FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25016

FusionGeneSummary for NTRK2_AFAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: NTRK2_AFAP1
Fusion gene ID: 25016
HgeneTgene
Gene symbol

NTRK2

AFAP1

Gene ID

4915

60312

Gene nameneurotrophic receptor tyrosine kinase 2actin filament associated protein 1
SynonymsEIEE58|GP145-TrkB|OBHD|TRKB|trk-BAFAP|AFAP-110|AFAP110
Cytomap

9q21.33

4p16.1

Type of geneprotein-codingprotein-coding
DescriptionBDNF/NT-3 growth factors receptorBDNF-tropomyosine receptor kinase Bneurotrophic tyrosine kinase receptor type 2tropomyosin-related kinase Btyrosine kinase receptor Bactin filament-associated protein 1110 kDa actin filament-associated proteinactin filament-associated protein, 110 kDa
Modification date2018052320180519
UniProtAcc

Q16620

Q8N556

Ensembl transtripts involved in fusion geneENST00000376214, ENST00000376213, 
ENST00000395882, ENST00000304053, 
ENST00000376208, ENST00000277120, 
ENST00000323115, ENST00000359847, 
ENST00000395866, 
ENST00000360265, 
ENST00000358461, ENST00000420658, 
ENST00000382543, ENST00000513842, 
Fusion gene scores* DoF score4 X 4 X 3=482 X 2 X 2=8
# samples 42
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: NTRK2 [Title/Abstract] AND AFAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLGGTCGA-HT-7680-01ANTRK2chr9

87342874

+AFAP1chr4

7776630

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000376214ENST00000360265NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376214ENST00000358461NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376214ENST00000420658NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376214ENST00000382543NTRK2chr9

87342874

+AFAP1chr4

7776630

-
5CDS-5UTRENST00000376214ENST00000513842NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376213ENST00000360265NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376213ENST00000358461NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376213ENST00000420658NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376213ENST00000382543NTRK2chr9

87342874

+AFAP1chr4

7776630

-
5CDS-5UTRENST00000376213ENST00000513842NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000395882ENST00000360265NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000395882ENST00000358461NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000395882ENST00000420658NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000395882ENST00000382543NTRK2chr9

87342874

+AFAP1chr4

7776630

-
5CDS-5UTRENST00000395882ENST00000513842NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000304053ENST00000360265NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000304053ENST00000358461NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000304053ENST00000420658NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000304053ENST00000382543NTRK2chr9

87342874

+AFAP1chr4

7776630

-
5CDS-5UTRENST00000304053ENST00000513842NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376208ENST00000360265NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376208ENST00000358461NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376208ENST00000420658NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000376208ENST00000382543NTRK2chr9

87342874

+AFAP1chr4

7776630

-
5CDS-5UTRENST00000376208ENST00000513842NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000277120ENST00000360265NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000277120ENST00000358461NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000277120ENST00000420658NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000277120ENST00000382543NTRK2chr9

87342874

+AFAP1chr4

7776630

-
5CDS-5UTRENST00000277120ENST00000513842NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000323115ENST00000360265NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000323115ENST00000358461NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000323115ENST00000420658NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000323115ENST00000382543NTRK2chr9

87342874

+AFAP1chr4

7776630

-
5CDS-5UTRENST00000323115ENST00000513842NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000359847ENST00000360265NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000359847ENST00000358461NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000359847ENST00000420658NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000359847ENST00000382543NTRK2chr9

87342874

+AFAP1chr4

7776630

-
5CDS-5UTRENST00000359847ENST00000513842NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000395866ENST00000360265NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000395866ENST00000358461NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000395866ENST00000420658NTRK2chr9

87342874

+AFAP1chr4

7776630

-
In-frameENST00000395866ENST00000382543NTRK2chr9

87342874

+AFAP1chr4

7776630

-
5CDS-5UTRENST00000395866ENST00000513842NTRK2chr9

87342874

+AFAP1chr4

7776630

-

Top

FusionProtFeatures for NTRK2_AFAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NTRK2

Q16620

AFAP1

Q8N556

Receptor tyrosine kinase involved in the development andthe maturation of the central and the peripheral nervous systemsthrough regulation of neuron survival, proliferation, migration,differentiation, and synapse formation and plasticity. Receptorfor BDNF/brain-derived neurotrophic factor and NTF4/neurotrophin-4. Alternatively can also bind NTF3/neurotrophin-3 which is lessefficient in activating the receptor but regulates neuron survivalthrough NTRK2. Upon ligand-binding, undergoes homodimerization,autophosphorylation and activation. Recruits, phosphorylatesand/or activates several downstream effectors including SHC1,FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlappingsignaling cascades. Through SHC1, FRS2, SH2B1, SH2B2 activates theGRB2-Ras-MAPK cascade that regulates for instance neuronaldifferentiation including neurite outgrowth. Through the sameeffectors controls the Ras-PI3 kinase-AKT1 signaling cascade thatmainly regulates growth and survival. Through PLCG1 and thedownstream protein kinase C-regulated pathways controls synapticplasticity. Thereby, plays a role in learning and memory byregulating both short term synaptic function and long-termpotentiation. PLCG1 also leads to NF-Kappa-B activation and thetranscription of genes involved in cell survival. Hence, it isable to suppress anoikis, the apoptosis resulting from loss ofcell-matrix interactions. May also play a role in neutrophin-dependent calcium signaling in glial cells and mediatecommunication between neurons and glia.{ECO:0000269|PubMed:15494731}. Can cross-link actin filaments into both network andbundle structures (By similarity). May modulate changes in actinfilament integrity and induce lamellipodia formation. May functionas an adapter molecule that links other proteins, such as SRC andPKC to the actin cytoskeleton. Seems to play a role in thedevelopment and progression of prostate adenocarcinoma byregulating cell-matrix adhesions and migration in the cancercells. {ECO:0000250, ECO:0000269|PubMed:15485829}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+919148_196386839DomainNote=LRRCT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+919197_282386839DomainNote=Ig-like C2-type 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+919295_365386839DomainNote=Ig-like C2-type 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+91932_61386839DomainNote=LRRNT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+915148_196386554DomainNote=LRRCT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+915197_282386554DomainNote=Ig-like C2-type 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+915295_365386554DomainNote=Ig-like C2-type 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+91532_61386554DomainNote=LRRNT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+817148_196386823DomainNote=LRRCT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+817197_282386823DomainNote=Ig-like C2-type 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+817295_365386823DomainNote=Ig-like C2-type 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+81732_61386823DomainNote=LRRNT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+812148_196386478DomainNote=LRRCT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+812197_282386478DomainNote=Ig-like C2-type 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+812295_365386478DomainNote=Ig-like C2-type 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+81232_61386478DomainNote=LRRNT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+914148_196386538DomainNote=LRRCT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+914197_282386538DomainNote=Ig-like C2-type 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+914295_365386538DomainNote=Ig-like C2-type 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+91432_61386538DomainNote=LRRNT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+1120148_196386823DomainNote=LRRCT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+1120197_282386823DomainNote=Ig-like C2-type 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+1120295_365386823DomainNote=Ig-like C2-type 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+112032_61386823DomainNote=LRRNT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+1121148_196386839DomainNote=LRRCT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+1121197_282386839DomainNote=Ig-like C2-type 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+1121295_365386839DomainNote=Ig-like C2-type 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+112132_61386839DomainNote=LRRNT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+812148_196230322DomainNote=LRRCT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+81232_61230322DomainNote=LRRNT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+913148_196386478DomainNote=LRRCT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+913197_282386478DomainNote=Ig-like C2-type 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+913295_365386478DomainNote=Ig-like C2-type 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+91332_61386478DomainNote=LRRNT
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+919116_137386839RepeatNote=LRR 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+91992_113386839RepeatNote=LRR 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+915116_137386554RepeatNote=LRR 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+91592_113386554RepeatNote=LRR 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+817116_137386823RepeatNote=LRR 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+81792_113386823RepeatNote=LRR 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+812116_137386478RepeatNote=LRR 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+81292_113386478RepeatNote=LRR 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+914116_137386538RepeatNote=LRR 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+91492_113386538RepeatNote=LRR 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+1120116_137386823RepeatNote=LRR 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+112092_113386823RepeatNote=LRR 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+1121116_137386839RepeatNote=LRR 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+112192_113386839RepeatNote=LRR 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+812116_137230322RepeatNote=LRR 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+81292_113230322RepeatNote=LRR 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+913116_137386478RepeatNote=LRR 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+91392_113386478RepeatNote=LRR 1
TgeneAFAP1chr9:87342874chr4:7776630ENST00000358461-1217557_648548731Coiled coilOntology_term=ECO:0000255
TgeneAFAP1chr9:87342874chr4:7776630ENST00000360265-1116557_648548731Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+919538_807386839DomainProtein kinase
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+915538_807386554DomainProtein kinase
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+817538_807386823DomainProtein kinase
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+812538_807386478DomainProtein kinase
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+914538_807386538DomainProtein kinase
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+1120538_807386823DomainProtein kinase
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+1121538_807386839DomainProtein kinase
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+812197_282230322DomainNote=Ig-like C2-type 1
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+812295_365230322DomainNote=Ig-like C2-type 2
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+812538_807230322DomainProtein kinase
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+913538_807386478DomainProtein kinase
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+919544_552386839Nucleotide bindingATP
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+915544_552386554Nucleotide bindingATP
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+817544_552386823Nucleotide bindingATP
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+812544_552386478Nucleotide bindingATP
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+914544_552386538Nucleotide bindingATP
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+1120544_552386823Nucleotide bindingATP
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+1121544_552386839Nucleotide bindingATP
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+812544_552230322Nucleotide bindingATP
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+913544_552386478Nucleotide bindingATP
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+91932_430386839Topological domainExtracellular
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+919455_822386839Topological domainCytoplasmic
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+91532_430386554Topological domainExtracellular
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+915455_822386554Topological domainCytoplasmic
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+81732_430386823Topological domainExtracellular
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+817455_822386823Topological domainCytoplasmic
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+81232_430386478Topological domainExtracellular
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+812455_822386478Topological domainCytoplasmic
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+91432_430386538Topological domainExtracellular
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+914455_822386538Topological domainCytoplasmic
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+112032_430386823Topological domainExtracellular
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+1120455_822386823Topological domainCytoplasmic
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+112132_430386839Topological domainExtracellular
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+1121455_822386839Topological domainCytoplasmic
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+81232_430230322Topological domainExtracellular
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+812455_822230322Topological domainCytoplasmic
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+91332_430386478Topological domainExtracellular
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+913455_822386478Topological domainCytoplasmic
HgeneNTRK2chr9:87342874chr4:7776630ENST00000277120+919431_454386839TransmembraneHelical
HgeneNTRK2chr9:87342874chr4:7776630ENST00000304053+915431_454386554TransmembraneHelical
HgeneNTRK2chr9:87342874chr4:7776630ENST00000323115+817431_454386823TransmembraneHelical
HgeneNTRK2chr9:87342874chr4:7776630ENST00000359847+812431_454386478TransmembraneHelical
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376208+914431_454386538TransmembraneHelical
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376213+1120431_454386823TransmembraneHelical
HgeneNTRK2chr9:87342874chr4:7776630ENST00000376214+1121431_454386839TransmembraneHelical
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395866+812431_454230322TransmembraneHelical
HgeneNTRK2chr9:87342874chr4:7776630ENST00000395882+913431_454386478TransmembraneHelical
TgeneAFAP1chr9:87342874chr4:7776630ENST00000382543-1217557_648632815Coiled coilOntology_term=ECO:0000255
TgeneAFAP1chr9:87342874chr4:7776630ENST00000420658-1318557_648632815Coiled coilOntology_term=ECO:0000255
TgeneAFAP1chr9:87342874chr4:7776630ENST00000358461-121760_106548731Compositional biasNote=Pro-rich
TgeneAFAP1chr9:87342874chr4:7776630ENST00000360265-111660_106548731Compositional biasNote=Pro-rich
TgeneAFAP1chr9:87342874chr4:7776630ENST00000382543-121760_106632815Compositional biasNote=Pro-rich
TgeneAFAP1chr9:87342874chr4:7776630ENST00000420658-131860_106632815Compositional biasNote=Pro-rich
TgeneAFAP1chr9:87342874chr4:7776630ENST00000358461-1217153_249548731DomainPH 1
TgeneAFAP1chr9:87342874chr4:7776630ENST00000358461-1217347_441548731DomainPH 2
TgeneAFAP1chr9:87342874chr4:7776630ENST00000360265-1116153_249548731DomainPH 1
TgeneAFAP1chr9:87342874chr4:7776630ENST00000360265-1116347_441548731DomainPH 2
TgeneAFAP1chr9:87342874chr4:7776630ENST00000382543-1217153_249632815DomainPH 1
TgeneAFAP1chr9:87342874chr4:7776630ENST00000382543-1217347_441632815DomainPH 2
TgeneAFAP1chr9:87342874chr4:7776630ENST00000420658-1318153_249632815DomainPH 1
TgeneAFAP1chr9:87342874chr4:7776630ENST00000420658-1318347_441632815DomainPH 2
TgeneAFAP1chr9:87342874chr4:7776630ENST00000358461-1217451_456548731MotifSH2-binding 2
TgeneAFAP1chr9:87342874chr4:7776630ENST00000358461-121771_74548731MotifSH3-binding
TgeneAFAP1chr9:87342874chr4:7776630ENST00000358461-121794_97548731MotifSH2-binding 1
TgeneAFAP1chr9:87342874chr4:7776630ENST00000360265-1116451_456548731MotifSH2-binding 2
TgeneAFAP1chr9:87342874chr4:7776630ENST00000360265-111671_74548731MotifSH3-binding
TgeneAFAP1chr9:87342874chr4:7776630ENST00000360265-111694_97548731MotifSH2-binding 1
TgeneAFAP1chr9:87342874chr4:7776630ENST00000382543-1217451_456632815MotifSH2-binding 2
TgeneAFAP1chr9:87342874chr4:7776630ENST00000382543-121771_74632815MotifSH3-binding
TgeneAFAP1chr9:87342874chr4:7776630ENST00000382543-121794_97632815MotifSH2-binding 1
TgeneAFAP1chr9:87342874chr4:7776630ENST00000420658-1318451_456632815MotifSH2-binding 2
TgeneAFAP1chr9:87342874chr4:7776630ENST00000420658-131871_74632815MotifSH3-binding
TgeneAFAP1chr9:87342874chr4:7776630ENST00000420658-131894_97632815MotifSH2-binding 1


Top

FusionGeneSequence for NTRK2_AFAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_569aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAT
VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN
LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILE
EKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLK

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_413aa
MWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHT
QGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHV
TNHTEYHGCLQLDNPTHMNNGDYTLIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQL
RKERKDLRAAIEVNAGRKPQAILEEKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLEN

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_413aa
MWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHT
QGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHV
TNHTEYHGCLQLDNPTHMNNGDYTLIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQL
RKERKDLRAAIEVNAGRKPQAILEEKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLEN

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_413aa
MWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHT
QGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHV
TNHTEYHGCLQLDNPTHMNNGDYTLIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQL
RKERKDLRAAIEVNAGRKPQAILEEKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLEN

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_413aa
MWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMTWDVGNLVSKHMNETSHT
QGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFTNGAILNESKYICTKIHV
TNHTEYHGCLQLDNPTHMNNGDYTLIAKNETGKDEKQISAHFMGWPGIDDDAAQYKTGKNRVEADAKRLQTKEEELLKRKEALRNRLAQL
RKERKDLRAAIEVNAGRKPQAILEEKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLEN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1707nt
ATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTC
GCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCT
AACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTAT
GTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATC
AATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTT
ACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGC
AGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAA
GGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATG
AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAAT
CTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCAC
TGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATC
TGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACT
CTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAG
TACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGG
AATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAG
GAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGC
CTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGG
CACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAG

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_1239nt
ATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTG
GCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTA
TCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACA
CAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAA
GATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACT
GTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTT
ACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAG
TATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAAC
CGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTC
CGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTG
GAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCG
GGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAAC
TCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCG

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_1239nt
ATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTG
GCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTA
TCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACA
CAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAA
GATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACT
GTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTT
ACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAG
TATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAAC
CGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTC
CGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTG
GAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCG
GGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAAC
TCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCG

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_1239nt
ATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTG
GCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTA
TCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACA
CAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAA
GATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACT
GTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTT
ACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAG
TATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAAC
CGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTC
CGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTG
GAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCG
GGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAAC
TCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCG

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1239nt
ATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTG
GCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTA
TCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACA
CAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAA
GATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACT
GTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTT
ACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAG
TATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAAC
CGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTC
CGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTG
GAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCG
GGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAAC
TCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_7696nt
AAGACGGATTCTCAGACAAGGCTTGCAAATGCCCCGCAGCCATCATTTAACTGCACCCGCAGAATAGTTACGGTTTGTCACCCGACCCTC
CCGGATCGCCTAATTTGTCCCTAGTGAGACCCCGAGGCTCTGCCCGCGCCTGGCTTCTTCGTAGCTGGATGCATATCGTGCTCCGGGCAG
CGCGGGCGCAGGGCACGCGTTCGCGCACACCCTAGCACACATGAACACGCGCAAGAGCTGAACCAAGCACGGTTTCCATTTCAAAAAGGG
AGACAGCCTCTACCGCGATTGTAGAAGAGACTGTGGTGTGAATTAGGGACCGGGAGGCGTCGAACGGAGGAACGGTTCATCTTAGAGACT
AATTTTCTGGAGTTTCTGCCCCTGCTCTGCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATT
GGGTTGGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCC
GGCGGGCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCG
GGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGC
GGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCG
GCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGC
GCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCT
TCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACC
CTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAA
GGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTC
ATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACC
TTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCA
GTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCAT
CTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATA
TGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCG
ATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAA
CTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGT
TCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGC
TGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACT
TCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCA
AAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTG
AAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTG
TCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCA
AGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCG
AGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGA
AGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCT
CATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTG
TCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAA
AAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAAC
CCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCG
GGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTG
TGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTT
TTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTAC
TGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTT
TTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACA
CCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAA
GCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCC
AGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCA
GCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTG
GTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTC
ACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATA
GAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAA
ACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTT
AAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACAC
GAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAG
CCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGA
CATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCC
ACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTG
CTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAA
GAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCA
GCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCC
CCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGT
AATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCC
CTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAAT
AAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCT
GACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTC
ATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTA
GCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCC
GGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCT
CTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTC
ATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCG
GGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGT
GGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCT
GGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATC
TTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTT
CAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACG
GGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAA
GGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACG
GAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAG
GGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTG
GAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTG
CCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTT
CCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAA
TACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCA
CCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCAC
CGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGG
TGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGA
ATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATA
TTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGT
AAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGT
CCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGG

>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_7695nt
AAGACGGATTCTCAGACAAGGCTTGCAAATGCCCCGCAGCCATCATTTAACTGCACCCGCAGAATAGTTACGGTTTGTCACCCGACCCTC
CCGGATCGCCTAATTTGTCCCTAGTGAGACCCCGAGGCTCTGCCCGCGCCTGGCTTCTTCGTAGCTGGATGCATATCGTGCTCCGGGCAG
CGCGGGCGCAGGGCACGCGTTCGCGCACACCCTAGCACACATGAACACGCGCAAGAGCTGAACCAAGCACGGTTTCCATTTCAAAAAGGG
AGACAGCCTCTACCGCGATTGTAGAAGAGACTGTGGTGTGAATTAGGGACCGGGAGGCGTCGAACGGAGGAACGGTTCATCTTAGAGACT
AATTTTCTGGAGTTTCTGCCCCTGCTCTGCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATT
GGGTTGGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCC
GGCGGGCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCG
GGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGC
GGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCG
GCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGC
GCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCT
TCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACC
CTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAA
GGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTC
ATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACC
TTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCA
GTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCAT
CTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATA
TGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCG
ATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAA
CTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGT
TCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGC
TGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACT
TCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCA
AAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTG
AAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTG
TCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCA
AGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCG
AGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGA
AGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCT
CATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTG
TCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAA
AAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAAC
CCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCG
GGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTG
TGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTT
TTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTAC
TGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTT
TTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACA
CCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAA
GCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCC
AGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCA
GCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTG
GTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTC
ACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATA
GAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAA
ACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTT
AAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACAC
GAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAG
CCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGA
CATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCC
ACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTG
CTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAA
GAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCA
GCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCC
CCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGT
AATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCC
CTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAAT
AAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCT
GACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTC
ATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTA
GCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCC
GGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCT
CTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTC
ATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCG
GGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGT
GGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCT
GGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATC
TTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTT
CAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACG
GGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAA
GGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACG
GAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAG
GGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTG
GAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTG
CCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTT
CCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAA
TACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCA
CCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCAC
CGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGG
TGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGA
ATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATA
TTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGT
AAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGT
CCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGG

>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_7695nt
AAGACGGATTCTCAGACAAGGCTTGCAAATGCCCCGCAGCCATCATTTAACTGCACCCGCAGAATAGTTACGGTTTGTCACCCGACCCTC
CCGGATCGCCTAATTTGTCCCTAGTGAGACCCCGAGGCTCTGCCCGCGCCTGGCTTCTTCGTAGCTGGATGCATATCGTGCTCCGGGCAG
CGCGGGCGCAGGGCACGCGTTCGCGCACACCCTAGCACACATGAACACGCGCAAGAGCTGAACCAAGCACGGTTTCCATTTCAAAAAGGG
AGACAGCCTCTACCGCGATTGTAGAAGAGACTGTGGTGTGAATTAGGGACCGGGAGGCGTCGAACGGAGGAACGGTTCATCTTAGAGACT
AATTTTCTGGAGTTTCTGCCCCTGCTCTGCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATT
GGGTTGGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCC
GGCGGGCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCG
GGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGC
GGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCG
GCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGC
GCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCT
TCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACC
CTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAA
GGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTC
ATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACC
TTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCA
GTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCAT
CTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATA
TGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCG
ATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAA
CTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGT
TCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGC
TGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACT
TCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCA
AAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTG
AAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTG
TCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCA
AGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCG
AGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGA
AGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCT
CATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTG
TCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAA
AAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAAC
CCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCG
GGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTG
TGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTT
TTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTAC
TGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTT
TTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACA
CCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAA
GCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCC
AGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCA
GCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTG
GTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTC
ACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATA
GAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAA
ACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTT
AAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACAC
GAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAG
CCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGA
CATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCC
ACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTG
CTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAA
GAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCA
GCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCC
CCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGT
AATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCC
CTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAAT
AAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCT
GACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTC
ATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTA
GCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCC
GGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCT
CTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTC
ATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCG
GGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGT
GGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCT
GGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATC
TTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTT
CAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACG
GGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAA
GGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACG
GAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAG
GGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTG
GAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTG
CCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTT
CCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAA
TACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCA
CCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCAC
CGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGG
TGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGA
ATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATA
TTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGT
AAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGT
CCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGG

>In-frame_NTRK2_ENST00000376214_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_2786nt
AAGACGGATTCTCAGACAAGGCTTGCAAATGCCCCGCAGCCATCATTTAACTGCACCCGCAGAATAGTTACGGTTTGTCACCCGACCCTC
CCGGATCGCCTAATTTGTCCCTAGTGAGACCCCGAGGCTCTGCCCGCGCCTGGCTTCTTCGTAGCTGGATGCATATCGTGCTCCGGGCAG
CGCGGGCGCAGGGCACGCGTTCGCGCACACCCTAGCACACATGAACACGCGCAAGAGCTGAACCAAGCACGGTTTCCATTTCAAAAAGGG
AGACAGCCTCTACCGCGATTGTAGAAGAGACTGTGGTGTGAATTAGGGACCGGGAGGCGTCGAACGGAGGAACGGTTCATCTTAGAGACT
AATTTTCTGGAGTTTCTGCCCCTGCTCTGCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATT
GGGTTGGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCC
GGCGGGCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCG
GGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGC
GGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCG
GCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGC
GCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCT
TCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACC
CTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAA
GGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTC
ATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACC
TTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCA
GTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCAT
CTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATA
TGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCG
ATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAA
CTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGT
TCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGC
TGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACT
TCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCA
AAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTG
AAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTG
TCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCA
AGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCG
AGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGA
AGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCT

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_7696nt
AAGACGGATTCTCAGACAAGGCTTGCAAATGCCCCGCAGCCATCATTTAACTGCACCCGCAGAATAGTTACGGTTTGTCACCCGACCCTC
CCGGATCGCCTAATTTGTCCCTAGTGAGACCCCGAGGCTCTGCCCGCGCCTGGCTTCTTCGTAGCTGGATGCATATCGTGCTCCGGGCAG
CGCGGGCGCAGGGCACGCGTTCGCGCACACCCTAGCACACATGAACACGCGCAAGAGCTGAACCAAGCACGGTTTCCATTTCAAAAAGGG
AGACAGCCTCTACCGCGATTGTAGAAGAGACTGTGGTGTGAATTAGGGACCGGGAGGCGTCGAACGGAGGAACGGTTCATCTTAGAGACT
AATTTTCTGGAGTTTCTGCCCCTGCTCTGCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATT
GGGTTGGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCC
GGCGGGCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCG
GGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGC
GGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCG
GCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGC
GCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCT
TCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACC
CTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAA
GGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTC
ATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACC
TTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCA
GTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCAT
CTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATA
TGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCG
ATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAA
CTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGT
TCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGC
TGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACT
TCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCA
AAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTG
AAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTG
TCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCA
AGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCG
AGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGA
AGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCT
CATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTG
TCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAA
AAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAAC
CCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCG
GGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTG
TGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTT
TTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTAC
TGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTT
TTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACA
CCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAA
GCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCC
AGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCA
GCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTG
GTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTC
ACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATA
GAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAA
ACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTT
AAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACAC
GAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAG
CCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGA
CATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCC
ACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTG
CTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAA
GAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCA
GCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCC
CCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGT
AATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCC
CTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAAT
AAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCT
GACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTC
ATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTA
GCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCC
GGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCT
CTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTC
ATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCG
GGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGT
GGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCT
GGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATC
TTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTT
CAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACG
GGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAA
GGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACG
GAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAG
GGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTG
GAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTG
CCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTT
CCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAA
TACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCA
CCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCAC
CGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGG
TGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGA
ATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATA
TTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGT
AAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGT
CCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGG

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_7695nt
AAGACGGATTCTCAGACAAGGCTTGCAAATGCCCCGCAGCCATCATTTAACTGCACCCGCAGAATAGTTACGGTTTGTCACCCGACCCTC
CCGGATCGCCTAATTTGTCCCTAGTGAGACCCCGAGGCTCTGCCCGCGCCTGGCTTCTTCGTAGCTGGATGCATATCGTGCTCCGGGCAG
CGCGGGCGCAGGGCACGCGTTCGCGCACACCCTAGCACACATGAACACGCGCAAGAGCTGAACCAAGCACGGTTTCCATTTCAAAAAGGG
AGACAGCCTCTACCGCGATTGTAGAAGAGACTGTGGTGTGAATTAGGGACCGGGAGGCGTCGAACGGAGGAACGGTTCATCTTAGAGACT
AATTTTCTGGAGTTTCTGCCCCTGCTCTGCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATT
GGGTTGGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCC
GGCGGGCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCG
GGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGC
GGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCG
GCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGC
GCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCT
TCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACC
CTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAA
GGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTC
ATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACC
TTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCA
GTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCAT
CTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATA
TGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCG
ATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAA
CTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGT
TCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGC
TGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACT
TCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCA
AAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTG
AAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTG
TCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCA
AGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCG
AGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGA
AGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCT
CATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTG
TCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAA
AAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAAC
CCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCG
GGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTG
TGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTT
TTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTAC
TGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTT
TTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACA
CCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAA
GCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCC
AGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCA
GCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTG
GTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTC
ACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATA
GAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAA
ACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTT
AAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACAC
GAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAG
CCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGA
CATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCC
ACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTG
CTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAA
GAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCA
GCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCC
CCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGT
AATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCC
CTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAAT
AAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCT
GACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTC
ATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTA
GCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCC
GGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCT
CTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTC
ATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCG
GGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGT
GGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCT
GGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATC
TTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTT
CAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACG
GGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAA
GGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACG
GAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAG
GGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTG
GAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTG
CCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTT
CCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAA
TACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCA
CCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCAC
CGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGG
TGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGA
ATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATA
TTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGT
AAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGT
CCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGG

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_7695nt
AAGACGGATTCTCAGACAAGGCTTGCAAATGCCCCGCAGCCATCATTTAACTGCACCCGCAGAATAGTTACGGTTTGTCACCCGACCCTC
CCGGATCGCCTAATTTGTCCCTAGTGAGACCCCGAGGCTCTGCCCGCGCCTGGCTTCTTCGTAGCTGGATGCATATCGTGCTCCGGGCAG
CGCGGGCGCAGGGCACGCGTTCGCGCACACCCTAGCACACATGAACACGCGCAAGAGCTGAACCAAGCACGGTTTCCATTTCAAAAAGGG
AGACAGCCTCTACCGCGATTGTAGAAGAGACTGTGGTGTGAATTAGGGACCGGGAGGCGTCGAACGGAGGAACGGTTCATCTTAGAGACT
AATTTTCTGGAGTTTCTGCCCCTGCTCTGCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATT
GGGTTGGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCC
GGCGGGCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCG
GGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGC
GGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCG
GCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGC
GCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCT
TCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACC
CTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAA
GGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTC
ATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACC
TTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCA
GTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCAT
CTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATA
TGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCG
ATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAA
CTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGT
TCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGC
TGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACT
TCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCA
AAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTG
AAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTG
TCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCA
AGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCG
AGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGA
AGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCT
CATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTG
TCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAA
AAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAAC
CCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCG
GGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTG
TGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTT
TTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTAC
TGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTT
TTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACA
CCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAA
GCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCC
AGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCA
GCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTG
GTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTC
ACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATA
GAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAA
ACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTT
AAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACAC
GAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAG
CCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGA
CATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCC
ACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTG
CTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAA
GAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCA
GCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCC
CCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGT
AATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCC
CTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAAT
AAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCT
GACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTC
ATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTA
GCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCC
GGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCT
CTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTC
ATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCG
GGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGT
GGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCT
GGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATC
TTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTT
CAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACG
GGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAA
GGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACG
GAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAG
GGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTG
GAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTG
CCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTT
CCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAA
TACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCA
CCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCAC
CGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGG
TGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGA
ATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATA
TTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGT
AAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGT
CCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGG

>In-frame_NTRK2_ENST00000376213_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_2786nt
AAGACGGATTCTCAGACAAGGCTTGCAAATGCCCCGCAGCCATCATTTAACTGCACCCGCAGAATAGTTACGGTTTGTCACCCGACCCTC
CCGGATCGCCTAATTTGTCCCTAGTGAGACCCCGAGGCTCTGCCCGCGCCTGGCTTCTTCGTAGCTGGATGCATATCGTGCTCCGGGCAG
CGCGGGCGCAGGGCACGCGTTCGCGCACACCCTAGCACACATGAACACGCGCAAGAGCTGAACCAAGCACGGTTTCCATTTCAAAAAGGG
AGACAGCCTCTACCGCGATTGTAGAAGAGACTGTGGTGTGAATTAGGGACCGGGAGGCGTCGAACGGAGGAACGGTTCATCTTAGAGACT
AATTTTCTGGAGTTTCTGCCCCTGCTCTGCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATT
GGGTTGGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCC
GGCGGGCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCG
GGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGC
GGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCG
GCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGC
GCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCT
TCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACC
CTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAA
GGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTC
ATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACC
TTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCA
GTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCAT
CTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATA
TGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCG
ATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAA
CTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGT
TCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGC
TGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACT
TCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCA
AAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTG
AAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTG
TCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCA
AGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCG
AGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGA
AGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCT

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_7308nt
GCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATTGGGTTGGAGCAGGAGCCTCGCTGGCTGC
TTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGGGCGTGAGGCGCCGGAGCCCGGCC
TCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGCGCCGCCGGTCGGTGCCCGGCGCG
CCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTCGCTATGCCGGGGCCACTGTGAAC
CCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACGCCCGCAACAAGCACCGAGGAGTT
AAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTG
GCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAG
GGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAG
ATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGT
TGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCT
GCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGG
CAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCT
GAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCAC
TGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTC
CAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGT
GGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTC
AGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTC
CAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGG
GGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGA
TGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGA
GGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGC
GATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGT
CAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCC
AGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGC
CGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGG
GACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCC
CAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTA
CTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGG
ATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTC
CATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACT
GGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCC
GTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTT
TGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTT
TCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCC
TCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGC
TCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGG
AACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGT
TGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATAT
TTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAG
ATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAA
CGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAA
GCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCC
AGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGG
GCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGA
ACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCC
TCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCA
CACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTG
CAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGG
GTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAG
TAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGC
ACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAAC
GGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTT
AAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTC
CATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAA
ATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCC
AAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGG
CCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGC
CACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGAC
CCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTG
TCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCT
CCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTG
CAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAG
ACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCA
GTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCA
TTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGC
CACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGG
GTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTT
GGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAG
GATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGG
TGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGG
CAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATT
TTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCT
TGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCA
GTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCAT
CCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTA
GTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATT
TTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAA
AATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGC
AAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTA
TTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCA
CTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCCTTGGCGTGCCCCTTTGTGTATGA

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_7307nt
GCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATTGGGTTGGAGCAGGAGCCTCGCTGGCTGC
TTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGGGCGTGAGGCGCCGGAGCCCGGCC
TCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGCGCCGCCGGTCGGTGCCCGGCGCG
CCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTCGCTATGCCGGGGCCACTGTGAAC
CCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACGCCCGCAACAAGCACCGAGGAGTT
AAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTG
GCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAG
GGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAG
ATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGT
TGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCT
GCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGG
CAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCT
GAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCAC
TGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTC
CAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGT
GGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTC
AGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTC
CAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGG
GGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGA
TGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGA
GGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGC
GATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGT
CAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCC
AGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGC
CGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGG
GACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCC
CAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTA
CTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGG
ATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTC
CATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACT
GGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCC
GTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTT
TGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTT
TCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCC
TCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGC
TCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGG
AACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGT
TGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATAT
TTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAG
ATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAA
CGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAA
GCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCC
AGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGG
GCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGA
ACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCC
TCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCA
CACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTG
CAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGG
GTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAG
TAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGC
ACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAAC
GGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTT
AAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTC
CATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAA
ATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCC
AAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGG
CCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGC
CACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGAC
CCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTG
TCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCT
CCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTG
CAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAG
ACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCA
GTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCA
TTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGC
CACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGG
GTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTT
GGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAG
GATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGG
TGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGG
CAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATT
TTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCT
TGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCA
GTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCAT
CCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTA
GTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATT
TTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAA
AATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGC
AAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTA
TTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCA
CTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCCTTGGCGTGCCCCTTTGTGTATGA

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_7307nt
GCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATTGGGTTGGAGCAGGAGCCTCGCTGGCTGC
TTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGGGCGTGAGGCGCCGGAGCCCGGCC
TCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGCGCCGCCGGTCGGTGCCCGGCGCG
CCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTCGCTATGCCGGGGCCACTGTGAAC
CCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACGCCCGCAACAAGCACCGAGGAGTT
AAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTG
GCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAG
GGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAG
ATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGT
TGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCT
GCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGG
CAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCT
GAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCAC
TGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTC
CAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGT
GGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTC
AGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTC
CAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGG
GGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGA
TGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGA
GGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGC
GATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGT
CAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCC
AGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGC
CGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGG
GACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCC
CAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTA
CTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGG
ATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTC
CATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACT
GGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCC
GTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTT
TGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTT
TCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCC
TCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGC
TCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGG
AACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGT
TGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATAT
TTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAG
ATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAA
CGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAA
GCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCC
AGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGG
GCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGA
ACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCC
TCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCA
CACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTG
CAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGG
GTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAG
TAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGC
ACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAAC
GGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTT
AAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTC
CATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAA
ATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCC
AAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGG
CCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGC
CACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGAC
CCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTG
TCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCT
CCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTG
CAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAG
ACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCA
GTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCA
TTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGC
CACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGG
GTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTT
GGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAG
GATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGG
TGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGG
CAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATT
TTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCT
TGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCA
GTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCAT
CCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTA
GTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATT
TTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAA
AATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGC
AAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTA
TTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCA
CTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCCTTGGCGTGCCCCTTTGTGTATGA

>In-frame_NTRK2_ENST00000395882_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_2398nt
GCGTCAGCCCTCACGTCACTTCGCCAGCAGTAGCAGAGGCGGCGGCGGCGGCTCCCGGAATTGGGTTGGAGCAGGAGCCTCGCTGGCTGC
TTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGGGCGTGAGGCGCCGGAGCCCGGCC
TCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGCGCCGCCGGTCGGTGCCCGGCGCG
CCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTCGCTATGCCGGGGCCACTGTGAAC
CCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACGCCCGCAACAAGCACCGAGGAGTT
AAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTG
GCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAG
GGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAG
ATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGT
TGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCT
GCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGG
CAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCT
GAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCAC
TGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTC
CAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGT
GGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTC
AGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTC
CAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGG
GGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGA
TGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGA
GGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGC
GATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGT
CAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCC
AGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGC
CGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGG
GACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCC

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_7241nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT
GTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCC
CAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAA
GTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGC
CCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCAT
GAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCT
TGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATT
ATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGT
GTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAAT
ACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGG
AGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAG
TTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTT
GTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTT
CTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATT
TACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTA
TGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATA
CAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACT
GACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGT
GGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATT
GGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTT
CTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCC
AGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCAT
TGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCT
CCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAA
CTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAG
CTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGA
GCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTC
ACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGA
GGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTT
ATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAG
TGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAAC
GAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGA
TGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGG
ACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCT
CCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGA
AACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAA
CTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATC
TGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGG
GCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACT
CATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAA
AGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACT
CAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTA
TTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACT
GATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGG
GGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGT
CTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTC
CTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGG
TTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGT
GGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAG
GAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGC
ACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTT
TTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAA
TTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAA
AATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATA
TATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACT
CGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCC

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_7240nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT
GTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCC
CAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAA
GTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGC
CCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCAT
GAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCT
TGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATT
ATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGT
GTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAAT
ACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGG
AGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAG
TTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTT
GTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTT
CTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATT
TACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTA
TGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATA
CAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACT
GACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGT
GGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATT
GGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTT
CTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCC
AGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCAT
TGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCT
CCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAA
CTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAG
CTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGA
GCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTC
ACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGA
GGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTT
ATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAG
TGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAAC
GAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGA
TGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGG
ACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCT
CCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGA
AACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAA
CTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATC
TGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGG
GCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACT
CATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAA
AGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACT
CAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTA
TTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACT
GATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGG
GGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGT
CTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTC
CTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGG
TTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGT
GGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAG
GAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGC
ACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTT
TTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAA
TTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAA
AATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATA
TATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACT
CGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCC

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_7240nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT
GTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCC
CAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAA
GTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGC
CCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCAT
GAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCT
TGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATT
ATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGT
GTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAAT
ACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGG
AGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAG
TTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTT
GTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTT
CTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATT
TACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTA
TGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATA
CAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACT
GACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGT
GGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATT
GGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTT
CTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCC
AGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCAT
TGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCT
CCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAA
CTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAG
CTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGA
GCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTC
ACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGA
GGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTT
ATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAG
TGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAAC
GAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGA
TGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGG
ACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCT
CCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGA
AACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAA
CTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATC
TGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGG
GCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACT
CATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAA
AGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACT
CAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTA
TTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACT
GATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGG
GGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGT
CTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTC
CTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGG
TTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGT
GGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAG
GAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGC
ACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTT
TTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAA
TTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAA
AATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATA
TATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACT
CGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCC

>In-frame_NTRK2_ENST00000304053_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_2331nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_7241nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT
GTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCC
CAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAA
GTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGC
CCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCAT
GAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCT
TGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATT
ATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGT
GTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAAT
ACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGG
AGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAG
TTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTT
GTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTT
CTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATT
TACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTA
TGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATA
CAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACT
GACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGT
GGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATT
GGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTT
CTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCC
AGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCAT
TGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCT
CCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAA
CTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAG
CTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGA
GCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTC
ACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGA
GGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTT
ATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAG
TGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAAC
GAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGA
TGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGG
ACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCT
CCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGA
AACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAA
CTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATC
TGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGG
GCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACT
CATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAA
AGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACT
CAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTA
TTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACT
GATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGG
GGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGT
CTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTC
CTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGG
TTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGT
GGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAG
GAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGC
ACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTT
TTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAA
TTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAA
AATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATA
TATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACT
CGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCC

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_7240nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT
GTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCC
CAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAA
GTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGC
CCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCAT
GAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCT
TGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATT
ATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGT
GTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAAT
ACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGG
AGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAG
TTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTT
GTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTT
CTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATT
TACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTA
TGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATA
CAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACT
GACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGT
GGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATT
GGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTT
CTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCC
AGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCAT
TGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCT
CCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAA
CTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAG
CTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGA
GCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTC
ACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGA
GGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTT
ATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAG
TGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAAC
GAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGA
TGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGG
ACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCT
CCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGA
AACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAA
CTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATC
TGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGG
GCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACT
CATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAA
AGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACT
CAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTA
TTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACT
GATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGG
GGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGT
CTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTC
CTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGG
TTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGT
GGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAG
GAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGC
ACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTT
TTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAA
TTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAA
AATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATA
TATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACT
CGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCC

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_7240nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT
GTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCC
CAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAA
GTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGC
CCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCAT
GAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCT
TGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATT
ATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGT
GTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAAT
ACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGG
AGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAG
TTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTT
GTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTT
CTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATT
TACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTA
TGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATA
CAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACT
GACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGT
GGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATT
GGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTT
CTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCC
AGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCAT
TGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCT
CCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAA
CTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAG
CTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGA
GCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTC
ACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGA
GGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTT
ATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAG
TGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAAC
GAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGA
TGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGG
ACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCT
CCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGA
AACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAA
CTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATC
TGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGG
GCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACT
CATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAA
AGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACT
CAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTA
TTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACT
GATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGG
GGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGT
CTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTC
CTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGG
TTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGT
GGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAG
GAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGC
ACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTT
TTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAA
TTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAA
AATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATA
TATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACT
CGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCC

>In-frame_NTRK2_ENST00000376208_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_2331nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_7241nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT
GTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCC
CAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAA
GTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGC
CCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCAT
GAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCT
TGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATT
ATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGT
GTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAAT
ACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGG
AGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAG
TTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTT
GTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTT
CTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATT
TACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTA
TGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATA
CAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACT
GACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGT
GGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATT
GGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTT
CTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCC
AGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCAT
TGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCT
CCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAA
CTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAG
CTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGA
GCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTC
ACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGA
GGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTT
ATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAG
TGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAAC
GAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGA
TGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGG
ACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCT
CCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGA
AACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAA
CTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATC
TGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGG
GCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACT
CATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAA
AGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACT
CAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTA
TTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACT
GATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGG
GGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGT
CTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTC
CTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGG
TTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGT
GGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAG
GAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGC
ACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTT
TTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAA
TTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAA
AATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATA
TATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACT
CGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCC

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_7240nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT
GTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCC
CAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAA
GTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGC
CCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCAT
GAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCT
TGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATT
ATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGT
GTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAAT
ACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGG
AGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAG
TTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTT
GTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTT
CTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATT
TACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTA
TGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATA
CAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACT
GACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGT
GGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATT
GGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTT
CTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCC
AGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCAT
TGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCT
CCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAA
CTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAG
CTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGA
GCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTC
ACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGA
GGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTT
ATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAG
TGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAAC
GAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGA
TGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGG
ACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCT
CCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGA
AACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAA
CTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATC
TGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGG
GCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACT
CATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAA
AGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACT
CAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTA
TTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACT
GATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGG
GGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGT
CTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTC
CTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGG
TTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGT
GGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAG
GAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGC
ACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTT
TTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAA
TTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAA
AATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATA
TATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACT
CGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCC

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_7240nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT
GTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCC
CAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAA
GTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGC
CCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCAT
GAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCT
TGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATT
ATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGT
GTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAAT
ACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGG
AGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAG
TTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTT
GTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTT
CTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATT
TACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTA
TGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATA
CAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACT
GACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGT
GGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATT
GGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTT
CTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCC
AGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCAT
TGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCT
CCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAA
CTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAG
CTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGA
GCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTC
ACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGA
GGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTT
ATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAG
TGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAAC
GAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGA
TGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGG
ACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCT
CCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGA
AACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAA
CTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATC
TGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGG
GCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACT
CATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAA
AGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACT
CAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTA
TTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACT
GATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGG
GGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGT
CTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTC
CTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGG
TTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGT
GGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAG
GAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGC
ACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTT
TTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAA
TTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAA
AATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATA
TATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACT
CGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCC

>In-frame_NTRK2_ENST00000277120_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_2331nt
GGAGCAGGAGCCTCGCTGGCTGCTTCGCTCGCGCTCTACGCGCTCAGTCCCCGGCGGTAGCAGGAGCCTGGACCCAGGCGCCGCCGGCGG
GCGTGAGGCGCCGGAGCCCGGCCTCGAGGTGCATACCGGACCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGC
GCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGACGGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTC
GCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAACACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACG
CCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGG
GACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGC
TGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCT
CCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTA
GAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAA
GCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGAC
TTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCA
GACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCA
AATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTAT
TGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGAC
AGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATC
ACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTAT
AACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGAT
AATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATG
GGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAG
GAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTG
AACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGC
CTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCA
GGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGC
CCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCC
AAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCT

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_7111nt
CCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGAC
GGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAA
CACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGC
AGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGT
CCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTC
CCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTG
TAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGAC
TGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTA
CCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCT
CCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGA
ATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGT
CTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAA
CAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAG
GAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCA
TTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTA
AAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAG
CCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGT
ATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGC
TGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGC
TGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGA
AAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGA
CCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCC
AGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAG
CACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTG
CACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTT
TAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGT
GACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGA
AAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGC
CCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAG
AGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAA
AAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTT
TATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCA
TCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAG
GACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGA
GCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTG
CTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGA
TGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTC
CCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGAT
TCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCAC
TGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGC
GCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTG
AAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAA
AGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTG
GAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTC
CGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCAC
TTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTG
GTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGAT
GGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTG
GGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTG
CTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGT
TAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCT
TGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTA
TATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAA
CAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAG
GGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGC
CGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGG
CTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCT
CCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGAC
CTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTC
TCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCAT
GGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTC
TGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAA
ACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGT
TTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGT
GAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTT
GCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGT
GTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGG
TGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCT
TACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTC
ACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCAT
ACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGA
GTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTC
ATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGAT
ACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAA
ATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAG
AATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGAT
TTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAA
AAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTC
CTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCCTTGGCGTGCCCCTTTGTGTATGAATAAACTTCTCTCCCCC

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_7110nt
CCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGAC
GGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAA
CACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGC
AGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGT
CCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTC
CCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTG
TAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGAC
TGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTA
CCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCT
CCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGA
ATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGT
CTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAA
CAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAG
GAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCA
TTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTA
AAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAG
CCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGT
ATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGC
TGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGC
TGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGA
AAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGA
CCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCC
AGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAG
CACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTG
CACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTT
TAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGT
GACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGA
AAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGC
CCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAG
AGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAA
AAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTT
TATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCA
TCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAG
GACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGA
GCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTG
CTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGA
TGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTC
CCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGAT
TCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCAC
TGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGC
GCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTG
AAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAA
AGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTG
GAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTC
CGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCAC
TTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTG
GTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGAT
GGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTG
GGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTG
CTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGT
TAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCT
TGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTA
TATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAA
CAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAG
GGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGC
CGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGG
CTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCT
CCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGAC
CTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTC
TCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCAT
GGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTC
TGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAA
ACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGT
TTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGT
GAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTT
GCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGT
GTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGG
TGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCT
TACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTC
ACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCAT
ACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGA
GTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTC
ATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGAT
ACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAA
ATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAG
AATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGAT
TTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAA
AAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTC
CTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCCTTGGCGTGCCCCTTTGTGTATGAATAAACTTCTCTCCCCC

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_7110nt
CCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGAC
GGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAA
CACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGC
AGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGT
CCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTC
CCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTG
TAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGAC
TGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTA
CCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCT
CCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGA
ATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGT
CTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAA
CAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAG
GAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCA
TTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTA
AAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAG
CCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGT
ATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGC
TGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGC
TGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGA
AAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGA
CCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCC
AGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAG
CACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTG
CACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTT
TAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGT
GACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGA
AAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGC
CCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAG
AGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAA
AAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTT
TATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCA
TCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAG
GACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGA
GCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTG
CTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGA
TGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTC
CCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGAT
TCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCAC
TGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGC
GCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTG
AAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAA
AGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTG
GAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTC
CGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCAC
TTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTG
GTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGAT
GGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTG
GGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTG
CTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGT
TAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCT
TGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTA
TATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAA
CAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAG
GGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGC
CGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGG
CTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCT
CCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGAC
CTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTC
TCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCAT
GGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTC
TGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAA
ACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGT
TTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGT
GAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTT
GCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGT
GTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGG
TGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCT
TACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTC
ACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCAT
ACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGA
GTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTC
ATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGAT
ACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAA
ATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAG
AATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGAT
TTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAA
AAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTC
CTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCCTTGGCGTGCCCCTTTGTGTATGAATAAACTTCTCTCCCCC

>In-frame_NTRK2_ENST00000323115_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_2201nt
CCCCCATTCGCATCTAACAAGGAATCTGCGCCCCAGAGAGTCCCGGGAGCGCCGCCGGTCGGTGCCCGGCGCGCCGGGCCATGCAGCGAC
GGCCGCCGCGGAGCTCCGAGCAGCGGTAGCGCCCCCCTGTAAAGCGGTTCGCTATGCCGGGGCCACTGTGAACCCTGCCGCCTGCCGGAA
CACTCTTCGCTCCGGACCAGCTCAGCCTCTGATAAGCTGGACTCGGCACGCCCGCAACAAGCACCGAGGAGTTAAGAGAGCCGCAAGCGC
AGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGATGTCGT
CCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCGCCTGTC
CCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTAACAGTG
TAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGAC
TGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTA
CCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCT
CCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGA
ATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGT
CTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAA
CAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAG
GAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCA
TTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTA
AAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAG
CCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGT
ATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGC
TGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGC
TGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGA
AAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGA
CCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCC
AGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAG
CACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTG

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_6847nt
AAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGA
TGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCG
CCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTA
ACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATG
TGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCA
ATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTA
CATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCA
GCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAG
GAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGA
ATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATC
TTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACT
GGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCT
GTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTC
TAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGT
ACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGA
ATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGG
AGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCC
TGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGC
ACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGA
AGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGA
CAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCT
CAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGG
CGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGG
CGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCC
AGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTT
GCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGT
CATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGA
CATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCC
TTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGG
CTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCT
GTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACAC
CTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTG
GCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAA
TTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTT
GGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAG
GCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCT
GTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTT
CAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGA
TTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGA
TTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAG
TCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGG
GCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGG
GCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTT
TCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGG
GGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGT
CACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGA
TTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGC
AAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATA
CTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTT
AATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCC
CAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCA
GGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTA
CGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGC
TCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTT
CAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCC
CCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTA
GCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAG
GAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCG
CCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAG
ACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGA
AGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAG
GGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTA
AATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCC
TGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCA
TTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCT
GCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGA
ACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGG
GTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTAT
TCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCG
TAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATG
GAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGA
AAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCAT
ATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGC
AAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTATTTAATTCATA
AAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCT
GCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCCTTGGCGTGCCCCTTTGTGTATGAATAAACTTCTC

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_6846nt
AAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGA
TGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCG
CCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTA
ACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATG
TGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCA
ATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTA
CATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCA
GCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAG
GAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGA
ATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATC
TTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACT
GGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCT
GTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTC
TAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGT
ACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGA
ATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGG
AGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCC
TGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGC
ACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGA
AGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGA
CAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCT
CAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGG
CGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGG
CGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCC
AGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTT
GCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGT
CATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGA
CATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCC
TTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGG
CTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCT
GTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACAC
CTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTG
GCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAA
TTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTT
GGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAG
GCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCT
GTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTT
CAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGA
TTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGA
TTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAG
TCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGG
GCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGG
GCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTT
TCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGG
GGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGT
CACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGA
TTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGC
AAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATA
CTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTT
AATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCC
CAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCA
GGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTA
CGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGC
TCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTT
CAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCC
CCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTA
GCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAG
GAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCG
CCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAG
ACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGA
AGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAG
GGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTA
AATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCC
TGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCA
TTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCT
GCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGA
ACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGG
GTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTAT
TCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCG
TAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATG
GAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGA
AAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCAT
ATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGC
AAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTATTTAATTCATA
AAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCT
GCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCCTTGGCGTGCCCCTTTGTGTATGAATAAACTTCTC

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_6846nt
AAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGA
TGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCG
CCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTA
ACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATG
TGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCA
ATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTA
CATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCA
GCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAG
GAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGA
ATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATC
TTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACT
GGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCT
GTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTC
TAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGT
ACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGA
ATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGG
AGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCC
TGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGC
ACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGA
AGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGA
CAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCT
CAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTCTGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGG
CGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAACTTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGG
CGAAGTGACATCTTTCTAACCAGATAGGCCATTGCTTTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCC
AGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGATCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTT
GCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTCCTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGT
CATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGAAACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGA
CATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTAGGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCC
TTATTTTATTAATTAATTATTTGTGCTGCTTTTGACAGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGG
CTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGGCAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCT
GTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAGTCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACAC
CTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGCCCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTG
GCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGTAGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAA
TTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGTTCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTT
GGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTACGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAG
GCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCCCCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCT
GTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGAAGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTT
CAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAGTTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGA
TTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAAAAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGA
TTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCCTGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAG
TCCGTGGAGGCCCATCACACCAGCATCCGTGACGCCAGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGG
GCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTCCAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGG
GCCCACTTCATATCACACAAAATGAATTTTCTATAAAGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTT
TCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCAGCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGG
GGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAGCACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGT
CACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCACCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGA
TTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTAAAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGC
AAACGTTAACAAACCCCATCGTGGTCCATGGAGCCTTTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATA
CTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAGCATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTT
AATTTATATCTGTACATATTAGACACACGCGAGCCATCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCC
CAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCGAGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCA
GGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAATGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTA
CGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCACGCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGC
TCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTGTCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTT
CAACCTCCATTTATATATTTTTATAATGTTAAGCCACTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCC
CCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTCTTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTA
GCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTGCAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAG
GAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGACCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCG
CCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTAACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAG
ACAAAAACTACCCTAAAATGTGGAGATTTACTCCTTTTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGA
AGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTTTGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAG
GGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACCTTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTA
AATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTGCTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCC
TGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGGCACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCA
TTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCTGGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCT
GCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGTTAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGA
ACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAGGATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGG
GTTCATACTGTGAAATAAACTAAAATGAAACCAAAACGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTAT
TCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAAAGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCG
TAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGAAAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATG
GAAGATACTTTCAAAAGGACATCTTCAGATCATAAGTCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGA
AAGGAAATATTCACTTTACATTTTAACATCAACTTTTAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCAT
ATTAAGAATGTAATTATTTCCTTATTGTATTTTTTAAAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGC
AAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCCACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTATTTAATTCATA
AAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAAATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCT
GCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGTGTAACCCTAGACTGGCGCCCTTGGCGTGCCCCTTTGTGTATGAATAAACTTCTC

>In-frame_NTRK2_ENST00000359847_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1937nt
AAGCGCAGGGAAGGCCTCCCCGCACGGGTGGGGGAAAGCGGCCGGTGCAGCGCGGGGACAGGCACTCGGGCTGGCACTGGCTGCTAGGGA
TGTCGTCCTGGATAAGGTGGCATGGACCCGCCATGGCGCGGCTCTGGGGCTTCTGCTGGCTGGTTGTGGGCTTCTGGAGGGCCGCTTTCG
CCTGTCCCACGTCCTGCAAATGCAGTGCCTCTCGGATCTGGTGCAGCGACCCTTCTCCTGGCATCGTGGCATTTCCGAGATTGGAGCCTA
ACAGTGTAGATCCTGAGAACATCACCGAAATTTTCATCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATG
TGGGACTGAGAAATCTGACAATTGTGGATTCTGGATTAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCA
ATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGAAACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTA
CATGCTCCTGTGACATTATGTGGATCAAGACTCTCCAAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCA
GCAAGAATATTCCCCTGGCAAACCTGCAGATACCCAATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAG
GAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTGATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGA
ATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATC
TTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTGTGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACT
GGTGCATTCCATTCACTGTGAAAGGCAACCCCAAACCAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCT
GTACTAAAATACATGTTACCAATCACACGGAGTACCACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTC
TAATAGCCAAGAATGAGTATGGGAAGGATGAGAAACAGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGT
ACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCAAGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGA
ATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACCTTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGG
AGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGAAGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCC
TGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGCTGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGC
ACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTGACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGA
AGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAGGGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGA
CAGCAGCACCACTCCAGCCTCAGAGACTGCACACCCCCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCT

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000360265_chr4_7776630_-_6631nt
GAGTGCGCATGCATTTTTCCTTCCACAGAAAACATACAACCATGTTTCTGCCAACGTAGTTGACCAAGATAACCTGTTTTTTAATTTTCA
TCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGAT
TAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGA
AACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCC
AAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCA
ATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTG
ATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAA
CTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTG
TGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAAC
CAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACC
ACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAAC
AGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCA
AGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACC
TTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGA
AGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGC
TGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTG
ACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAG
GGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCC
CCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTC
TGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAAC
TTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCT
TTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGA
TCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTC
CTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGA
AACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTA
GGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGAC
AGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGG
CAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAG
TCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGC
CCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGT
AGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGT
TCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTA
CGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCC
CCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGA
AGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAG
TTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAA
AAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCC
TGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCC
AGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTC
CAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAA
AGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCA
GCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAG
CACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCA
CCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTA
AAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCT
TTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAG
CATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCA
TCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCG
AGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAA
TGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCAC
GCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTG
TCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCA
CTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTC
TTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTG
CAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGA
CCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTA
ACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTT
TTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTT
TGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACC
TTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTG
CTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGG
CACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCT
GGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGT
TAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAG
GATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAA
CGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAA
AGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGA
AAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAG
TCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTT
TAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTA
AAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCC
ACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAA
ATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGT

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000358461_chr4_7776630_-_6630nt
GAGTGCGCATGCATTTTTCCTTCCACAGAAAACATACAACCATGTTTCTGCCAACGTAGTTGACCAAGATAACCTGTTTTTTAATTTTCA
TCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGAT
TAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGA
AACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCC
AAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCA
ATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTG
ATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAA
CTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTG
TGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAAC
CAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACC
ACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAAC
AGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCA
AGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACC
TTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGA
AGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGC
TGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTG
ACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAG
GGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCC
CCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTC
TGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAAC
TTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCT
TTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGA
TCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTC
CTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGA
AACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTA
GGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGAC
AGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGG
CAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAG
TCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGC
CCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGT
AGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGT
TCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTA
CGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCC
CCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGA
AGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAG
TTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAA
AAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCC
TGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCC
AGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTC
CAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAA
AGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCA
GCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAG
CACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCA
CCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTA
AAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCT
TTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAG
CATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCA
TCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCG
AGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAA
TGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCAC
GCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTG
TCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCA
CTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTC
TTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTG
CAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGA
CCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTA
ACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTT
TTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTT
TGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACC
TTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTG
CTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGG
CACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCT
GGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGT
TAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAG
GATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAA
CGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAA
AGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGA
AAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAG
TCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTT
TAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTA
AAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCC
ACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAA
ATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGT

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000420658_chr4_7776630_-_6630nt
GAGTGCGCATGCATTTTTCCTTCCACAGAAAACATACAACCATGTTTCTGCCAACGTAGTTGACCAAGATAACCTGTTTTTTAATTTTCA
TCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGAT
TAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGA
AACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCC
AAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCA
ATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTG
ATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAA
CTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTG
TGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAAC
CAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACC
ACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAAC
AGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCA
AGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACC
TTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGA
AGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGC
TGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTG
ACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAG
GGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCC
CCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTC
TGAGGCCAGTGCCTGTCCCCCAGGCCCACTTGTATTCTTTCTACTGTAAAATGGCGCCTTTAAAAAAGATGTAAGACTTTGGTTCCCAAC
TTTGTTAAAAAACAAAAAAAGTGATGGAAAGGTGTTTGAAAGGATGCTATCAGGCGAAGTGACATCTTTCTAACCAGATAGGCCATTGCT
TTCACCGATTCCAACCCAGCCCTGGACTGAGGATGGATGGTTCCATGAGCCCCCAGATGAAAACCTGGATTCGACAGGGAAGAGCTTGGA
TCCCCGGCTGCCCCGGGCATGAGTGTGGCTGGCCATGGGCACTGGGCTCGCCTTGCACGCCCACCAGGAGGGCCAGGGGCATACGCAGTC
CTGACGTGGACTTTGTGTCTTGGCGTACCCTCTCCACGTGCCCGTCCCCCTCGTCATCAGAGGTAAAGGCATGAGAAAATCGCGCTGTGA
AACGTTTTTTACCTTTTATTATTATTTTTTGGACAGATGCTTTTGTCACCAAGACATGAAAAGCTGCCATTCTTCTTAACCTGTTTTTTA
GGAATGTCTTTTTACTGTGTGTCACACTTAGATCAAGGAGTTTTCAGAGGTTCCTTATTTTATTAATTAATTATTTGTGCTGCTTTTGAC
AGGTAGCAGAGGGTTTTAATACTTCACTAACAGTACACCCTCCTCCCCCTTGGGCTAGCATCCCCAGCCCTTAATCCACGTCGGAGCCGG
CAGGTGCTTCTCACACCAGGAGCCTCTGGGGGCAGGGGCTGGCTCCTCGCCGCTGTACAGGACGTTTACTGCTGCTTGGGGCCAGGGCAG
TCCTTTGAAAGGGAAGCAAGTTCCGGAATTTGTTCGCTCATGGAACTATAACACCTTAGAGCAAGAGGCAGGAATTCCAGGGCCTCCTGC
CCCTCCCCTTCCTCCAGCTTGTCAAGTTAAACCACTAATGTGTTGGTGGGCCTGGCCGTGCTGCCTCTCCTGAGTAGGGTGGGTGCAAGT
AGGGCCTCTTTCCCAGCTTTCTTGCTTGCCTTCTGTGCAATATTTCTTGGAGAATTTGGATGCCTAAGGCATAAAGGAAAAAAACAGAGT
TCATAGTTTGAGCTGGTATTTACCCCCTGGGTTTAAAAATCAGATTAACTTCTTGGTCTCCCGGAGGCTGCTGTCAGGAATTCTCCAGTA
CGGGAAGATGCAGTCACTTATGACGAAATAAGTCACCCCTGAACGCCTCCGCAGGCAGATTCATGGAGACCAGTCCCAGTAGCAACCGCC
CCTTCCCCAAGCATAGAATACAGAGGTGCCATACTTGGTGTAAGCCTTCCTTCTGTCCACTGTCCAGAATGTCCTTTTTCACACAGAGGA
AGAGATGGCGGGAAAACACTGACTGACTCCTTGGGTTTCCCCCAGACATACTTTCAGAGCGCTAGCTGTGTGGTGCACGGGACTTTACAG
TTAGGATTCATGTTTAAGGTGGTGGCGCTTGAGGCCTGCAAGGGCCACGTTGGATTACTGAAGCGGAAAGCGGTCTCCCATGTATAAGAA
AAAGTTTTACAACACGAATTGGAAGCTGCTTGAGTCCACCTGAACTTGAATTGATTGCAAAGCCATCTGCTGGGAACGGTTTTGGGTTCC
TGAGCCATCAGCCAGCCTTTCTTTCCCCTCTGATGCACGTTCCTCCCGGCCTAGTCCGTGGAGGCCCATCACACCAGCATCCGTGACGCC
AGCTTCCCACTAGGACATCCAGGCAGGTCGGGCGGGGACGCCACACACCTCAGGGCCGTCCGCTGCATTGCCATAGAGGAGCCCTCCCTC
CAGTGGTCACTTCCCACCATTGCAGGCAGACTTCCCACCATTGCAGGCAGCTGGGCCCACTTCATATCACACAAAATGAATTTTCTATAA
AGGGAAAAAAGTTTGCTCCTCCATAGATTTTTGCTGCCTTCGGGTCAAATAGTTTCCCTGGTTGACACTCTTGGGCCACTCTGATTGGCA
GCCTGCTTTGCCAAAGAGAACTGTGTGAGGTTTTGGTGGTTAGTAAGAGAAGGGGGAGATGGCCAGCCTGAAGTCACGGTCCTGGCCCAG
CACAGGTGGGCAGCAGCGAGCTGGCAGGTGAAGTGTGAGCAGCACGCAAAGTGTCACGTGGGCCTTAGCCGTCACCCACCAGCTTCCTCA
CCAGGCAAGGAGGCCCCGGAGCCTTAGCAGGGACTTGCCCAACGGCACAGCTGATTGGTGCTCGACTCCCAGCATGCATATTTTGTTGTA
AAAACCCAGGTTTGTAATTCACATCCACAACCCTAAGCCTTTTAAAGCGGAGGCAAACGTTAACAAACCCCATCGTGGTCCATGGAGCCT
TTCAAAATGGGTGCCCTGGAGGGGCCTGACAGTGGGTTCCTTCCATGGCGGATACTCCCTTGAAATTTCACATTCCATCAAAGTTTAAAG
CATTTACTTCAGAATAAGTTATTTATGTGTATATGTTCAATAAATATAGTTTTTAATTTATATCTGTACATATTAGACACACGCGAGCCA
TCTTGCCAGAATTCTGACAGTGATGTCATTTTATTCCCCTCCCAAAACATGCCCCAGGAACAAGCACCCCTTGCCTCTGTGGCAGCTGCG
AGTGTGTCTGATTTCATAACGAAGCCAGGCTGAGGGCAAGAGGCCCGACAGGCAGGCCAGGGTCCCCGGAGAAGCCGGATTTCTTCGCAA
TGTCACTGGTACTTAGCAGATGGTCGTGTTCACAGGGGCTAGCCACCTGTACTACGGTGCCGACCGCAATGCGAGGAATGTGGTGGCCAC
GCGATGGAGCTGGCCGGAGGACAGGTCAGGTGAGGGGGCCGACCCCTGCGGGGCTCAGGGCTCCTTCCATTCTAACCTTGAGCCACAGTG
TCACTCTTCAGGGCTCTGCTCCTGGCTCTATTTTGTTAAGGTGTCATCAGCCTTCAACCTCCATTTATATATTTTTATAATGTTAAGCCA
CTGACCAACTTTTTCATAGAAACAACTATCAGATTCGAGGGCTCCCTTTGTCCCCCTGACCTGGGCACAGGCATGGGCGATGGCTCCCTC
TTCCCAGAATCTGCGGGGAACTGGGGCAAGGCCCATCTGTCTGCAAGGCTGGTAGCTCTCTCCCTCGGCTTCCAGAGTCCACGGCAGTTG
CAAGGTAACCAGTGTGGATCTGCTGAGTCACCCCAGGCACCAGACTTACCCCAGGAGCATGGGCCACTGTCCATGGGGCCTTCCTTGAGA
CCTTCCCTTGGGGCTGGCGGGCGGCGGCTTACCAGCTGGGTCAGTCCCATCTCGCCCCTCTGTGCCTATGCCCTGGCGTTGCCAGGCTTA
ACCTTCCCCTGTATCTTACTCATCCCAGAATTATTACTGGCCATTTCTAAATAGACAAAAACTACCCTAAAATGTGGAGATTTACTCCTT
TTGAAAAGTCTGTTTCAAAAAGTGTGGCCTCAGCTCTGGAGGCCACCCCCAGGAAGGAGTTTGAGGTTCATTGTCATTATGGCCACAGTT
TGGTGCTTGTGCACGGGACTCAAAGGGCAGCGTCGAAGCTGGGGTTAGGTGTAGGGTTGTGAGCAAAGCTCCCCTGTTTGTGGCCACACC
TTCCCTTTCCAAAAAGGCTATTAATTCTACTCACCCACTATTTGGGGGGATGTAAATTTTGCCCACAGACTTTGCCACCCAGGTGAGGTG
CTGTGTTCATGCACGGAACTGATGTCATTAGACACCATCCAAGGATGGGCAGCCTGCAGTGTGGCCGGCGACTGCCATCCAGAGAAAAGG
CACCTTGTGCCACAGGGCGGGGCCGACACCCTGAGCTCACAGGTGGCCCCTGCATTCAGGTGGATGTCCATCCTTGAAACAGCCTCTTCT
GGGAACACAGCACTGGAGGTCTCCAGGCATCAGGGTTGGCCGGCAGGGTGCCCTGCAGCTTACATAAAGGTCGTGGCAATGTTTCAATGT
TAAACTAAACTATTGCCTTCCTCTTACTTTTCCTAAAATGATTTTCTAATGGGAACAGTCACTTCAAGTTCATGACATAGTTTGAAGGAG
GATAATTCATTTTTTCCTGGTTGTCACTGTCTTCTTATCCCCTTGGTGGGCTGGGTTCATACTGTGAAATAAACTAAAATGAAACCAAAA
CGTTCCTGCCGTAAATACGTGGCACAGCACTGCAGAAAAAGCAGTCACCTCTATTCGTGAGTCCCCAAGCCATAGCAGGGCGTCTGTAAA
AGAAGGGAAACTGCACCCAGGAAGTGGTGGGCGTCAGACGCATCCTTTCGCCCGTAGTTCATGAAATAGTTCCGGCTTTGGTCTTCCAGA
AAATCTCAACTTCACCGTGCACAAGTGTTACCGGGTCTTTTTAGTGTAGCCATGGAAGATACTTTCAAAAGGACATCTTCAGATCATAAG
TCTTAGGACCAAAGGTGTTTTTAATGAGATAATCTTTTTGATTTTCTAACAAGAAAGGAAATATTCACTTTACATTTTAACATCAACTTT
TAAGTGATATTCAGAATTAATTGACCATGGTGATACGTTGTAAAATGTTTTCATATTAAGAATGTAATTATTTCCTTATTGTATTTTTTA
AAAGCTAAAGTCATATTTAAAATTCTCTTTGAAAGAAACAGGCAAAGAAACAGCAAAGATTTTTTTAAATTAAATATGTTAGTAGTGCCC
ACTTCAAATGACTGTAAATATATTTTCACTGTTTCTCAATGTATTTAATTCATAAAGTAAAAATTTTATGAAAAGAAACTTGCAAGGAAA
ATCCTAGTTTTCAGTCCACTCGCCCCACTTTGTAGTAGCTTCACTGAATTTCCTGCTTTCCTGGTTGAATTTTCTACTGTTTCACGTGGT

>In-frame_NTRK2_ENST00000395866_chr9_87342874_+_AFAP1_ENST00000382543_chr4_7776630_-_1721nt
GAGTGCGCATGCATTTTTCCTTCCACAGAAAACATACAACCATGTTTCTGCCAACGTAGTTGACCAAGATAACCTGTTTTTTAATTTTCA
TCGCAAACCAGAAAAGGTTAGAAATCATCAACGAAGATGATGTTGAAGCTTATGTGGGACTGAGAAATCTGACAATTGTGGATTCTGGAT
TAAAATTTGTGGCTCATAAAGCATTTCTGAAAAACAGCAACCTGCAGCACATCAATTTTACCCGAAACAAACTGACGAGTTTGTCTAGGA
AACATTTCCGTCACCTTGACTTGTCTGAACTGATCCTGGTGGGCAATCCATTTACATGCTCCTGTGACATTATGTGGATCAAGACTCTCC
AAGAGGCTAAATCCAGTCCAGACACTCAGGATTTGTACTGCCTGAATGAAAGCAGCAAGAATATTCCCCTGGCAAACCTGCAGATACCCA
ATTGTGGTTTGCCATCTGCAAATCTGGCCGCACCTAACCTCACTGTGGAGGAAGGAAAGTCTATCACATTATCCTGTAGTGTGGCAGGTG
ATCCGGTTCCTAATATGTATTGGGATGTTGGTAACCTGGTTTCCAAACATATGAATGAAACAAGCCACACACAGGGCTCCTTAAGGATAA
CTAACATTTCATCCGATGACAGTGGGAAGCAGATCTCTTGTGTGGCGGAAAATCTTGTAGGAGAAGATCAAGATTCTGTCAACCTCACTG
TGCATTTTGCACCAACTATCACATTTCTCGAATCTCCAACCTCAGACCACCACTGGTGCATTCCATTCACTGTGAAAGGCAACCCCAAAC
CAGCGCTTCAGTGGTTCTATAACGGGGCAATATTGAATGAGTCCAAATACATCTGTACTAAAATACATGTTACCAATCACACGGAGTACC
ACGGCTGCCTCCAGCTGGATAATCCCACTCACATGAACAATGGGGACTACACTCTAATAGCCAAGAATGAGTATGGGAAGGATGAGAAAC
AGATTTCTGCTCACTTCATGGGCTGGCCTGGAATTGACGATGATGCTGCCCAGTACAAGTATGGCAAGAACCGGGTAGAAGCAGATGCCA
AGCGGCTACAGACCAAAGAGGAGGAGCTGCTGAAGAGGAAAGAGGCCCTGCGGAATAGGCTGGCCCAGCTCCGCAAGGAAAGAAAAGACC
TTCGAGCGGCTATTGAAGTGAACGCCGGCAGGAAGCCGCAGGCGATCCTGGAGGAGAAGCTGAAGCAGCTGGAGGAGGAGTGCCGGCAGA
AGGAGGCGGAGCGTGTCAGCCTGGAGCTGGAGCTGACGGAGGTCAAGGAGAGCCTGAAGAAAGCGCTGGCGGGCGGAGTCACCCTGGGGC
TGGCCATCGAGCCCAAGTCAGGGACATCGAGTCCACAGTCTCCAGTGTTCCGGCACCGGACCCTGGAAAACTCGCCCATCTCCAGCTGTG
ACACCAGTGACACCGAGGGCCCCGTGCCGGTGAACAGCGCGGCCGTCTTGAAGAAGAGCCAGGCTGCCCCGGGCAGCTCCCCCTGCCGAG
GGCATGTGCTGCGGAAGGCCAAGGAATGGGAATTGAAGAACGGGACCTAGGGGACAGCAGCACCACTCCAGCCTCAGAGACTGCACACCC
CCTTGCCTGTATCCTCATCTGTGTGACGGCAGGAAGCTCTGCCCAGAGTGGCCTCAGCTGCACGACTCCAGAGGCTCCACGACTGAGCTC


Top

FusionGenePPI for NTRK2_AFAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NTRK2NTF3, FYN, FRS2, SHC1, PLCG1, BDNF, NTF4, SHC3, GIPC1, SQSTM1, PIK3R1, SH2B1, NCK2, PTPN1, TRAF6, HSP90AA1, POLR2G, AP1B1, NMNAT1, RANBP9, TNK2, EGFRAFAP1AFAP1, ACTC1, PRKCB, PRKCE, PRKCG, PRKCD, PRKCA, MYC, NXF1, BRCA1, CAPZA2, CDK2, DBN1, FLNA, GAK, MYH9, MYO1C, PPP1CB, IQGAP1, SYNPO, MAPRE1, TPX2, LIMA1, ANLN, MYO5C, MYO19, MYO18A, EXT2, TRIM25, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneAFAP1chr9:87342874chr4:7776630ENST00000358461-1217594_637548731F-actin
TgeneAFAP1chr9:87342874chr4:7776630ENST00000360265-1116594_637548731F-actin


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneAFAP1chr9:87342874chr4:7776630ENST00000382543-1217594_637632815F-actin
TgeneAFAP1chr9:87342874chr4:7776630ENST00000420658-1318594_637632815F-actin


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NTRK2_AFAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneNTRK2Q16620DB00321AmitriptylineBDNF/NT-3 growth factors receptorsmall moleculeapproved

Top

RelatedDiseases for NTRK2_AFAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNTRK2C0011570Mental Depression5PSYGENET
HgeneNTRK2C0011581Depressive disorder5PSYGENET
HgeneNTRK2C0041696Unipolar Depression5PSYGENET
HgeneNTRK2C0525045Mood Disorders5PSYGENET
HgeneNTRK2C1269683Major Depressive Disorder5PSYGENET
HgeneNTRK2C0005586Bipolar Disorder3CTD_human;PSYGENET
HgeneNTRK2C0036341Schizophrenia2PSYGENET
HgeneNTRK2C0038220Status Epilepticus2CTD_human
HgeneNTRK2C0236736Cocaine-Related Disorders2CTD_human
HgeneNTRK2C0424295Hyperactive behavior2CTD_human
HgeneNTRK2C0001973Alcoholic Intoxication, Chronic1PSYGENET
HgeneNTRK2C0004114Astrocytoma1CTD_human
HgeneNTRK2C0004352Autistic Disorder1CTD_human
HgeneNTRK2C0008073Developmental Disabilities1CTD_human
HgeneNTRK2C0013415Dysthymic Disorder1PSYGENET
HgeneNTRK2C0017638Glioma1CTD_human
HgeneNTRK2C0020505Hyperphagia1CTD_human;HPO
HgeneNTRK2C0027819Neuroblastoma1CTD_human
HgeneNTRK2C0028754Obesity1CTD_human;HPO
HgeneNTRK2C0036349Paranoid Schizophrenia1PSYGENET
HgeneNTRK2C0678807prenatal alcohol exposure1PSYGENET
HgeneNTRK2C0752347Lewy Body Disease1CTD_human
HgeneNTRK2C3146244Alcohol Related Birth Defect1PSYGENET
HgeneNTRK2C3151303Obesity, Hyperphagia, and Developmental Delay1UNIPROT