FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2489

FusionGeneSummary for ARHGDIA_SQSTM1

check button Fusion gene summary
Fusion gene informationFusion gene name: ARHGDIA_SQSTM1
Fusion gene ID: 2489
HgeneTgene
Gene symbol

ARHGDIA

SQSTM1

Gene ID

396

8878

Gene nameRho GDP dissociation inhibitor alphasequestosome 1
SynonymsGDIA1|HEL-S-47e|NPHS8|RHOGDI|RHOGDI-1A170|DMRV|FTDALS3|NADGP|OSIL|PDB3|ZIP3|p60|p62|p62B
Cytomap

17q25.3

5q35.3

Type of geneprotein-codingprotein-coding
Descriptionrho GDP-dissociation inhibitor 1GDP-dissociation inhibitor, aplysia RAS-related 1Rho GDP dissociation inhibitor (GDI) alphaepididymis secretory sperm binding protein Li 47esequestosome-1EBI3-associated protein of 60 kDaEBI3-associated protein p60EBIAPoxidative stress induced likephosphotyrosine independent ligand for the Lck SH2 domain p62phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDaubiquitin-bi
Modification date2018052320180523
UniProtAcc

P52565

Q13501

Ensembl transtripts involved in fusion geneENST00000582520, ENST00000269321, 
ENST00000400721, ENST00000584461, 
ENST00000541078, ENST00000580685, 
ENST00000581876, 
ENST00000376929, 
ENST00000506690, ENST00000389805, 
ENST00000402874, ENST00000510187, 
ENST00000360718, 
Fusion gene scores* DoF score5 X 2 X 5=5017 X 12 X 8=1632
# samples 623
** MAII scorelog2(6/50*10)=0.263034405833794
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(23/1632*10)=-2.82693529102712
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARHGDIA [Title/Abstract] AND SQSTM1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSQSTM1

GO:0007032

endosome organization

27368102

TgeneSQSTM1

GO:0061635

regulation of protein complex stability

25127057

TgeneSQSTM1

GO:1905719

protein localization to perinuclear region of cytoplasm

27368102


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-CR-7398-01AARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
TCGARVSKCMTCGA-EB-A1NK-01AARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000582520ENST00000376929ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000582520ENST00000506690ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000582520ENST00000389805ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000582520ENST00000402874ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000582520ENST00000510187ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000582520ENST00000360718ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
In-frameENST00000269321ENST00000376929ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000269321ENST00000506690ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000269321ENST00000389805ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000269321ENST00000402874ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000269321ENST00000510187ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
5CDS-intronENST00000269321ENST00000360718ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-3CDSENST00000400721ENST00000376929ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000400721ENST00000506690ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000400721ENST00000389805ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000400721ENST00000402874ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000400721ENST00000510187ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000400721ENST00000360718ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-3CDSENST00000584461ENST00000376929ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000584461ENST00000506690ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000584461ENST00000389805ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000584461ENST00000402874ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000584461ENST00000510187ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000584461ENST00000360718ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-3CDSENST00000541078ENST00000376929ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000541078ENST00000506690ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000541078ENST00000389805ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000541078ENST00000402874ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000541078ENST00000510187ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000541078ENST00000360718ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-3CDSENST00000580685ENST00000376929ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000580685ENST00000506690ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000580685ENST00000389805ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000580685ENST00000402874ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000580685ENST00000510187ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000580685ENST00000360718ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-3CDSENST00000581876ENST00000376929ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000581876ENST00000506690ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000581876ENST00000389805ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000581876ENST00000402874ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000581876ENST00000510187ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+
intron-intronENST00000581876ENST00000360718ARHGDIAchr17

79825598

-SQSTM1chr5

179250858

+

Top

FusionProtFeatures for ARHGDIA_SQSTM1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARHGDIA

P52565

SQSTM1

Q13501

Controls Rho proteins homeostasis. Regulates the GDP/GTPexchange reaction of the Rho proteins by inhibiting thedissociation of GDP from them, and the subsequent binding of GTPto them. Retains Rho proteins such as CDC42, RAC1 and RHOA in aninactive cytosolic pool, regulating their stability and protectingthem from degradation. Actively involved in the recycling anddistribution of activated Rho GTPases in the cell, mediatesextraction from membranes of both inactive and activated moleculesdue its exceptionally high affinity for prenylated forms. Throughthe modulation of Rho proteins, may play a role in cell motilityregulation. In glioma cells, inhibits cell migration and invasionby mediating the signals of SEMA5A and PLXNB3 that lead toinactivation of RAC1. {ECO:0000269|PubMed:20400958,ECO:0000269|PubMed:23434736}. Autophagy receptor required for selective macroautophagy(aggrephagy). Functions as a bridge between polyubiquitinatedcargo and autophagosomes. Interacts directly with both the cargoto become degraded and an autophagy modifier of the MAP1 LC3family (PubMed:16286508, PubMed:20168092, PubMed:24128730,PubMed:28404643, PubMed:22622177). Along with WDFY3, involved inthe formation and autophagic degradation of cytoplasmic ubiquitin-containing inclusions (p62 bodies, ALIS/aggresome-like inducedstructures). Along with WDFY3, required to recruit ubiquitinatedproteins to PML bodies in the nucleus (PubMed:24128730,PubMed:20168092). May regulate the activation of NFKB1 by TNF-alpha, nerve growth factor (NGF) and interleukin-1. May play arole in titin/TTN downstream signaling in muscle cells. Mayregulate signaling cascades through ubiquitination. Adapter thatmediates the interaction between TRAF6 and CYLD (By similarity).May be involved in cell differentiation, apoptosis, immuneresponse and regulation of K(+) channels. Involved in endosomeorganization by retaining vesicles in the perinuclear cloud:following ubiquitination by RNF26, attracts specific vesicle-associated adapters, forming a molecular bridge that restrainscognate vesicles in the perinuclear region and organizes theendosomal pathway for efficient cargo transport (PubMed:27368102).{ECO:0000250|UniProtKB:O08623, ECO:0000250|UniProtKB:Q64337,ECO:0000269|PubMed:10356400, ECO:0000269|PubMed:10747026,ECO:0000269|PubMed:11244088, ECO:0000269|PubMed:12471037,ECO:0000269|PubMed:15340068, ECO:0000269|PubMed:15802564,ECO:0000269|PubMed:15911346, ECO:0000269|PubMed:15953362,ECO:0000269|PubMed:16079148, ECO:0000269|PubMed:16286508,ECO:0000269|PubMed:19931284, ECO:0000269|PubMed:20168092,ECO:0000269|PubMed:22622177, ECO:0000269|PubMed:24128730,ECO:0000269|PubMed:27368102, ECO:0000269|PubMed:28404643}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+07272_29416357Compositional biasNote=Ser-rich
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+29272_29416357Compositional biasNote=Ser-rich
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+18272_294100441Compositional biasNote=Ser-rich
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+18272_29416357Compositional biasNote=Ser-rich
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+07389_43416357DomainUBA
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+29389_43416357DomainUBA
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+18389_434100441DomainUBA
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+18389_43416357DomainUBA
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+07228_23316357MotifNote=TRAF6-binding
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+07336_34116357MotifNote=LIR
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+29228_23316357MotifNote=TRAF6-binding
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+29336_34116357MotifNote=LIR
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+18228_233100441MotifNote=TRAF6-binding
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+18336_341100441MotifNote=LIR
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+18228_23316357MotifNote=TRAF6-binding
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+18336_34116357MotifNote=LIR
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+07170_22016357RegionNote=LIM protein-binding (LB)
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+07321_34216357RegionNote=MAP1LC3B-binding
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+29170_22016357RegionNote=LIM protein-binding (LB)
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+29321_34216357RegionNote=MAP1LC3B-binding
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+18170_220100441RegionNote=LIM protein-binding (LB)
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+18321_342100441RegionNote=MAP1LC3B-binding
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+18170_22016357RegionNote=LIM protein-binding (LB)
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+18321_34216357RegionNote=MAP1LC3B-binding
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+07122_16716357Zinc fingerZZ-type
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+29122_16716357Zinc fingerZZ-type
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+18122_167100441Zinc fingerZZ-type
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+18122_16716357Zinc fingerZZ-type

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+073_10216357DomainPB1
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+293_10216357DomainPB1
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+183_102100441DomainPB1
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+183_10216357DomainPB1


Top

FusionGeneSequence for ARHGDIA_SQSTM1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARHGDIA_ENST00000582520_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_367aa
VFPSQDPLDRADFNAVEYINTLFPTEQRKKSAGGTTAHRVLRRRPATWCTPMXSAMAAMGLWXEPATSAASAQTTTCVASARERACTGGT
PSSHSPAPSGTCLRASRTAAGSGRXNTDTSGGQDGKWVHQETGAHVLLVQGRPALAPRQNQLLVHRRIRVXISXRTLGRVWQLPLALWAL
KLISMWSTEGKEAAXPPSLQRVPAQRRRAAHSQAAAALTPASRVGMLRAPRSLWRSRXGRSPWSPRGALRNRWSRITVQEEMMTGPICLQ
KKWTRLQVNSSPYRCQNPKGQALWTPPRRDPQGXRKLPCTHISRQRLTRGXLSPSPRCCPWASLMKAAGSPGSCRPRTMTSERLWTPSSI

>In-frame_ARHGDIA_ENST00000269321_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_340aa
RKKSAGGTTAHRVLRRRPATWCTPMXSAMAAMGLWXEPATSAASAQTTTCVASARERACTGGTPSSHSPAPSGTCLRASRTAAGSGRXNT
DTSGGQDGKWVHQETGAHVLLVQGRPALAPRQNQLLVHRRIRVXISXRTLGRVWQLPLALWALKLISMWSTEGKEAAXPPSLQRVPAQRR
RAAHSQAAAALTPASRVGMLRAPRSLWRSRXGRSPWSPRGALRNRWSRITVQEEMMTGPICLQKKWTRLQVNSSPYRCQNPKGQALWTPP

>In-frame_ARHGDIA_ENST00000582520_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_375aa
VGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEG
KGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAA
ALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDD
DWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGA

>In-frame_ARHGDIA_ENST00000269321_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_340aa
RKKSAGGTTAHRVLRRRPATWCTPMXSAMAAMGLWXEPATSAASAQTTTCVASARERACTGGTPSSHSPAPSGTCLRASRTAAGSGRXNT
DTSGGQDGKWVHQETGAHVLLVQGRPALAPRQNQLLVHRRIRVXISXRTLGRVWQLPLALWALKLISMWSTEGKEAAXPPSLQRVPAQRR
RAAHSQAAAALTPASRVGMLRAPRSLWRSRXGRSPWSPRGALRNRWSRITVQEEMMTGPICLQKKWTRLQVNSSPYRCQNPKGQALWTPP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARHGDIA_ENST00000582520_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_1103nt
GTGTTTCCAAGCCAGGACCCTCTAGATCGAGCAGATTTCAATGCTGTTGAGTATATCAATACCCTGTTCCCAACCGAGCAAAGAAAAAAG
AGTGCCGGCGGGACCACCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCCAATGTGATCTGCGATGGCTGCAATGGGC
CTGTGGTAGGAACCCGCTACAAGTGCAGCGTCTGCCCAGACTACGACTTGTGTAGCGTCTGCGAGGGAAAGGGCTTGCACCGGGGGCACA
CCAAGCTCGCATTCCCCAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGGCTCCGGAAGGTGAAACACGGACACTTCG
GGTGGCCAGGATGGGAAATGGGTCCACCAGGAAACTGGAGCCCACGTCCTCCTCGTGCAGGGGAGGCCCGCCCTGGCCCCACGGCAGAAT
CAGCTTCTGGTCCATCGGAGGATCCGAGTGTGAATTTCCTGAAGAACGTTGGGGAGAGTGTGGCAGCTGCCCTTAGCCCTCTGGGCATTG
AAGTTGATATCGATGTGGAGCACGGAGGGAAAAGAAGCCGCCTGACCCCCGTCTCTCCAGAGAGTTCCAGCACAGAGGAGAAGAGCAGCT
CACAGCCAAGCAGCTGCTGCTCTGACCCCAGCAAGCCGGGTGGGAATGTTGAGGGCGCCACGCAGTCTCTGGCGGAGCAGATGAGGAAGA
TCGCCTTGGAGTCCGAGGGGCGCCCTGAGGAACAGATGGAGTCGGATAACTGTTCAGGAGGAGATGATGACTGGACCCATCTGTCTTCAA
AAGAAGTGGACCCGTCTACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCAAGCTCTCTGGACCCCTCCCAGGAGGGAC
CCACAGGGCTGAAGGAAGCTGCCTTGTACCCACATCTCCCGCCAGAGGCTGACCCGCGGCTGATTGAGTCCCTCTCCCAGATGCTGTCCA
TGGGCTTCTCTGATGAAGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATCGGAGCGGCTCTGGACACCATCCAGTATT

>In-frame_ARHGDIA_ENST00000269321_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_1022nt
AGAAAAAAGAGTGCCGGCGGGACCACCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCCAATGTGATCTGCGATGGCT
GCAATGGGCCTGTGGTAGGAACCCGCTACAAGTGCAGCGTCTGCCCAGACTACGACTTGTGTAGCGTCTGCGAGGGAAAGGGCTTGCACC
GGGGGCACACCAAGCTCGCATTCCCCAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGGCTCCGGAAGGTGAAACACG
GACACTTCGGGTGGCCAGGATGGGAAATGGGTCCACCAGGAAACTGGAGCCCACGTCCTCCTCGTGCAGGGGAGGCCCGCCCTGGCCCCA
CGGCAGAATCAGCTTCTGGTCCATCGGAGGATCCGAGTGTGAATTTCCTGAAGAACGTTGGGGAGAGTGTGGCAGCTGCCCTTAGCCCTC
TGGGCATTGAAGTTGATATCGATGTGGAGCACGGAGGGAAAAGAAGCCGCCTGACCCCCGTCTCTCCAGAGAGTTCCAGCACAGAGGAGA
AGAGCAGCTCACAGCCAAGCAGCTGCTGCTCTGACCCCAGCAAGCCGGGTGGGAATGTTGAGGGCGCCACGCAGTCTCTGGCGGAGCAGA
TGAGGAAGATCGCCTTGGAGTCCGAGGGGCGCCCTGAGGAACAGATGGAGTCGGATAACTGTTCAGGAGGAGATGATGACTGGACCCATC
TGTCTTCAAAAGAAGTGGACCCGTCTACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCAAGCTCTCTGGACCCCTCCC
AGGAGGGACCCACAGGGCTGAAGGAAGCTGCCTTGTACCCACATCTCCCGCCAGAGGCTGACCCGCGGCTGATTGAGTCCCTCTCCCAGA
TGCTGTCCATGGGCTTCTCTGATGAAGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATCGGAGCGGCTCTGGACACCA

>In-frame_ARHGDIA_ENST00000582520_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_1125nt
GTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTA
CTAGCATTCCAAGAGAAAAAAGAGTGCCGGCGGGACCACCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCCAATGTG
ATCTGCGATGGCTGCAATGGGCCTGTGGTAGGAACCCGCTACAAGTGCAGCGTCTGCCCAGACTACGACTTGTGTAGCGTCTGCGAGGGA
AAGGGCTTGCACCGGGGGCACACCAAGCTCGCATTCCCCAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGGCTCCGG
AAGGTGAAACACGGACACTTCGGGTGGCCAGGATGGGAAATGGGTCCACCAGGAAACTGGAGCCCACGTCCTCCTCGTGCAGGGGAGGCC
CGCCCTGGCCCCACGGCAGAATCAGCTTCTGGTCCATCGGAGGATCCGAGTGTGAATTTCCTGAAGAACGTTGGGGAGAGTGTGGCAGCT
GCCCTTAGCCCTCTGGGCATTGAAGTTGATATCGATGTGGAGCACGGAGGGAAAAGAAGCCGCCTGACCCCCGTCTCTCCAGAGAGTTCC
AGCACAGAGGAGAAGAGCAGCTCACAGCCAAGCAGCTGCTGCTCTGACCCCAGCAAGCCGGGTGGGAATGTTGAGGGCGCCACGCAGTCT
CTGGCGGAGCAGATGAGGAAGATCGCCTTGGAGTCCGAGGGGCGCCCTGAGGAACAGATGGAGTCGGATAACTGTTCAGGAGGAGATGAT
GACTGGACCCATCTGTCTTCAAAAGAAGTGGACCCGTCTACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCAAGCTCT
CTGGACCCCTCCCAGGAGGGACCCACAGGGCTGAAGGAAGCTGCCTTGTACCCACATCTCCCGCCAGAGGCTGACCCGCGGCTGATTGAG
TCCCTCTCCCAGATGCTGTCCATGGGCTTCTCTGATGAAGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATCGGAGCG

>In-frame_ARHGDIA_ENST00000269321_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_1022nt
AGAAAAAAGAGTGCCGGCGGGACCACCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCCAATGTGATCTGCGATGGCT
GCAATGGGCCTGTGGTAGGAACCCGCTACAAGTGCAGCGTCTGCCCAGACTACGACTTGTGTAGCGTCTGCGAGGGAAAGGGCTTGCACC
GGGGGCACACCAAGCTCGCATTCCCCAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGGCTCCGGAAGGTGAAACACG
GACACTTCGGGTGGCCAGGATGGGAAATGGGTCCACCAGGAAACTGGAGCCCACGTCCTCCTCGTGCAGGGGAGGCCCGCCCTGGCCCCA
CGGCAGAATCAGCTTCTGGTCCATCGGAGGATCCGAGTGTGAATTTCCTGAAGAACGTTGGGGAGAGTGTGGCAGCTGCCCTTAGCCCTC
TGGGCATTGAAGTTGATATCGATGTGGAGCACGGAGGGAAAAGAAGCCGCCTGACCCCCGTCTCTCCAGAGAGTTCCAGCACAGAGGAGA
AGAGCAGCTCACAGCCAAGCAGCTGCTGCTCTGACCCCAGCAAGCCGGGTGGGAATGTTGAGGGCGCCACGCAGTCTCTGGCGGAGCAGA
TGAGGAAGATCGCCTTGGAGTCCGAGGGGCGCCCTGAGGAACAGATGGAGTCGGATAACTGTTCAGGAGGAGATGATGACTGGACCCATC
TGTCTTCAAAAGAAGTGGACCCGTCTACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCAAGCTCTCTGGACCCCTCCC
AGGAGGGACCCACAGGGCTGAAGGAAGCTGCCTTGTACCCACATCTCCCGCCAGAGGCTGACCCGCGGCTGATTGAGTCCCTCTCCCAGA
TGCTGTCCATGGGCTTCTCTGATGAAGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATCGGAGCGGCTCTGGACACCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARHGDIA_ENST00000582520_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_2749nt
AGAGAGGCCGCAGCCAGGCCTCTGCTGCCCTTTCTGTGCCCCCCAGGCTCTCAGTGCCACCACCCCCGGCAGGCCTTCCCTGACCCAGCC
AGGAACAAACAAGGGACCAAGTGCACACATTGCTGAGAGCCGTCTCCTGTGCCTCCCCCGCCCCATCCCCGGTCTTCGTGTTGTGTCTGC
CAGGCTCAGGCAGAGGCGCCTGTCCCTGCTTCTTTTCTGACCGGGAAATAAATGCCCCTGAAGGAAGAAAAAAGAGTGCCGGCGGGACCA
CCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCCAATGTGATCTGCGATGGCTGCAATGGGCCTGTGGTAGGAACCCG
CTACAAGTGCAGCGTCTGCCCAGACTACGACTTGTGTAGCGTCTGCGAGGGAAAGGGCTTGCACCGGGGGCACACCAAGCTCGCATTCCC
CAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGGCTCCGGAAGGTGAAACACGGACACTTCGGGTGGCCAGGATGGGA
AATGGGTCCACCAGGAAACTGGAGCCCACGTCCTCCTCGTGCAGGGGAGGCCCGCCCTGGCCCCACGGCAGAATCAGCTTCTGGTCCATC
GGAGGATCCGAGTGTGAATTTCCTGAAGAACGTTGGGGAGAGTGTGGCAGCTGCCCTTAGCCCTCTGGGCATTGAAGTTGATATCGATGT
GGAGCACGGAGGGAAAAGAAGCCGCCTGACCCCCGTCTCTCCAGAGAGTTCCAGCACAGAGGAGAAGAGCAGCTCACAGCCAAGCAGCTG
CTGCTCTGACCCCAGCAAGCCGGGTGGGAATGTTGAGGGCGCCACGCAGTCTCTGGCGGAGCAGATGAGGAAGATCGCCTTGGAGTCCGA
GGGGCGCCCTGAGGAACAGATGGAGTCGGATAACTGTTCAGGAGGAGATGATGACTGGACCCATCTGTCTTCAAAAGAAGTGGACCCGTC
TACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCAAGCTCTCTGGACCCCTCCCAGGAGGGACCCACAGGGCTGAAGGA
AGCTGCCTTGTACCCACATCTCCCGCCAGAGGCTGACCCGCGGCTGATTGAGTCCCTCTCCCAGATGCTGTCCATGGGCTTCTCTGATGA
AGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATCGGAGCGGCTCTGGACACCATCCAGTATTCAAAGCATCCCCCGCC
GTTGTGACCACTTTTGCCCACCTCTTCTGCGTGCCCCTCTTCTGTCTCATAGTTGTGTTAAGCTTGCGTAGAATTGCAGGTCTCTGTACG
GGCCAGTTTCTCTGCCTTCTTCCAGGATCAGGGGTTAGGGTGCAAGAAGCCATTTAGGGCAGCAAAACAAGTGACATGAAGGGAGGGTCC
CTGTGTGTGTGTGTGCTGATGTTTCCTGGGTGCCCTGGCTCCTTGCAGCAGGGCTGGGCCTGCGAGACCCAAGGCTCACTGCAGCGCGCT
CCTGACCCCTCCCTGCAGGGGCTACGTTAGCAGCCCAGCACATAGCTTGCCTAATGGCTTTCACTTTCTCTTTTGTTTTAAATGACTCAT
AGGTCCCTGACATTTAGTTGATTATTTTCTGCTACAGACCTGGTACACTCTGATTTTAGATAAAGTAAGCCTAGGTGTTGTCAGCAGGCA
GGCTGGGGAGGCCAGTGTTGTGGGCTTCCTGCTGGGACTGAGAAGGCTCACGAAGGGCATCCGCAATGTTGGTTTCACTGAGAGCTGCCT
CCTGGTCTCTTCACCACTGTAGTTCTCTCATTTCCAAACCATCAGCTGCTTTTAAAATAAGATCTCTTTGTAGCCATCCTGTTAAATTTG
TAAACAATCTAATTAAATGGCATCAGCACTTTAACCAATGACGTTTGCATAGAGAGAAATGATTGACAGTAAGTTTATTGTTAATGGTTC
TTACAGAGTATCTTTAAAAGTGCCTTAGGGGAACCCTGTCCCTCCTAACAAGTGTATCTCGATTAATAACCTGCCAGTCCCAGATCACAC
ATCATCATCGAAGTCTTCCCCAGTTATAAAGAGGTCACATAGTCGTGTGGGTCGAGGATTCTGTGCCTCCAGGACCAGGGGCCCACCCTC
TGCCCAGGGAGTCCTTGCGTCCCATGAGGTCTTCCCGCAAGGCCTCTCAGACCCAGATGTGACGGGGTGTGTGGCCCGAGGAAGCTGGAC
AGCGGCAGTGGGCCTGCTGAGGCCTTCTCTTGAGGCCTGTGCTCTGGGGGTCCCTTGCTTAGCCTGTGCTGGACCAGCTGGCCTGGGGTC
CCTCTGAAGAGACCTTGGCTGCTCACTGTCCACATGTGAACTTTTTCTAGGTGGCAGGACAAATTGCGCCCATTTAGAGGATGTGGCTGT
AACCTGCTGGATGGGACTCCATAGCTCCTTCCCAGGACCCCTCAGCTCCCCGGCACTGCAGTCTGCAGAGTTCTCCTGGAGGCAGGGGCT
GCTGCCTTGTTTCACCTTCCATGTCAGGCCAGCCTGTCCCTGAAAGAGAAGATGGCCATGCCCTCCATGTGTAAGAACAATGCCAGGGCC
CAGGAGGACCGCCTGCCCTGCCTGGGCCTTGGCTGGGCCTCTGGTTCTGACACTTTCTGCTGGAAGCTGTCAGGCTGGGACAGGCTTTGA

>In-frame_ARHGDIA_ENST00000269321_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_4410nt
GAGCGGAAGTCTCGTGACCCCGGAAGTGACAGGCAGGGCGGGCGGGGCGGCCGACGACGTTCGTCATTTAGTGCGGGAGGGATCCTGAAC
CGCGCGGCCGAACCCTCCGGTGTCCCGACCCAGGCTAAGCTTGAGCATGGCTGAGCAGGAGCCCACAGCCGAGCAGCTGGCCCAGATTGC
AGCGGAGAACGAGGAGGATGAGCACTCGGTCAACTACAAGCCCCCGGCCCAGAAGAGCATCCAGGAGATCCAGGAGCTGGACAAGGACGA
CGAGAGCCTGCGAAAGTACAAGGAGGCCCTGCTGGGCCGCGTGGCCGTTTCCGCAGACCCCAACGTCCCCAACGTCGTGGTGACTGGCCT
GACCCTGGTGTGCAGCTCGGCCCCGGGCCCCCTGGAGCTGGACCTGACGGGCGACCTGGAGAGCTTCAAGAAGCAGTCGTTTGTGCTGAA
GGAGGGTGTGGAGTACCGGATAAAAATCTCTTTCCGGGTTAACCGAGAGATAGTGTCCGGCATGAAGTACATCCAGCATACGTACAGGAA
AGGCGTCAAGATTGACAAGACTGACTACATGGTAGGCAGCTATGGGCCCCGGGCCGAGGAGTACGAGTTCCTGACCCCCGTGGAGGAGGC
ACCCAAGGGTATGCTGGCCCGGGGCAGCTACAGCATCAAGTCCCGCTTCACAGACGACGACAAGACCGACCACCTGTCCTGGGAGTGGAA
TCTCACCATCAAGAAGGACTGGAAGGACTGAGCCCAGCCAGAGGCGGGCAGGGCAGACTGACGGACGGACGACGGACAGGCGGATGTGTC
CCCCCCAGCCCCTCCCCTCCCCATACCAAAGTGCTGACAGGCCCTCCGTGCCCCTCCCACCCTGGTCCGCCTCCCTGGCCTGGCTCAACC
GAGTGCCTCCGACCCCCCTCCTCAGCCCTCCCCCACCCACAGGCCCAGCCTCCTCGGTCTCCTGTCTCGTTGCTGCTTCTGCCTGTGCTG
TGGGGGAGAGAGGCCGCAGCCAGGCCTCTGCTGCCCTTTCTGTGCCCCCCAGGTTCTATCTCCCCGTCACACCCGAGGCCTGGCTTCAGG
AGGGAGCGGAGCAGCCATTCTCCAGGCCCCGTGGTTGCCCCTGGACGTGTGCGTCTGCTGCTCCGGGGTGGAGCTGGGGTGTGGGATGCA
CGGCCTCGTGGGGGCCGGGCCGTCCTCCAGCCCCGCTGCTCCCTGGCCAGCCCCCTTGTCGCTGTCGGTCCCGTCTAACCATGATGCCTT
AACATGTGGAGTGTACCGTGGGGCCTCACTAGCCTCTAACTCCCTGTGTCTGCATGAGCATGTGGCCTCCCCGTCCCTTCCCCGGTGGCG
AACCCAGTGACCCAGGGACACGTGGGGTGTGCTGCTGCTGCTCCCCAGCCCACCAGTGCCTGGCCAGCCTGCCCCCTTCCCTGGACAGGG
CTGTGGAGATGGCTCCGGCGGCTTGGGGAAAGCCAAATTGCCAAAACTCAAGTCACCTCAGTACCATCCAGGAGGCTGGGTATTGTCCTG
CCTCTGCCTTTTCTGTCTCAGCGGGCAGTGCCCAGAGCCCACACCCCCCCAAGAGCCCTCGATGGACAGCCTCACTCACCCCACCTGGGC
CCAGCCAGGAGCCCCGCCTGGCCATCAGTATTTATTGCCTCCGTCCGTGCCGTCCCTGGGCCACTGGCCTGGCGCCTGTTCCCCCAGGCT
CTCAGTGCCACCACCCCCGGCAGGCCTTCCCTGACCCAGCCAGGAACAAACAAGGGACCAAGTGCACACATTGCTGAGAGCCGTCTCCTG
TGCCTCCCCCGCCCCATCCCCGGTCTTCGTGTTGTGTCTGCCAGGCTCAGGCAGAGGCGCCTGTCCCTGCTTCTTTTCTGACCGGGAAAT
AAATGCCCCTGAAGGAAGAAAAAAGAGTGCCGGCGGGACCACCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCCAAT
GTGATCTGCGATGGCTGCAATGGGCCTGTGGTAGGAACCCGCTACAAGTGCAGCGTCTGCCCAGACTACGACTTGTGTAGCGTCTGCGAG
GGAAAGGGCTTGCACCGGGGGCACACCAAGCTCGCATTCCCCAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGGCTC
CGGAAGGTGAAACACGGACACTTCGGGTGGCCAGGATGGGAAATGGGTCCACCAGGAAACTGGAGCCCACGTCCTCCTCGTGCAGGGGAG
GCCCGCCCTGGCCCCACGGCAGAATCAGCTTCTGGTCCATCGGAGGATCCGAGTGTGAATTTCCTGAAGAACGTTGGGGAGAGTGTGGCA
GCTGCCCTTAGCCCTCTGGGCATTGAAGTTGATATCGATGTGGAGCACGGAGGGAAAAGAAGCCGCCTGACCCCCGTCTCTCCAGAGAGT
TCCAGCACAGAGGAGAAGAGCAGCTCACAGCCAAGCAGCTGCTGCTCTGACCCCAGCAAGCCGGGTGGGAATGTTGAGGGCGCCACGCAG
TCTCTGGCGGAGCAGATGAGGAAGATCGCCTTGGAGTCCGAGGGGCGCCCTGAGGAACAGATGGAGTCGGATAACTGTTCAGGAGGAGAT
GATGACTGGACCCATCTGTCTTCAAAAGAAGTGGACCCGTCTACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCAAGC
TCTCTGGACCCCTCCCAGGAGGGACCCACAGGGCTGAAGGAAGCTGCCTTGTACCCACATCTCCCGCCAGAGGCTGACCCGCGGCTGATT
GAGTCCCTCTCCCAGATGCTGTCCATGGGCTTCTCTGATGAAGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATCGGA
GCGGCTCTGGACACCATCCAGTATTCAAAGCATCCCCCGCCGTTGTGACCACTTTTGCCCACCTCTTCTGCGTGCCCCTCTTCTGTCTCA
TAGTTGTGTTAAGCTTGCGTAGAATTGCAGGTCTCTGTACGGGCCAGTTTCTCTGCCTTCTTCCAGGATCAGGGGTTAGGGTGCAAGAAG
CCATTTAGGGCAGCAAAACAAGTGACATGAAGGGAGGGTCCCTGTGTGTGTGTGTGCTGATGTTTCCTGGGTGCCCTGGCTCCTTGCAGC
AGGGCTGGGCCTGCGAGACCCAAGGCTCACTGCAGCGCGCTCCTGACCCCTCCCTGCAGGGGCTACGTTAGCAGCCCAGCACATAGCTTG
CCTAATGGCTTTCACTTTCTCTTTTGTTTTAAATGACTCATAGGTCCCTGACATTTAGTTGATTATTTTCTGCTACAGACCTGGTACACT
CTGATTTTAGATAAAGTAAGCCTAGGTGTTGTCAGCAGGCAGGCTGGGGAGGCCAGTGTTGTGGGCTTCCTGCTGGGACTGAGAAGGCTC
ACGAAGGGCATCCGCAATGTTGGTTTCACTGAGAGCTGCCTCCTGGTCTCTTCACCACTGTAGTTCTCTCATTTCCAAACCATCAGCTGC
TTTTAAAATAAGATCTCTTTGTAGCCATCCTGTTAAATTTGTAAACAATCTAATTAAATGGCATCAGCACTTTAACCAATGACGTTTGCA
TAGAGAGAAATGATTGACAGTAAGTTTATTGTTAATGGTTCTTACAGAGTATCTTTAAAAGTGCCTTAGGGGAACCCTGTCCCTCCTAAC
AAGTGTATCTCGATTAATAACCTGCCAGTCCCAGATCACACATCATCATCGAAGTCTTCCCCAGTTATAAAGAGGTCACATAGTCGTGTG
GGTCGAGGATTCTGTGCCTCCAGGACCAGGGGCCCACCCTCTGCCCAGGGAGTCCTTGCGTCCCATGAGGTCTTCCCGCAAGGCCTCTCA
GACCCAGATGTGACGGGGTGTGTGGCCCGAGGAAGCTGGACAGCGGCAGTGGGCCTGCTGAGGCCTTCTCTTGAGGCCTGTGCTCTGGGG
GTCCCTTGCTTAGCCTGTGCTGGACCAGCTGGCCTGGGGTCCCTCTGAAGAGACCTTGGCTGCTCACTGTCCACATGTGAACTTTTTCTA
GGTGGCAGGACAAATTGCGCCCATTTAGAGGATGTGGCTGTAACCTGCTGGATGGGACTCCATAGCTCCTTCCCAGGACCCCTCAGCTCC
CCGGCACTGCAGTCTGCAGAGTTCTCCTGGAGGCAGGGGCTGCTGCCTTGTTTCACCTTCCATGTCAGGCCAGCCTGTCCCTGAAAGAGA
AGATGGCCATGCCCTCCATGTGTAAGAACAATGCCAGGGCCCAGGAGGACCGCCTGCCCTGCCTGGGCCTTGGCTGGGCCTCTGGTTCTG
ACACTTTCTGCTGGAAGCTGTCAGGCTGGGACAGGCTTTGATTTTGAGGGTTAGCAAGACAAAGCAAATAAATGCCTTCCACCTCACCGC

>In-frame_ARHGDIA_ENST00000582520_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_2749nt
AGAGAGGCCGCAGCCAGGCCTCTGCTGCCCTTTCTGTGCCCCCCAGGCTCTCAGTGCCACCACCCCCGGCAGGCCTTCCCTGACCCAGCC
AGGAACAAACAAGGGACCAAGTGCACACATTGCTGAGAGCCGTCTCCTGTGCCTCCCCCGCCCCATCCCCGGTCTTCGTGTTGTGTCTGC
CAGGCTCAGGCAGAGGCGCCTGTCCCTGCTTCTTTTCTGACCGGGAAATAAATGCCCCTGAAGGAAGAAAAAAGAGTGCCGGCGGGACCA
CCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCCAATGTGATCTGCGATGGCTGCAATGGGCCTGTGGTAGGAACCCG
CTACAAGTGCAGCGTCTGCCCAGACTACGACTTGTGTAGCGTCTGCGAGGGAAAGGGCTTGCACCGGGGGCACACCAAGCTCGCATTCCC
CAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGGCTCCGGAAGGTGAAACACGGACACTTCGGGTGGCCAGGATGGGA
AATGGGTCCACCAGGAAACTGGAGCCCACGTCCTCCTCGTGCAGGGGAGGCCCGCCCTGGCCCCACGGCAGAATCAGCTTCTGGTCCATC
GGAGGATCCGAGTGTGAATTTCCTGAAGAACGTTGGGGAGAGTGTGGCAGCTGCCCTTAGCCCTCTGGGCATTGAAGTTGATATCGATGT
GGAGCACGGAGGGAAAAGAAGCCGCCTGACCCCCGTCTCTCCAGAGAGTTCCAGCACAGAGGAGAAGAGCAGCTCACAGCCAAGCAGCTG
CTGCTCTGACCCCAGCAAGCCGGGTGGGAATGTTGAGGGCGCCACGCAGTCTCTGGCGGAGCAGATGAGGAAGATCGCCTTGGAGTCCGA
GGGGCGCCCTGAGGAACAGATGGAGTCGGATAACTGTTCAGGAGGAGATGATGACTGGACCCATCTGTCTTCAAAAGAAGTGGACCCGTC
TACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCAAGCTCTCTGGACCCCTCCCAGGAGGGACCCACAGGGCTGAAGGA
AGCTGCCTTGTACCCACATCTCCCGCCAGAGGCTGACCCGCGGCTGATTGAGTCCCTCTCCCAGATGCTGTCCATGGGCTTCTCTGATGA
AGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATCGGAGCGGCTCTGGACACCATCCAGTATTCAAAGCATCCCCCGCC
GTTGTGACCACTTTTGCCCACCTCTTCTGCGTGCCCCTCTTCTGTCTCATAGTTGTGTTAAGCTTGCGTAGAATTGCAGGTCTCTGTACG
GGCCAGTTTCTCTGCCTTCTTCCAGGATCAGGGGTTAGGGTGCAAGAAGCCATTTAGGGCAGCAAAACAAGTGACATGAAGGGAGGGTCC
CTGTGTGTGTGTGTGCTGATGTTTCCTGGGTGCCCTGGCTCCTTGCAGCAGGGCTGGGCCTGCGAGACCCAAGGCTCACTGCAGCGCGCT
CCTGACCCCTCCCTGCAGGGGCTACGTTAGCAGCCCAGCACATAGCTTGCCTAATGGCTTTCACTTTCTCTTTTGTTTTAAATGACTCAT
AGGTCCCTGACATTTAGTTGATTATTTTCTGCTACAGACCTGGTACACTCTGATTTTAGATAAAGTAAGCCTAGGTGTTGTCAGCAGGCA
GGCTGGGGAGGCCAGTGTTGTGGGCTTCCTGCTGGGACTGAGAAGGCTCACGAAGGGCATCCGCAATGTTGGTTTCACTGAGAGCTGCCT
CCTGGTCTCTTCACCACTGTAGTTCTCTCATTTCCAAACCATCAGCTGCTTTTAAAATAAGATCTCTTTGTAGCCATCCTGTTAAATTTG
TAAACAATCTAATTAAATGGCATCAGCACTTTAACCAATGACGTTTGCATAGAGAGAAATGATTGACAGTAAGTTTATTGTTAATGGTTC
TTACAGAGTATCTTTAAAAGTGCCTTAGGGGAACCCTGTCCCTCCTAACAAGTGTATCTCGATTAATAACCTGCCAGTCCCAGATCACAC
ATCATCATCGAAGTCTTCCCCAGTTATAAAGAGGTCACATAGTCGTGTGGGTCGAGGATTCTGTGCCTCCAGGACCAGGGGCCCACCCTC
TGCCCAGGGAGTCCTTGCGTCCCATGAGGTCTTCCCGCAAGGCCTCTCAGACCCAGATGTGACGGGGTGTGTGGCCCGAGGAAGCTGGAC
AGCGGCAGTGGGCCTGCTGAGGCCTTCTCTTGAGGCCTGTGCTCTGGGGGTCCCTTGCTTAGCCTGTGCTGGACCAGCTGGCCTGGGGTC
CCTCTGAAGAGACCTTGGCTGCTCACTGTCCACATGTGAACTTTTTCTAGGTGGCAGGACAAATTGCGCCCATTTAGAGGATGTGGCTGT
AACCTGCTGGATGGGACTCCATAGCTCCTTCCCAGGACCCCTCAGCTCCCCGGCACTGCAGTCTGCAGAGTTCTCCTGGAGGCAGGGGCT
GCTGCCTTGTTTCACCTTCCATGTCAGGCCAGCCTGTCCCTGAAAGAGAAGATGGCCATGCCCTCCATGTGTAAGAACAATGCCAGGGCC
CAGGAGGACCGCCTGCCCTGCCTGGGCCTTGGCTGGGCCTCTGGTTCTGACACTTTCTGCTGGAAGCTGTCAGGCTGGGACAGGCTTTGA

>In-frame_ARHGDIA_ENST00000269321_chr17_79825598_-_SQSTM1_ENST00000376929_chr5_179250858_+_4410nt
GAGCGGAAGTCTCGTGACCCCGGAAGTGACAGGCAGGGCGGGCGGGGCGGCCGACGACGTTCGTCATTTAGTGCGGGAGGGATCCTGAAC
CGCGCGGCCGAACCCTCCGGTGTCCCGACCCAGGCTAAGCTTGAGCATGGCTGAGCAGGAGCCCACAGCCGAGCAGCTGGCCCAGATTGC
AGCGGAGAACGAGGAGGATGAGCACTCGGTCAACTACAAGCCCCCGGCCCAGAAGAGCATCCAGGAGATCCAGGAGCTGGACAAGGACGA
CGAGAGCCTGCGAAAGTACAAGGAGGCCCTGCTGGGCCGCGTGGCCGTTTCCGCAGACCCCAACGTCCCCAACGTCGTGGTGACTGGCCT
GACCCTGGTGTGCAGCTCGGCCCCGGGCCCCCTGGAGCTGGACCTGACGGGCGACCTGGAGAGCTTCAAGAAGCAGTCGTTTGTGCTGAA
GGAGGGTGTGGAGTACCGGATAAAAATCTCTTTCCGGGTTAACCGAGAGATAGTGTCCGGCATGAAGTACATCCAGCATACGTACAGGAA
AGGCGTCAAGATTGACAAGACTGACTACATGGTAGGCAGCTATGGGCCCCGGGCCGAGGAGTACGAGTTCCTGACCCCCGTGGAGGAGGC
ACCCAAGGGTATGCTGGCCCGGGGCAGCTACAGCATCAAGTCCCGCTTCACAGACGACGACAAGACCGACCACCTGTCCTGGGAGTGGAA
TCTCACCATCAAGAAGGACTGGAAGGACTGAGCCCAGCCAGAGGCGGGCAGGGCAGACTGACGGACGGACGACGGACAGGCGGATGTGTC
CCCCCCAGCCCCTCCCCTCCCCATACCAAAGTGCTGACAGGCCCTCCGTGCCCCTCCCACCCTGGTCCGCCTCCCTGGCCTGGCTCAACC
GAGTGCCTCCGACCCCCCTCCTCAGCCCTCCCCCACCCACAGGCCCAGCCTCCTCGGTCTCCTGTCTCGTTGCTGCTTCTGCCTGTGCTG
TGGGGGAGAGAGGCCGCAGCCAGGCCTCTGCTGCCCTTTCTGTGCCCCCCAGGTTCTATCTCCCCGTCACACCCGAGGCCTGGCTTCAGG
AGGGAGCGGAGCAGCCATTCTCCAGGCCCCGTGGTTGCCCCTGGACGTGTGCGTCTGCTGCTCCGGGGTGGAGCTGGGGTGTGGGATGCA
CGGCCTCGTGGGGGCCGGGCCGTCCTCCAGCCCCGCTGCTCCCTGGCCAGCCCCCTTGTCGCTGTCGGTCCCGTCTAACCATGATGCCTT
AACATGTGGAGTGTACCGTGGGGCCTCACTAGCCTCTAACTCCCTGTGTCTGCATGAGCATGTGGCCTCCCCGTCCCTTCCCCGGTGGCG
AACCCAGTGACCCAGGGACACGTGGGGTGTGCTGCTGCTGCTCCCCAGCCCACCAGTGCCTGGCCAGCCTGCCCCCTTCCCTGGACAGGG
CTGTGGAGATGGCTCCGGCGGCTTGGGGAAAGCCAAATTGCCAAAACTCAAGTCACCTCAGTACCATCCAGGAGGCTGGGTATTGTCCTG
CCTCTGCCTTTTCTGTCTCAGCGGGCAGTGCCCAGAGCCCACACCCCCCCAAGAGCCCTCGATGGACAGCCTCACTCACCCCACCTGGGC
CCAGCCAGGAGCCCCGCCTGGCCATCAGTATTTATTGCCTCCGTCCGTGCCGTCCCTGGGCCACTGGCCTGGCGCCTGTTCCCCCAGGCT
CTCAGTGCCACCACCCCCGGCAGGCCTTCCCTGACCCAGCCAGGAACAAACAAGGGACCAAGTGCACACATTGCTGAGAGCCGTCTCCTG
TGCCTCCCCCGCCCCATCCCCGGTCTTCGTGTTGTGTCTGCCAGGCTCAGGCAGAGGCGCCTGTCCCTGCTTCTTTTCTGACCGGGAAAT
AAATGCCCCTGAAGGAAGAAAAAAGAGTGCCGGCGGGACCACCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCCAAT
GTGATCTGCGATGGCTGCAATGGGCCTGTGGTAGGAACCCGCTACAAGTGCAGCGTCTGCCCAGACTACGACTTGTGTAGCGTCTGCGAG
GGAAAGGGCTTGCACCGGGGGCACACCAAGCTCGCATTCCCCAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGGCTC
CGGAAGGTGAAACACGGACACTTCGGGTGGCCAGGATGGGAAATGGGTCCACCAGGAAACTGGAGCCCACGTCCTCCTCGTGCAGGGGAG
GCCCGCCCTGGCCCCACGGCAGAATCAGCTTCTGGTCCATCGGAGGATCCGAGTGTGAATTTCCTGAAGAACGTTGGGGAGAGTGTGGCA
GCTGCCCTTAGCCCTCTGGGCATTGAAGTTGATATCGATGTGGAGCACGGAGGGAAAAGAAGCCGCCTGACCCCCGTCTCTCCAGAGAGT
TCCAGCACAGAGGAGAAGAGCAGCTCACAGCCAAGCAGCTGCTGCTCTGACCCCAGCAAGCCGGGTGGGAATGTTGAGGGCGCCACGCAG
TCTCTGGCGGAGCAGATGAGGAAGATCGCCTTGGAGTCCGAGGGGCGCCCTGAGGAACAGATGGAGTCGGATAACTGTTCAGGAGGAGAT
GATGACTGGACCCATCTGTCTTCAAAAGAAGTGGACCCGTCTACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCAAGC
TCTCTGGACCCCTCCCAGGAGGGACCCACAGGGCTGAAGGAAGCTGCCTTGTACCCACATCTCCCGCCAGAGGCTGACCCGCGGCTGATT
GAGTCCCTCTCCCAGATGCTGTCCATGGGCTTCTCTGATGAAGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATCGGA
GCGGCTCTGGACACCATCCAGTATTCAAAGCATCCCCCGCCGTTGTGACCACTTTTGCCCACCTCTTCTGCGTGCCCCTCTTCTGTCTCA
TAGTTGTGTTAAGCTTGCGTAGAATTGCAGGTCTCTGTACGGGCCAGTTTCTCTGCCTTCTTCCAGGATCAGGGGTTAGGGTGCAAGAAG
CCATTTAGGGCAGCAAAACAAGTGACATGAAGGGAGGGTCCCTGTGTGTGTGTGTGCTGATGTTTCCTGGGTGCCCTGGCTCCTTGCAGC
AGGGCTGGGCCTGCGAGACCCAAGGCTCACTGCAGCGCGCTCCTGACCCCTCCCTGCAGGGGCTACGTTAGCAGCCCAGCACATAGCTTG
CCTAATGGCTTTCACTTTCTCTTTTGTTTTAAATGACTCATAGGTCCCTGACATTTAGTTGATTATTTTCTGCTACAGACCTGGTACACT
CTGATTTTAGATAAAGTAAGCCTAGGTGTTGTCAGCAGGCAGGCTGGGGAGGCCAGTGTTGTGGGCTTCCTGCTGGGACTGAGAAGGCTC
ACGAAGGGCATCCGCAATGTTGGTTTCACTGAGAGCTGCCTCCTGGTCTCTTCACCACTGTAGTTCTCTCATTTCCAAACCATCAGCTGC
TTTTAAAATAAGATCTCTTTGTAGCCATCCTGTTAAATTTGTAAACAATCTAATTAAATGGCATCAGCACTTTAACCAATGACGTTTGCA
TAGAGAGAAATGATTGACAGTAAGTTTATTGTTAATGGTTCTTACAGAGTATCTTTAAAAGTGCCTTAGGGGAACCCTGTCCCTCCTAAC
AAGTGTATCTCGATTAATAACCTGCCAGTCCCAGATCACACATCATCATCGAAGTCTTCCCCAGTTATAAAGAGGTCACATAGTCGTGTG
GGTCGAGGATTCTGTGCCTCCAGGACCAGGGGCCCACCCTCTGCCCAGGGAGTCCTTGCGTCCCATGAGGTCTTCCCGCAAGGCCTCTCA
GACCCAGATGTGACGGGGTGTGTGGCCCGAGGAAGCTGGACAGCGGCAGTGGGCCTGCTGAGGCCTTCTCTTGAGGCCTGTGCTCTGGGG
GTCCCTTGCTTAGCCTGTGCTGGACCAGCTGGCCTGGGGTCCCTCTGAAGAGACCTTGGCTGCTCACTGTCCACATGTGAACTTTTTCTA
GGTGGCAGGACAAATTGCGCCCATTTAGAGGATGTGGCTGTAACCTGCTGGATGGGACTCCATAGCTCCTTCCCAGGACCCCTCAGCTCC
CCGGCACTGCAGTCTGCAGAGTTCTCCTGGAGGCAGGGGCTGCTGCCTTGTTTCACCTTCCATGTCAGGCCAGCCTGTCCCTGAAAGAGA
AGATGGCCATGCCCTCCATGTGTAAGAACAATGCCAGGGCCCAGGAGGACCGCCTGCCCTGCCTGGGCCTTGGCTGGGCCTCTGGTTCTG
ACACTTTCTGCTGGAAGCTGTCAGGCTGGGACAGGCTTTGATTTTGAGGGTTAGCAAGACAAAGCAAATAAATGCCTTCCACCTCACCGC


Top

FusionGenePPI for ARHGDIA_SQSTM1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARHGDIARHOA, RAC1, RHOC, CDC42, EIF2B1, DHX9, IGF2BP1, HNRNPAB, EWSR1, HNRNPA3, BID, TNFRSF10B, EZR, FADD, FASLG, MAPK8, MSN, CASP10, CASP8, FAS, TNFRSF1A, ACTL6A, CDKN1B, NEDD4L, SH3GL3, JUP, FEN1, RDX, RHOH, ARHGDIA, RAC2, RHOG, RAC3, BAK1, UBE2R2, CBX5, SDHC, MAPK6, TRIM13, UBE2L6, UFM1, HERPUD1, HAAO, TWF2, XIAP, ESR1, SIRT7, TERF1, TINF2, POT1, CUL3, CDK2, PSMD10, ATXN3, PIR, CASP3, CASP7, ADRB2, IKBKG, CUL7, CCDC8, ALDOA, AHNAK, ALDOC, ASS1, COMMD4, COTL1, DUT, ENO2, HSD17B10, HSPB1, IMPA1, IMPA2, ISYNA1, PCNA, PLS3, RAB11A, RAP1A, TXN, UCHL3, FAM98B, GDI1, HINT1, NPEPL1, PDIA3, PFKM, PFKP, SUMO3, SUMO4, NTRK1, U2AF2, STOM, ANKRD13A, PRRC2B, EIF2B4, FBXW7, UBE2I, EP300, KAT2B, SIRT2, HDAC6SQSTM1GABARAPL2, RAD23A, GABARAPL1, SQSTM1, LINC00341, MAP1LC3B, TRAF6, PRKCZ, IRAK1, PRKCI, NTRK1, RIPK1, NTRK2, NTRK3, LCK, MAP1LC3A, KEAP1, GABARAP, C10orf2, ABHD10, CEP78, DIP2B, BLOC1S5, EMILIN3, NSUN4, OSBPL8, INA, NIPSNAP1, GBAS, LLGL1, HADHA, GPC4, HADHB, CTNND1, ASPH, ENPP1, TRMT61B, GLG1, MRPL38, NEFM, GTF3C3, SRRM2, MYD88, MYC, MAP3K3, MAP2K5, IRF8, TRIM21, CYLD, CALM1, BNIP1, NFE2L2, CUL3, PIK3CA, PPHLN1, BPTF, UBC, DAZAP2, CDC37, TRIM13, CASP8, PCK1, STAT5A, PDE4A, MAPT, ATG4B, CHMP2B, TARDBP, CUL1, CUL2, HDAC6, ATG7, FUS, CSNK2A1, ZFAND5, TUBA1A, WDFY3, BAG3, NBR1, SNCA, TRIM63, TRIM55, TTN, RARA, PSMC2, PSMD4, MAP1LC3C, TRIM50, ARHGEF28, TGM2, PAWR, RPTOR, MTOR, AKT1S1, MLST8, RPS6KB1, RRAGC, RRAGB, CDK9, SPRED2, TRIM5, AJUBA, LIMD1, MAPK14, PARP10, TNFRSF10A, HTT, HNRNPA2B1, SDHA, CAV1, BID, FAS, SESN2, SESN1, MALT1, IKBKG, FHOD3, NOD2, SYNPO2, PYCARD, MLH1, PARK2, BCL2, PAN2, NPM1, MBP, YWHAZ, STXBP1, FKBP4, MEIS2, TKT, HSPA4, RELN, CAMK2A, ULK2, NCOR1, NGFR, CALCOCO2, CDK1, CCNB1, PRKCD, MAPK1, SMAD3, EEF1D, RPL37, GEMIN4, DVL2, CHAF1A, TP53, CASP9, HIF1A, PSMD12, PSMD3, FLNB, PSMD10, TXNL1, TNK2, LGALS3, EDEM1, CFTR, CSNK2A2, DCP2, EGLN3, EPAS1, ULK1, TOLLIP, OPTN, ATXN3, STUB1, ISG15, MOV10, NXF1, CUL7, PIK3R1, PIK3R2, AGAP1, INSR, TBK1, CRHBP, SCCPDH, DNAI1, DNAI2, TP53INP1, LLGL2, HSPB1, IFI16, KIAA0753, MED4, CEP135, CNTRL, SASS6, TMEM17, XPO1, CD44, KIF5B, PML, ENC1, SKI, TRIB3, RBM45, MAPK13, CHDH, EPDR1, GAS6, NDUFS2, NDUFS3, GFM2, NDUFA5, CD48, LDHA, RCN2, TRAF1, GBP2, KLHL3, EPM2A, RAD54L2, HSPA5, GRIA1, UBXN1, PEX5, BCL10, ATG5, CSNK1A1, VANGL2, SERPINA1, LRRK2, VHL, TCEB2, TCEB1, RNF166, NOTCH1, RETN, KERA, INSL5, TMX1, VWCE, CD96, HTR3A, RNF26, INO80B, DLST, TRIM25, PLIN1, TES, WDR81, PSMA6, TRIM23


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+07122_22416357GABRR3
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+29122_22416357GABRR3
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+18122_224100441GABRR3
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+18122_22416357GABRR3
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+07269_44016357NTRK1
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+29269_44016357NTRK1
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+18269_440100441NTRK1
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+18269_44016357NTRK1
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+0750_8016357PAWR
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+2950_8016357PAWR
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+1850_8016357PAWR
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+0743_10716357PRKCZ and dimerization
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+2943_10716357PRKCZ and dimerization
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+1843_10716357PRKCZ and dimerization


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000360718+072_5016357LCK
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000376929+292_5016357LCK
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+182_50100441LCK
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000402874+182_5016357LCK
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+1850_80100441PAWR
TgeneSQSTM1chr17:79825598chr5:179250858ENST00000389805+1843_107100441PRKCZ and dimerization


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARHGDIA_SQSTM1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARHGDIA_SQSTM1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneARHGDIAC0019693HIV Infections1CTD_human
HgeneARHGDIAC0022548Keloid1CTD_human
HgeneARHGDIAC0027627Neoplasm Metastasis1CTD_human
HgeneARHGDIAC1458155Mammary Neoplasms1CTD_human
TgeneSQSTM1C4085252PAGET DISEASE OF BONE 312UNIPROT
TgeneSQSTM1C4225326FRONTOTEMPORAL DEMENTIA AND/OR AMYOTROPHIC LATERAL SCLEROSIS 33UNIPROT
TgeneSQSTM1C0002736Amyotrophic Lateral Sclerosis1CTD_human;HPO;ORPHANET
TgeneSQSTM1C0242383Age related macular degeneration1CTD_human