FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25218

FusionGeneSummary for NUP210_MAST1

check button Fusion gene summary
Fusion gene informationFusion gene name: NUP210_MAST1
Fusion gene ID: 25218
HgeneTgene
Gene symbol

NUP210

MAST1

Gene ID

23225

23332

Gene namenucleoporin 210cytoplasmic linker associated protein 1
SynonymsGP210|POM210MAST1
Cytomap

3p25.1

2q14.2-q14.3

Type of geneprotein-codingprotein-coding
Descriptionnuclear pore membrane glycoprotein 210nuclear envelope pore membrane protein POM 210nuclear pore protein gp210nucleoporin 210kDanucleoporin Nup210pore membrane protein of 210 kDaCLIP-associating protein 1multiple asters 1multiple asters homolog 1protein Orbit homolog 1
Modification date2018052320180522
UniProtAcc

Q8TEM1

Q9Y2H9

Ensembl transtripts involved in fusion geneENST00000254508, ENST00000485755, 
ENST00000251472, ENST00000591495, 
Fusion gene scores* DoF score4 X 4 X 3=485 X 5 X 5=125
# samples 66
** MAII scorelog2(6/48*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/125*10)=-1.05889368905357
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NUP210 [Title/Abstract] AND MAST1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMAST1

GO:0051294

establishment of spindle orientation

21822276

TgeneMAST1

GO:0051301

cell division

21822276


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCSTCGA-N5-A4RA-01ANUP210chr3

13418956

-MAST1chr19

12962748

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000254508ENST00000251472NUP210chr3

13418956

-MAST1chr19

12962748

+
In-frameENST00000254508ENST00000591495NUP210chr3

13418956

-MAST1chr19

12962748

+
intron-3CDSENST00000485755ENST00000251472NUP210chr3

13418956

-MAST1chr19

12962748

+
intron-3CDSENST00000485755ENST00000591495NUP210chr3

13418956

-MAST1chr19

12962748

+

Top

FusionProtFeatures for NUP210_MAST1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NUP210

Q8TEM1

MAST1

Q9Y2H9

Nucleoporin essential for nuclear pore assembly andfusion, nuclear pore spacing, as well as structural integrity.{ECO:0000269|PubMed:14517331}. Appears to link the dystrophin/utrophin network withmicrotubule filaments via the syntrophins. Phosphorylation of DMDor UTRN may modulate their affinities for associated proteins (Bysimilarity). {ECO:0000250|UniProtKB:Q9R1L5}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMAST1chr3:13418956chr19:12962748ENST00000251472+626374_6472581571DomainProtein kinase
TgeneMAST1chr3:13418956chr19:12962748ENST00000251472+626648_7192581571DomainNote=AGC-kinase C-terminal
TgeneMAST1chr3:13418956chr19:12962748ENST00000251472+626967_10552581571DomainPDZ
TgeneMAST1chr3:13418956chr19:12962748ENST00000251472+626380_3882581571Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNUP210chr3:13418956chr19:12962748ENST00000254508-940486_4913841888Compositional biasNote=Poly-Ser
HgeneNUP210chr3:13418956chr19:12962748ENST00000254508-9401830_18873841888Topological domainCytoplasmic
HgeneNUP210chr3:13418956chr19:12962748ENST00000254508-94027_18083841888Topological domainLumenal
HgeneNUP210chr3:13418956chr19:12962748ENST00000254508-9401809_18293841888TransmembraneHelical


Top

FusionGeneSequence for NUP210_MAST1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NUP210_ENST00000254508_chr3_13418956_-_MAST1_ENST00000251472_chr19_12962748_+_1697aa
MAARGRGLLLLTLSVLLAAGPSAAAAKLNIPKVLLPFTRATRVNFTLEASEGCYRWLSTRPEVASIEPLGLDEQQCSQKAVVQARLTQPA
RLTSIIFAEDITTGQVLRCDAIVDLIHDIQIVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFEWTIVKDSEADRFSDSHNALRIL
TFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLILENILLNPAYDVYLMVGTSIHYKVQKIRQGK
ITELSMPSDQYELQLQNSIPGPEGDPARPVAVLAQDTSMVTALQLGQSSLVLGHRSIRMQGASRLPNSTIYVVEPGYLGFTVHPGDRWVL
ETGRLYEITIEVFDKFSNKVYVSDAYERSESLEVAFVTQLVKKLLIIISRPARLLECLEFNPEEFYHLLEAAEGHAKEGHLVKTDIPRYI
IRQLGLTRDPFPDVVHLEEQDSGGSNTPEQDDLSEGRSSKAKKPPGENDFDTIKLISNGAYGAVYLVRHRDTRQRFAMKKINKQNLILRN
QIQQAFVERDILTFAENPFVVGMFCSFETRRHLCMVMEYVEGGDCATLLKNIGALPVEMARMYFAETVLALEYLHNYGIVHRDLKPDNLL
ITSMGHIKLTDFGLSKMGLMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEE
LFGQVISDDILWPEGDEALPTEAQLLISSLLQTNPLVRLGAGGAFEVKQHSFFRDLDWTGLLRQKAEFIPHLESEDDTSYFDTRSDRYHH
VNSYDEDDTTEEEPVEIRQFSSCSPRFSKVYSSMEQLSQHEPKTPVAAAGSSKREPSTKGPEEKVAGKREGLGGLTLREKTWRGGSPEIK
RFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDEARLRRPPRPSSDPAGSLDARAPKEETQGEGTSSAGDSEATDRPRPGDL
CPPSKDGDASGPRATNDLVLRRARHQQMSGDVAVEKRPSRTGGKVIKSASATALSVMIPAVDPHGSSPLASPMSPRSLSSNPSSRDSSPS
RDYSPAVSGLRSPITIQRSGKKYGFTLRAIRVYMGDTDVYSVHHIVWHVEEGGPAQEAGLCAGDLITHVNGEPVHGMVHPEVVELILKSG
NKVAVTTTPFENTSIRIGPARRSSYKAKMARRNKRPSAKEGQESKKRSSLFRKITKQSNLLHTSRSLSSLNRSLSSSDSLPGSPTHGLPA
RSPTHSYRSTPDSAYLGASSQSSSPASSTPNSPASSASHHIRPSTLHGLSPKLHRQYRSARCKSAGNIPLSPLAHTPSPTQASPPPLPGH
TVGSSHTTQSFPAKLHSSPPVVRPRPKSAEPPRSPLLKRVQSAEKLGASLSADKKGALRKHSLEVGHPDFRKDFHGELALHSLAESDGET
PPVEGLGAPRQVAVRRLGRQESPLSLGADPLLPEGASRPPVSSKEKESPGGAEACTPPRATTPGGRTLERDVGCTRHQSVQTEDGTGGMA
RAVAKAALSPVQEHETGRRSSSGEAGTPLVPIVVEPARPGAKAVVPQPLGADSKGLQEPAPLAPSVPEAPRGRERWVLEVVEERTTLSGP

>In-frame_NUP210_ENST00000254508_chr3_13418956_-_MAST1_ENST00000591495_chr19_12962748_+_606aa
MAARGRGLLLLTLSVLLAAGPSAAAAKLNIPKVLLPFTRATRVNFTLEASEGCYRWLSTRPEVASIEPLGLDEQQCSQKAVVQARLTQPA
RLTSIIFAEDITTGQVLRCDAIVDLIHDIQIVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFEWTIVKDSEADRFSDSHNALRIL
TFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLILENILLNPAYDVYLMVGTSIHYKVQKIRQGK
ITELSMPSDQYELQLQNSIPGPEGDPARPVAVLAQDTSMVTALQLGQSSLVLGHRSIRMQGASRLPNSTIYVVEPGYLGFTVHPGDRWVL
ETGRLYEITIEVFDKFSNKVYVSDAYERSESLEVAFVTQLVKKLLIIISRPARLLECLEFNPEEFYHLLEAAEGHAKEGHLVKTDIPRYI
IRQLGLTRDPFPDVVHLEEQDSGGSNTPEQDDLSEGRSSKAKKPPGENDFDTIKLISNGAYGAVYLVRHRDTRQRFAMKKINKQNLILRN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NUP210_ENST00000254508_chr3_13418956_-_MAST1_ENST00000251472_chr19_12962748_+_5091nt
ATGGCGGCGCGGGGCCGGGGGCTGCTGCTGCTGACGCTGTCGGTGCTGTTGGCGGCGGGCCCCTCCGCCGCTGCGGCCAAGCTCAACATC
CCCAAAGTGCTGCTGCCCTTCACGCGGGCCACGCGCGTTAACTTCACGCTGGAGGCCTCGGAGGGCTGCTACCGCTGGTTGTCCACCCGG
CCGGAGGTGGCCAGCATCGAGCCGCTGGGCCTGGACGAGCAGCAGTGCTCCCAGAAGGCAGTGGTGCAGGCCCGCCTGACCCAGCCTGCC
CGCCTCACCAGCATCATCTTCGCAGAGGACATCACCACAGGCCAGGTCCTGCGCTGTGATGCCATTGTGGACCTCATCCATGACATCCAG
ATCGTCTCCACCACCCGCGAGCTCTACCTGGAGGACTCCCCCCTGGAGCTGAAGATCCAGGCCCTGGACTCCGAAGGGAACACCTTCAGC
ACTCTGGCTGGACTGGTCTTCGAGTGGACGATTGTGAAGGACTCCGAGGCGGACAGGTTCTCAGACTCCCACAATGCGCTGCGAATCCTC
ACTTTCTTGGAGTCTACGTACATCCCTCCTTCTTACATCTCAGAGATGGAGAAGGCTGCCAAGCAAGGGGACACCATCCTGGTGTCTGGG
ATGAAGACCGGGAGCTCCAAGCTCAAGGCTCGCATCCAGGAGGCTGTCTACAAGAATGTACGCCCTGCAGAAGTCAGGCTGCTGATTTTG
GAAAACATCCTTCTGAACCCGGCCTATGACGTCTACCTGATGGTGGGAACCTCCATTCACTACAAGGTGCAGAAGATCAGGCAAGGGAAA
ATTACAGAACTCTCCATGCCTTCCGATCAGTACGAGTTGCAGCTTCAGAACAGCATCCCGGGCCCCGAAGGAGACCCAGCCCGGCCGGTG
GCTGTCTTGGCCCAGGACACGTCGATGGTCACTGCACTGCAGCTGGGACAGAGCAGCCTCGTCCTTGGCCACAGGAGTATTCGCATGCAA
GGTGCTTCTAGGTTACCCAACAGCACTATCTACGTGGTCGAACCTGGATACCTAGGGTTCACTGTTCACCCTGGTGACAGGTGGGTGCTG
GAGACCGGCCGCCTGTATGAAATCACCATCGAAGTTTTTGACAAGTTCAGCAACAAGGTCTATGTATCTGACGCCTATGAACGCTCTGAG
AGCTTGGAGGTGGCCTTCGTTACTCAGCTGGTGAAGAAGTTGCTTATTATCATCTCACGCCCTGCGAGGCTGCTGGAGTGCCTGGAATTC
AACCCCGAGGAGTTCTACCACCTGCTGGAGGCGGCCGAAGGACACGCCAAGGAGGGCCACCTTGTGAAGACGGACATCCCCCGCTACATC
ATCCGCCAGCTGGGCCTCACCCGTGACCCCTTTCCAGATGTGGTGCATCTGGAGGAACAGGACAGTGGTGGTTCCAACACCCCTGAGCAA
GACGATCTCTCTGAGGGCCGCAGCAGCAAGGCCAAGAAACCGCCGGGGGAGAATGACTTCGATACCATCAAGCTCATAAGCAACGGTGCC
TACGGCGCTGTCTACCTGGTGCGGCACCGCGACACGCGGCAGCGCTTTGCCATGAAAAAGATCAACAAGCAGAACTTGATCCTCCGCAAC
CAGATCCAGCAGGCCTTTGTGGAGCGCGATATCCTCACCTTCGCCGAGAACCCGTTTGTGGTCGGCATGTTCTGCTCCTTTGAGACTCGG
CGCCACCTCTGCATGGTCATGGAATATGTGGAAGGCGGCGACTGTGCCACCCTGCTGAAGAATATTGGAGCGCTGCCCGTAGAGATGGCC
CGCATGTACTTTGCTGAGACGGTGCTAGCCCTGGAGTATTTGCACAACTATGGCATCGTGCACCGCGACCTCAAGCCTGACAACCTCCTT
ATCACCTCCATGGGTCACATCAAGCTCACAGATTTCGGCCTCTCCAAGATGGGGCTCATGAGCCTCACCACCAACTTATATGAAGGCCAC
ATCGAGAAGGACGCCCGAGAGTTCCTGGACAAACAGGTGTGTGGGACCCCAGAGTACATCGCGCCCGAGGTCATCCTGCGTCAAGGCTAC
GGCAAGCCAGTGGACTGGTGGGCTATGGGGATCATCCTCTACGAGTTCCTGGTGGGCTGTGTGCCCTTCTTCGGAGACACACCAGAGGAG
CTATTTGGACAGGTCATCAGTGATGACATCCTGTGGCCCGAGGGGGATGAGGCCCTACCTACGGAGGCCCAACTCCTCATATCCAGCCTC
CTGCAGACCAACCCTCTGGTCAGGCTTGGGGCAGGCGGCGCTTTTGAGGTGAAGCAGCACAGTTTCTTTCGAGACCTGGACTGGACAGGG
CTGCTGAGGCAGAAGGCCGAGTTCATCCCCCACCTAGAGTCGGAAGATGACACTAGCTACTTTGACACCCGCTCAGACAGGTATCACCAC
GTGAACTCCTATGACGAGGATGACACGACGGAGGAGGAGCCCGTGGAAATCCGCCAGTTCTCTTCCTGCTCTCCGCGCTTCAGCAAGGTG
TATAGCAGCATGGAGCAGCTGTCGCAGCACGAGCCCAAGACCCCAGTAGCAGCTGCAGGGAGCAGCAAGCGGGAGCCGAGCACCAAGGGC
CCCGAGGAGAAGGTGGCCGGCAAGCGGGAGGGGCTGGGCGGCCTGACCCTGCGTGAGAAGACCTGGAGAGGGGGCTCTCCGGAGATCAAG
CGATTCTCCGCGTCCGAGGCCAGTTTCCTGGAGGGAGAGGCCAGTCCCCCTTTGGGCGCCCGCCGCCGTTTCTCGGCGCTGCTGGAGCCC
AGCCGCTTCAGCGCCCCCCAAGAGGACGAGGATGAGGCCCGGCTGCGCAGGCCTCCCCGGCCCAGCTCCGACCCCGCGGGATCCCTGGAT
GCACGGGCCCCCAAAGAGGAGACTCAAGGGGAAGGCACCTCCAGCGCCGGGGACTCCGAGGCCACTGACCGTCCACGCCCAGGTGACCTC
TGCCCACCCTCGAAGGATGGGGATGCATCAGGCCCAAGGGCTACCAATGACTTGGTTCTGCGCCGGGCGCGGCACCAGCAGATGTCAGGG
GATGTGGCAGTAGAGAAGAGGCCTTCTCGAACTGGGGGCAAAGTCATCAAATCAGCCTCAGCCACTGCCTTATCTGTCATGATTCCTGCA
GTGGACCCACATGGAAGTTCACCCCTTGCTAGTCCCATGTCTCCACGATCTCTGTCCTCCAACCCATCCTCACGGGACTCCTCACCCAGC
CGGGACTACTCACCAGCTGTCAGTGGGCTCCGCTCCCCCATCACCATCCAGCGCTCGGGCAAGAAGTATGGCTTCACACTGCGTGCCATC
CGTGTCTACATGGGTGACACGGATGTCTATAGTGTCCACCACATTGTCTGGCATGTGGAGGAAGGAGGCCCAGCCCAGGAGGCAGGACTC
TGTGCTGGGGACCTCATCACCCACGTGAATGGGGAGCCTGTGCATGGCATGGTGCATCCTGAGGTCGTGGAGCTGATCCTTAAGAGTGGC
AACAAGGTAGCAGTGACCACAACGCCCTTCGAAAATACCTCTATCCGCATTGGTCCCGCAAGGCGCAGCAGCTACAAGGCTAAAATGGCT
CGGAGGAACAAGCGACCCTCCGCCAAGGAGGGCCAGGAGAGCAAGAAGCGCAGCTCCCTCTTCCGGAAGATCACGAAGCAGTCGAACCTG
CTGCATACTAGCCGCTCGCTGTCGTCGCTGAACCGCTCGCTGTCATCCAGCGATAGTCTCCCGGGCTCGCCTACGCACGGGCTGCCGGCG
CGCTCGCCCACGCACAGCTACCGCTCCACGCCTGACTCCGCCTACCTAGGCGCCTCATCCCAGAGCAGCTCCCCAGCCTCGAGCACGCCC
AACTCGCCTGCGTCGTCGGCGTCGCACCACATTCGGCCCAGCACGCTGCACGGACTGTCGCCAAAGCTCCATCGCCAGTACCGCTCTGCG
CGATGCAAGTCGGCCGGCAACATCCCTCTATCGCCGCTGGCACACACGCCGTCCCCCACGCAGGCGTCACCGCCGCCACTGCCGGGCCAC
ACGGTGGGCAGCTCGCACACTACTCAGAGCTTCCCGGCCAAACTGCACTCATCGCCTCCCGTCGTGCGCCCGCGCCCCAAGAGTGCCGAG
CCCCCTCGCTCGCCGCTCCTCAAGCGCGTGCAGTCGGCCGAGAAGCTGGGAGCCTCTTTGAGTGCGGACAAGAAGGGCGCGCTGCGCAAA
CACAGCCTCGAGGTGGGCCACCCGGATTTCCGCAAGGACTTCCATGGCGAGCTGGCGCTGCATAGCCTTGCCGAGTCCGACGGTGAGACG
CCCCCAGTCGAGGGCCTTGGCGCGCCCCGGCAGGTCGCCGTCCGCCGCCTGGGCCGACAGGAGTCACCTTTGAGCCTGGGCGCGGACCCG
TTGCTGCCCGAGGGTGCCTCCAGGCCACCAGTGTCGAGCAAGGAGAAGGAATCCCCGGGGGGCGCCGAGGCGTGCACCCCACCCCGCGCG
ACGACCCCCGGTGGCCGGACCCTGGAGCGGGACGTCGGCTGCACGCGGCATCAGAGCGTGCAGACGGAGGATGGCACTGGCGGGATGGCC
AGGGCTGTGGCCAAGGCGGCGCTGAGCCCGGTGCAGGAACACGAGACAGGCCGGCGCAGCAGCTCTGGCGAGGCGGGCACACCCCTGGTA
CCCATTGTCGTAGAGCCTGCGCGGCCCGGGGCTAAGGCTGTGGTGCCTCAGCCTCTGGGCGCGGACTCCAAGGGGTTGCAGGAACCCGCA
CCCCTGGCGCCTTCCGTGCCCGAGGCCCCCCGGGGCCGGGAGCGCTGGGTGTTGGAGGTGGTGGAGGAGCGCACCACGCTGAGCGGTCCT
CGCTCCAAGCCCGCCTCCCCAAAGCTCTCCCCGGAGCCCCAGACACCCTCCCTAGCCCCAGCGAAGTGCAGTGCACCCAGCAGTGCAGTG
ACCCCAGTCCCACCCGCATCCCTCTTGGGCTCAGGCACCAAGCCTCAAGTGGGGCTGACCTCCCGGTGCCCTGCTGAAGCTGTGCCCCCA

>In-frame_NUP210_ENST00000254508_chr3_13418956_-_MAST1_ENST00000591495_chr19_12962748_+_1818nt
ATGGCGGCGCGGGGCCGGGGGCTGCTGCTGCTGACGCTGTCGGTGCTGTTGGCGGCGGGCCCCTCCGCCGCTGCGGCCAAGCTCAACATC
CCCAAAGTGCTGCTGCCCTTCACGCGGGCCACGCGCGTTAACTTCACGCTGGAGGCCTCGGAGGGCTGCTACCGCTGGTTGTCCACCCGG
CCGGAGGTGGCCAGCATCGAGCCGCTGGGCCTGGACGAGCAGCAGTGCTCCCAGAAGGCAGTGGTGCAGGCCCGCCTGACCCAGCCTGCC
CGCCTCACCAGCATCATCTTCGCAGAGGACATCACCACAGGCCAGGTCCTGCGCTGTGATGCCATTGTGGACCTCATCCATGACATCCAG
ATCGTCTCCACCACCCGCGAGCTCTACCTGGAGGACTCCCCCCTGGAGCTGAAGATCCAGGCCCTGGACTCCGAAGGGAACACCTTCAGC
ACTCTGGCTGGACTGGTCTTCGAGTGGACGATTGTGAAGGACTCCGAGGCGGACAGGTTCTCAGACTCCCACAATGCGCTGCGAATCCTC
ACTTTCTTGGAGTCTACGTACATCCCTCCTTCTTACATCTCAGAGATGGAGAAGGCTGCCAAGCAAGGGGACACCATCCTGGTGTCTGGG
ATGAAGACCGGGAGCTCCAAGCTCAAGGCTCGCATCCAGGAGGCTGTCTACAAGAATGTACGCCCTGCAGAAGTCAGGCTGCTGATTTTG
GAAAACATCCTTCTGAACCCGGCCTATGACGTCTACCTGATGGTGGGAACCTCCATTCACTACAAGGTGCAGAAGATCAGGCAAGGGAAA
ATTACAGAACTCTCCATGCCTTCCGATCAGTACGAGTTGCAGCTTCAGAACAGCATCCCGGGCCCCGAAGGAGACCCAGCCCGGCCGGTG
GCTGTCTTGGCCCAGGACACGTCGATGGTCACTGCACTGCAGCTGGGACAGAGCAGCCTCGTCCTTGGCCACAGGAGTATTCGCATGCAA
GGTGCTTCTAGGTTACCCAACAGCACTATCTACGTGGTCGAACCTGGATACCTAGGGTTCACTGTTCACCCTGGTGACAGGTGGGTGCTG
GAGACCGGCCGCCTGTATGAAATCACCATCGAAGTTTTTGACAAGTTCAGCAACAAGGTCTATGTATCTGACGCCTATGAACGCTCTGAG
AGCTTGGAGGTGGCCTTCGTTACTCAGCTGGTGAAGAAGTTGCTTATTATCATCTCACGCCCTGCGAGGCTGCTGGAGTGCCTGGAATTC
AACCCCGAGGAGTTCTACCACCTGCTGGAGGCGGCCGAAGGACACGCCAAGGAGGGCCACCTTGTGAAGACGGACATCCCCCGCTACATC
ATCCGCCAGCTGGGCCTCACCCGTGACCCCTTTCCAGATGTGGTGCATCTGGAGGAACAGGACAGTGGTGGTTCCAACACCCCTGAGCAA
GACGATCTCTCTGAGGGCCGCAGCAGCAAGGCCAAGAAACCGCCGGGGGAGAATGACTTCGATACCATCAAGCTCATAAGCAACGGTGCC
TACGGCGCTGTCTACCTGGTGCGGCACCGCGACACGCGGCAGCGCTTTGCCATGAAAAAGATCAACAAGCAGAACTTGATCCTCCGCAAC
CAGATCCAGCAGGCCTTTGTGGAGCGCGATATCCTCACCTTCGCCGAGAACCCGTTTGTGGTCGGCATGTTCTGCTCCTTTGAGACTCGG
CGCCACCTCTGCATGGTCATGGAATATGTGGAAGGTGTGGCTGCCTGCGGGGCTGCAGGGAAGATGGGGCCGTGCTCACTGGTCAGGGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NUP210_ENST00000254508_chr3_13418956_-_MAST1_ENST00000251472_chr19_12962748_+_5255nt
GCGCGCGCGCGGGCGGGAGCGGAGGGCAACGGGGCGGCGCGGGCGGCCGGGCGCAGGGTCGCGGGAGGTGACGCGCGGCGAGGATGGCGG
CGCGGGGCCGGGGGCTGCTGCTGCTGACGCTGTCGGTGCTGTTGGCGGCGGGCCCCTCCGCCGCTGCGGCCAAGCTCAACATCCCCAAAG
TGCTGCTGCCCTTCACGCGGGCCACGCGCGTTAACTTCACGCTGGAGGCCTCGGAGGGCTGCTACCGCTGGTTGTCCACCCGGCCGGAGG
TGGCCAGCATCGAGCCGCTGGGCCTGGACGAGCAGCAGTGCTCCCAGAAGGCAGTGGTGCAGGCCCGCCTGACCCAGCCTGCCCGCCTCA
CCAGCATCATCTTCGCAGAGGACATCACCACAGGCCAGGTCCTGCGCTGTGATGCCATTGTGGACCTCATCCATGACATCCAGATCGTCT
CCACCACCCGCGAGCTCTACCTGGAGGACTCCCCCCTGGAGCTGAAGATCCAGGCCCTGGACTCCGAAGGGAACACCTTCAGCACTCTGG
CTGGACTGGTCTTCGAGTGGACGATTGTGAAGGACTCCGAGGCGGACAGGTTCTCAGACTCCCACAATGCGCTGCGAATCCTCACTTTCT
TGGAGTCTACGTACATCCCTCCTTCTTACATCTCAGAGATGGAGAAGGCTGCCAAGCAAGGGGACACCATCCTGGTGTCTGGGATGAAGA
CCGGGAGCTCCAAGCTCAAGGCTCGCATCCAGGAGGCTGTCTACAAGAATGTACGCCCTGCAGAAGTCAGGCTGCTGATTTTGGAAAACA
TCCTTCTGAACCCGGCCTATGACGTCTACCTGATGGTGGGAACCTCCATTCACTACAAGGTGCAGAAGATCAGGCAAGGGAAAATTACAG
AACTCTCCATGCCTTCCGATCAGTACGAGTTGCAGCTTCAGAACAGCATCCCGGGCCCCGAAGGAGACCCAGCCCGGCCGGTGGCTGTCT
TGGCCCAGGACACGTCGATGGTCACTGCACTGCAGCTGGGACAGAGCAGCCTCGTCCTTGGCCACAGGAGTATTCGCATGCAAGGTGCTT
CTAGGTTACCCAACAGCACTATCTACGTGGTCGAACCTGGATACCTAGGGTTCACTGTTCACCCTGGTGACAGGTGGGTGCTGGAGACCG
GCCGCCTGTATGAAATCACCATCGAAGTTTTTGACAAGTTCAGCAACAAGGTCTATGTATCTGACGCCTATGAACGCTCTGAGAGCTTGG
AGGTGGCCTTCGTTACTCAGCTGGTGAAGAAGTTGCTTATTATCATCTCACGCCCTGCGAGGCTGCTGGAGTGCCTGGAATTCAACCCCG
AGGAGTTCTACCACCTGCTGGAGGCGGCCGAAGGACACGCCAAGGAGGGCCACCTTGTGAAGACGGACATCCCCCGCTACATCATCCGCC
AGCTGGGCCTCACCCGTGACCCCTTTCCAGATGTGGTGCATCTGGAGGAACAGGACAGTGGTGGTTCCAACACCCCTGAGCAAGACGATC
TCTCTGAGGGCCGCAGCAGCAAGGCCAAGAAACCGCCGGGGGAGAATGACTTCGATACCATCAAGCTCATAAGCAACGGTGCCTACGGCG
CTGTCTACCTGGTGCGGCACCGCGACACGCGGCAGCGCTTTGCCATGAAAAAGATCAACAAGCAGAACTTGATCCTCCGCAACCAGATCC
AGCAGGCCTTTGTGGAGCGCGATATCCTCACCTTCGCCGAGAACCCGTTTGTGGTCGGCATGTTCTGCTCCTTTGAGACTCGGCGCCACC
TCTGCATGGTCATGGAATATGTGGAAGGCGGCGACTGTGCCACCCTGCTGAAGAATATTGGAGCGCTGCCCGTAGAGATGGCCCGCATGT
ACTTTGCTGAGACGGTGCTAGCCCTGGAGTATTTGCACAACTATGGCATCGTGCACCGCGACCTCAAGCCTGACAACCTCCTTATCACCT
CCATGGGTCACATCAAGCTCACAGATTTCGGCCTCTCCAAGATGGGGCTCATGAGCCTCACCACCAACTTATATGAAGGCCACATCGAGA
AGGACGCCCGAGAGTTCCTGGACAAACAGGTGTGTGGGACCCCAGAGTACATCGCGCCCGAGGTCATCCTGCGTCAAGGCTACGGCAAGC
CAGTGGACTGGTGGGCTATGGGGATCATCCTCTACGAGTTCCTGGTGGGCTGTGTGCCCTTCTTCGGAGACACACCAGAGGAGCTATTTG
GACAGGTCATCAGTGATGACATCCTGTGGCCCGAGGGGGATGAGGCCCTACCTACGGAGGCCCAACTCCTCATATCCAGCCTCCTGCAGA
CCAACCCTCTGGTCAGGCTTGGGGCAGGCGGCGCTTTTGAGGTGAAGCAGCACAGTTTCTTTCGAGACCTGGACTGGACAGGGCTGCTGA
GGCAGAAGGCCGAGTTCATCCCCCACCTAGAGTCGGAAGATGACACTAGCTACTTTGACACCCGCTCAGACAGGTATCACCACGTGAACT
CCTATGACGAGGATGACACGACGGAGGAGGAGCCCGTGGAAATCCGCCAGTTCTCTTCCTGCTCTCCGCGCTTCAGCAAGGTGTATAGCA
GCATGGAGCAGCTGTCGCAGCACGAGCCCAAGACCCCAGTAGCAGCTGCAGGGAGCAGCAAGCGGGAGCCGAGCACCAAGGGCCCCGAGG
AGAAGGTGGCCGGCAAGCGGGAGGGGCTGGGCGGCCTGACCCTGCGTGAGAAGACCTGGAGAGGGGGCTCTCCGGAGATCAAGCGATTCT
CCGCGTCCGAGGCCAGTTTCCTGGAGGGAGAGGCCAGTCCCCCTTTGGGCGCCCGCCGCCGTTTCTCGGCGCTGCTGGAGCCCAGCCGCT
TCAGCGCCCCCCAAGAGGACGAGGATGAGGCCCGGCTGCGCAGGCCTCCCCGGCCCAGCTCCGACCCCGCGGGATCCCTGGATGCACGGG
CCCCCAAAGAGGAGACTCAAGGGGAAGGCACCTCCAGCGCCGGGGACTCCGAGGCCACTGACCGTCCACGCCCAGGTGACCTCTGCCCAC
CCTCGAAGGATGGGGATGCATCAGGCCCAAGGGCTACCAATGACTTGGTTCTGCGCCGGGCGCGGCACCAGCAGATGTCAGGGGATGTGG
CAGTAGAGAAGAGGCCTTCTCGAACTGGGGGCAAAGTCATCAAATCAGCCTCAGCCACTGCCTTATCTGTCATGATTCCTGCAGTGGACC
CACATGGAAGTTCACCCCTTGCTAGTCCCATGTCTCCACGATCTCTGTCCTCCAACCCATCCTCACGGGACTCCTCACCCAGCCGGGACT
ACTCACCAGCTGTCAGTGGGCTCCGCTCCCCCATCACCATCCAGCGCTCGGGCAAGAAGTATGGCTTCACACTGCGTGCCATCCGTGTCT
ACATGGGTGACACGGATGTCTATAGTGTCCACCACATTGTCTGGCATGTGGAGGAAGGAGGCCCAGCCCAGGAGGCAGGACTCTGTGCTG
GGGACCTCATCACCCACGTGAATGGGGAGCCTGTGCATGGCATGGTGCATCCTGAGGTCGTGGAGCTGATCCTTAAGAGTGGCAACAAGG
TAGCAGTGACCACAACGCCCTTCGAAAATACCTCTATCCGCATTGGTCCCGCAAGGCGCAGCAGCTACAAGGCTAAAATGGCTCGGAGGA
ACAAGCGACCCTCCGCCAAGGAGGGCCAGGAGAGCAAGAAGCGCAGCTCCCTCTTCCGGAAGATCACGAAGCAGTCGAACCTGCTGCATA
CTAGCCGCTCGCTGTCGTCGCTGAACCGCTCGCTGTCATCCAGCGATAGTCTCCCGGGCTCGCCTACGCACGGGCTGCCGGCGCGCTCGC
CCACGCACAGCTACCGCTCCACGCCTGACTCCGCCTACCTAGGCGCCTCATCCCAGAGCAGCTCCCCAGCCTCGAGCACGCCCAACTCGC
CTGCGTCGTCGGCGTCGCACCACATTCGGCCCAGCACGCTGCACGGACTGTCGCCAAAGCTCCATCGCCAGTACCGCTCTGCGCGATGCA
AGTCGGCCGGCAACATCCCTCTATCGCCGCTGGCACACACGCCGTCCCCCACGCAGGCGTCACCGCCGCCACTGCCGGGCCACACGGTGG
GCAGCTCGCACACTACTCAGAGCTTCCCGGCCAAACTGCACTCATCGCCTCCCGTCGTGCGCCCGCGCCCCAAGAGTGCCGAGCCCCCTC
GCTCGCCGCTCCTCAAGCGCGTGCAGTCGGCCGAGAAGCTGGGAGCCTCTTTGAGTGCGGACAAGAAGGGCGCGCTGCGCAAACACAGCC
TCGAGGTGGGCCACCCGGATTTCCGCAAGGACTTCCATGGCGAGCTGGCGCTGCATAGCCTTGCCGAGTCCGACGGTGAGACGCCCCCAG
TCGAGGGCCTTGGCGCGCCCCGGCAGGTCGCCGTCCGCCGCCTGGGCCGACAGGAGTCACCTTTGAGCCTGGGCGCGGACCCGTTGCTGC
CCGAGGGTGCCTCCAGGCCACCAGTGTCGAGCAAGGAGAAGGAATCCCCGGGGGGCGCCGAGGCGTGCACCCCACCCCGCGCGACGACCC
CCGGTGGCCGGACCCTGGAGCGGGACGTCGGCTGCACGCGGCATCAGAGCGTGCAGACGGAGGATGGCACTGGCGGGATGGCCAGGGCTG
TGGCCAAGGCGGCGCTGAGCCCGGTGCAGGAACACGAGACAGGCCGGCGCAGCAGCTCTGGCGAGGCGGGCACACCCCTGGTACCCATTG
TCGTAGAGCCTGCGCGGCCCGGGGCTAAGGCTGTGGTGCCTCAGCCTCTGGGCGCGGACTCCAAGGGGTTGCAGGAACCCGCACCCCTGG
CGCCTTCCGTGCCCGAGGCCCCCCGGGGCCGGGAGCGCTGGGTGTTGGAGGTGGTGGAGGAGCGCACCACGCTGAGCGGTCCTCGCTCCA
AGCCCGCCTCCCCAAAGCTCTCCCCGGAGCCCCAGACACCCTCCCTAGCCCCAGCGAAGTGCAGTGCACCCAGCAGTGCAGTGACCCCAG
TCCCACCCGCATCCCTCTTGGGCTCAGGCACCAAGCCTCAAGTGGGGCTGACCTCCCGGTGCCCTGCTGAAGCTGTGCCCCCAGCAGGCC
TGACCAAAAAAGGAGTGTCCAGTCCCGCACCCCCGGGACCATAGCCAAGGGGGTCATCGGCCCCGCGCTGTACAGCCTCCGTATACATAT

>In-frame_NUP210_ENST00000254508_chr3_13418956_-_MAST1_ENST00000591495_chr19_12962748_+_1952nt
GCGCGCGCGCGGGCGGGAGCGGAGGGCAACGGGGCGGCGCGGGCGGCCGGGCGCAGGGTCGCGGGAGGTGACGCGCGGCGAGGATGGCGG
CGCGGGGCCGGGGGCTGCTGCTGCTGACGCTGTCGGTGCTGTTGGCGGCGGGCCCCTCCGCCGCTGCGGCCAAGCTCAACATCCCCAAAG
TGCTGCTGCCCTTCACGCGGGCCACGCGCGTTAACTTCACGCTGGAGGCCTCGGAGGGCTGCTACCGCTGGTTGTCCACCCGGCCGGAGG
TGGCCAGCATCGAGCCGCTGGGCCTGGACGAGCAGCAGTGCTCCCAGAAGGCAGTGGTGCAGGCCCGCCTGACCCAGCCTGCCCGCCTCA
CCAGCATCATCTTCGCAGAGGACATCACCACAGGCCAGGTCCTGCGCTGTGATGCCATTGTGGACCTCATCCATGACATCCAGATCGTCT
CCACCACCCGCGAGCTCTACCTGGAGGACTCCCCCCTGGAGCTGAAGATCCAGGCCCTGGACTCCGAAGGGAACACCTTCAGCACTCTGG
CTGGACTGGTCTTCGAGTGGACGATTGTGAAGGACTCCGAGGCGGACAGGTTCTCAGACTCCCACAATGCGCTGCGAATCCTCACTTTCT
TGGAGTCTACGTACATCCCTCCTTCTTACATCTCAGAGATGGAGAAGGCTGCCAAGCAAGGGGACACCATCCTGGTGTCTGGGATGAAGA
CCGGGAGCTCCAAGCTCAAGGCTCGCATCCAGGAGGCTGTCTACAAGAATGTACGCCCTGCAGAAGTCAGGCTGCTGATTTTGGAAAACA
TCCTTCTGAACCCGGCCTATGACGTCTACCTGATGGTGGGAACCTCCATTCACTACAAGGTGCAGAAGATCAGGCAAGGGAAAATTACAG
AACTCTCCATGCCTTCCGATCAGTACGAGTTGCAGCTTCAGAACAGCATCCCGGGCCCCGAAGGAGACCCAGCCCGGCCGGTGGCTGTCT
TGGCCCAGGACACGTCGATGGTCACTGCACTGCAGCTGGGACAGAGCAGCCTCGTCCTTGGCCACAGGAGTATTCGCATGCAAGGTGCTT
CTAGGTTACCCAACAGCACTATCTACGTGGTCGAACCTGGATACCTAGGGTTCACTGTTCACCCTGGTGACAGGTGGGTGCTGGAGACCG
GCCGCCTGTATGAAATCACCATCGAAGTTTTTGACAAGTTCAGCAACAAGGTCTATGTATCTGACGCCTATGAACGCTCTGAGAGCTTGG
AGGTGGCCTTCGTTACTCAGCTGGTGAAGAAGTTGCTTATTATCATCTCACGCCCTGCGAGGCTGCTGGAGTGCCTGGAATTCAACCCCG
AGGAGTTCTACCACCTGCTGGAGGCGGCCGAAGGACACGCCAAGGAGGGCCACCTTGTGAAGACGGACATCCCCCGCTACATCATCCGCC
AGCTGGGCCTCACCCGTGACCCCTTTCCAGATGTGGTGCATCTGGAGGAACAGGACAGTGGTGGTTCCAACACCCCTGAGCAAGACGATC
TCTCTGAGGGCCGCAGCAGCAAGGCCAAGAAACCGCCGGGGGAGAATGACTTCGATACCATCAAGCTCATAAGCAACGGTGCCTACGGCG
CTGTCTACCTGGTGCGGCACCGCGACACGCGGCAGCGCTTTGCCATGAAAAAGATCAACAAGCAGAACTTGATCCTCCGCAACCAGATCC
AGCAGGCCTTTGTGGAGCGCGATATCCTCACCTTCGCCGAGAACCCGTTTGTGGTCGGCATGTTCTGCTCCTTTGAGACTCGGCGCCACC
TCTGCATGGTCATGGAATATGTGGAAGGTGTGGCTGCCTGCGGGGCTGCAGGGAAGATGGGGCCGTGCTCACTGGTCAGGGCTGCGGGGT


Top

FusionGenePPI for NUP210_MAST1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NUP210TRIP6, SIRT7, FBXO6, KYNU, LACTB2, FLNB, NUDCD2, OS9, FN1, ITGA4, ADRB2, EXOSC5, LGR4, CUL7, OBSL1, EED, ETFA, NONO, SARS, SFPQ, NTRK1, EWSR1, CEP162, TCTN1, KPNB1, UBE2I, NUP153, NUP107, SEH1L, NFATC1, PTPRN, CCRN4L, RHOBTB3, NR3C1MAST1SNTB2, EGFR, PAXIP1, APP, PSEN2, A2M, BLMH, APOE, NOS3, AP1M2, CDK5, CYP2C8, DNAJB1, ECSIT, ELAVL3, EXOC6, EXOSC1, FBXL12, IFIT3, IFIT5, LONP1, LOXL4, MGEA5, PRAM1, PRDX2, RAD23A, RPP30, STAMBPL1, FBXW4, RAB3A, RAB3D, CYP2C9, RNLS, GCDH, RNF32, YWHAB, YWHAE, YWHAH, YWHAZ


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NUP210_MAST1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NUP210_MAST1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource