCCGAGTGTCTCTTCGGAAA
ACCCGCCAGCCTCCAGAGCGGATCGCCAGCGGCGCCATCACCAAGGGCGTGGTCCTGGACAGCACCGAGGCGCTGTGCCTCGCCATCTCT
AGGAACTCCGAGCAGATGGCCAGCCACAGCGCAGTGCTGGAGGCCGGCAAAAACCTCTACACGTTCTGCGTGAGCTATGTGGATTCCATC
CAGCAAATGAGGAACAAGTTTGCCTTCCGAGAGGCCATCAACAAACTGGAGAATAATCTCCGGGAGCTTCAGATCTGCCCGGCGACAGCA
GGCAGTGGTCCAGCGGCCACTCAGGACTTCAGCAAGCTCCTCAGTTCGGTGAAGGAAATCAGTGACATAGTGCAGAGGTAGCAGCAGTCA
GGGGTCAGGTGTCAGGCCCGTCGGAGCTGCCTGCAGCACATGCGGGCTCGCCCATACCCGTGACAGTGGCTGACAAGGGACTAGTGAGTC
AGCACCTTGGCCCAGGAGCTCTGCGCCAGGCAGAGCTGAGGGCCCTGTGGAGTCCAGCTCTACTACCTACGTTTGCACCGCCTGCCCTCC
CGCACCTTCCTCCTCCCCGCTCCGTCTCTGTCCTCGAATTTTATCTGTGGAGTTCCTGCTCCGTGGACTGCAGTCGGCATGCCAGGACCC
GCCAGCCCCGCTCCCACCTAGTGCCCCAGACTGAGCTCTCCAGGCCAGGTGGGAACGGCTGATGTGGACTGTCTTTTTCATTTTTTTCTC
TCTGGAGCCCCTCCTCCCCCGGCTGGGCCTCCTTCTTCCACTTCTCCAAGAATGGAAGCCTGAACTGAGGCCTTGTGTGTCAGGCCCTCT
GCCTGCACTCCCTGGCCTTGCCCGTCGTGTGCTGAAGACATGTTTCAAGAACCGCATTTCGGGAAGGGCATGCACGGGCATGCACACGGC
TGGTCACTCTGCCCTCTGCTGCTGCCCGGGGTGGGGTGCACTCGCCATTTCCTCACGTGCAGGACAGCTCTTGATTTGGGTGGAAAACAG
GGTGCTAAAGCCAACCAGCCTTTGGGTCCTGGGCAGGTGGGAGCTGAAAAGGATCGAGGCATGGGGCATGTCCTTTCCATCTGTCCACAT
CCCCAGAGCCCAGCTCTTGCTCTCTTGTGACGTGCACTGTGAATCCTGGCAAGAAAGCTTGAGTCTCAAGGGTGGCAGGTCACTGTCACT
GCCGACATCCCTCCCCCAGCAGAATGGAGGCAGGGGACAAGGGAGGCAGTGGCTAGTGGGGTGAACAGCTGGTGCCAAATAGCCCCAGAC
TGGGCCCAGGCAGGTCTGCAAGGGCCCAGAGTGAACCGTCCTTTCACACATCTGGGTGCCCTGAAAGGGCCCTTCCCCTCCCCCACTCCT
CTAAGACAAAGTAGATTCTTACAAGGCCCTTTCCTTTGGAACAAGACAGCCTTCACTTTTCTGAGTTCTTGAAGCATTTCAAAGCCCTGC
CTCTGTGTAGCCGCCCTGAGAGAGAATAGAGCTGCCACTGGGCACCTGCGCACAGGTGGGAGGAAAGGGCCTGGCCAGTCCTGGTCCTGG
CTGCACTCTTGAACTGGGCGAATGTCTTATTTAATTACCGTGAGTGACATAGCCTCATGTTCTGTGGGGGTCATCAGGGAGGGTTAGGAA
AACCACAAACGGAGCCCCTGAAAGCCTCACGTATTTCACAGAGCACGCCTGCCATCTTCTCCCCGAGGCTGCCCCAGGCCGGAGCCCAGA
TACGGGGGCTGTGACTCTGGGCAGGGACCCGGGGTCTCCTGGACCTTGACAGAGCAGCTAACTCCGAGAGCAGTGGGCAGGTGGCCGCCC
CTGAGGCTTCACGCCGGGAGAAGCCACCTTCCCACCCCTTCATACCGCCTCGTGCCAGCAGCCTCGCACAGGCCCTAGCTTTACGCTCAT
CACCTAAACTTGTACTTTATTTTTCTGATAGAAATGGTTTCCTCTGGATCGTTTTATGCGGTTCTTACAGCACATCACCTCTTTGCCCCC
GACGGCTGTGACGCAGCCGGAGGGAGGCACTAGTCACCGACAGCGGCCTTGAAGACAGAGCAAAGCGCCCACCCAGGTCCCCCGACTGCC
TGTCTCCATGAGGTACTGGTCCCTTCCTTTTGTTAACGTGATGTGCCACTATATTTTACACGTATCTCTTGGTATGCATCTTTTATAGAC
GCTCTTTTCTAAGTGGCGTGTGCATAGCGTCCTGCCCTGCCCCCTCGGGGGCCTGTGGTGGCTCCCCCTCTGCTTCTCGGGGTCCAGTGC
ATTTTGTTTCTGTATATGATTCTCTGTGGTTTTTTTTGAATCCAAATCTGTCCTCTGTAGTATTTTTTAAATAAATCAGTGTTTACATTA


Top

FusionGenePPI for NUP214_ABL1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NUP214ZFP36, XPO1, NUP107, NXF2, NXF1, XPO5, IPO5, G3BP1, G3BP2, RAE1, APC, HDAC4, HDAC5, HDAC9, NUP88, SMAD1, CLEC4G, SMAD2, SMAD3, SMAD4, SIRT7, RANBP2, CUL3, CUL2, NUPL2, NUP214, ACOT13, PNPT1, HSPA1L, VPS4B, S100A6, EEF1A1, STRIP1, RPL19, NDUFA7, ITGA4, SOX2, LMNA, FBXO6, CUL7, OBSL1, NUP62, CLEC11A, DDX19A, KCMF1, CFL1, CSRP1, DYNC1LI1, TRIM28, TXNDC9, NTRK1, IFI16, NUP85, NUP35, KPNB1, UBE2I, NUPL1, NUP153, SEH1L, C11orf30, CDH1, RAN, FXR2, EMILIN1, SERPINB2, BRCA1ABL1ATM, NTRK1, PTPN6, RB1, BRCA1, BCR, ABL1, PIK3R1, RAD51, ABI2, BCAR1, ATR, ABL2, CRKL, CREB1, JAK1, YTHDC1, GPX1, CAT, ABI1, TP53, SHC1, INPPL1, SOS1, SLC9A2, PRKDC, TP73, DOK1, ST5, ZAP70, RFX1, RAD9A, TERF1, HCK, GRB2, VAV1, MDM2, MTOR, ZDHHC16, SPTA1, SPTAN1, ARHGAP17, EVL, PSTPIP1, NEDD9, CABLES2, SORBS2, SH3BP1, CBL, TUB, GRB10, RYBP, PAK2, PAG1, RAN, NCK1, PLCG1, MICAL1, XRCC6, SORBS1, SHD, SHE, EPHB2, EPHA3, SRC, NCOA3, TOPBP1, HSP90AA1, HSPA4, NFKBIA, PARK2, STK4, NEDD4, BAG1, HSPA8, NEDD4L, PCNA, ANKRA2, YWHAQ, PSMA7, PSMA4, PSMD4, SH3KBP1, FGFR1OP, WRNIP1, JUN, GAB3, HUWE1, MDM4, DDB1, LRRK1, PIK3R2, AP2M1, UBASH3B, EPS15, CRK, AP2B1, BMP2K, REPS1, STON2, CBLB, AP2A1, WASF1, MAPT, PFDN4, PDE4D, PRDX1, EGFR, ERBB2, ERBB3, ERBB4, SOCS3, SOCS1, MUC1, YWHAB, YWHAE, YWHAG, YWHAH, YWHAZ, SFN, XPO1, RASA1, DOK2, CDKN1B, PTGES3, HSPD1, UBC, CTNNB1, SRPK2, PARP1, USP7, LATS2, SPRR2A, CASP9, YAP1, FOS, CDK1, GTF2F1, CCND2, ACTA1, STUB1, CDON, MBP, SPAG9, MSH5, MAVS, RAPGEF1, PRKCZ, BCL2L1, CKAP4, DDX5, DRG1, EEF1G, EIF2A, EWSR1, FUS, HNRNPM, HSPE1, ILF3, LRRC59, RPL37, RPLP1, RPS21, SUB1, SHB, RTFDC1, LARS, NAA25, NARS, PAK4, PPM1B, GRAP2, HIPK2, CDKN1A, RPS6KB1, RIN1, EMD, TMPO, TRIM25, ANAPC15, DVL2, PLEKHA4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NUP214_ABL1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneABL1P00519DB00619ImatinibTyrosine-protein kinase ABL1small moleculeapproved
TgeneABL1P00519DB06616BosutinibTyrosine-protein kinase ABL1small moleculeapproved
TgeneABL1P00519DB08896RegorafenibTyrosine-protein kinase ABL1small moleculeapproved
TgeneABL1P00519DB01254DasatinibTyrosine-protein kinase ABL1small moleculeapproved|investigational
TgeneABL1P00519DB04868NilotinibTyrosine-protein kinase ABL1small moleculeapproved|investigational
TgeneABL1P00519DB08901PonatinibTyrosine-protein kinase ABL1small moleculeapproved|investigational

Top

RelatedDiseases for NUP214_ABL1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneABL1C0023473Myeloid Leukemia, Chronic3CTD_human;ORPHANET
TgeneABL1C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human
TgeneABL1C0001418Adenocarcinoma1CTD_human
TgeneABL1C0014859Esophageal Neoplasms1CTD_human
TgeneABL1C0023903Liver neoplasms1CTD_human
TgeneABL1C0027659Neoplasms, Experimental1CTD_human
TgeneABL1C0032927Precancerous Conditions1CTD_human
TgeneABL1C0596263Carcinogenesis1CTD_human
TgeneABL1C1458155Mammary Neoplasms1CTD_human