FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24885

FusionGeneSummary for NRXN2_NSD1

check button Fusion gene summary
Fusion gene informationFusion gene name: NRXN2_NSD1
Fusion gene ID: 24885
HgeneTgene
Gene symbol

NRXN2

NSD1

Gene ID

9379

64324

Gene nameneurexin 2nuclear receptor binding SET domain protein 1
Synonyms-ARA267|KMT3B|SOTOS|SOTOS1|STO
Cytomap

11q13.1

5q35.3

Type of geneprotein-codingprotein-coding
Descriptionneurexin-2-betaneurexin IIhistone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specificH3-K36-HMTaseH4-K20-HMTaseNR-binding SET domain-containing proteinandrogen receptor coactivator 267 kDa proteinandrogen receptor-associated coregulator 267androgen receptor-as
Modification date2018051920180519
UniProtAcc

Q9P2S2

Q96L73

Ensembl transtripts involved in fusion geneENST00000377559, ENST00000265459, 
ENST00000301894, ENST00000377551, 
ENST00000409571, ENST00000496291, 
ENST00000354179, ENST00000439151, 
ENST00000347982, ENST00000361032, 
ENST00000511258, 
Fusion gene scores* DoF score3 X 3 X 2=187 X 7 X 4=196
# samples 310
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(10/196*10)=-0.970853654340483
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NRXN2 [Title/Abstract] AND NSD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneNSD1

GO:0045893

positive regulation of transcription, DNA-templated

11509567


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCSTCGA-N5-A4RT-01ANRXN2chr11

64387766

-NSD1chr5

176665238

+
TCGALDUCSTCGA-N5-A4RT-01ANRXN2chr11

64387766

-NSD1chr5

176666757

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000377559ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000377559ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000377559ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000377559ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176665238

+
5CDS-intronENST00000377559ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000265459ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000265459ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000265459ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000265459ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176665238

+
5CDS-intronENST00000265459ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000301894ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000301894ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000301894ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000301894ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176665238

+
5CDS-intronENST00000301894ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000377551ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000377551ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000377551ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000377551ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176665238

+
5CDS-intronENST00000377551ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000409571ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000409571ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000409571ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176665238

+
Frame-shitENST00000409571ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176665238

+
5CDS-intronENST00000409571ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176665238

+
intron-3CDSENST00000496291ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176665238

+
intron-3CDSENST00000496291ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176665238

+
intron-3CDSENST00000496291ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176665238

+
intron-3CDSENST00000496291ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176665238

+
intron-intronENST00000496291ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176665238

+
In-frameENST00000377559ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000377559ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000377559ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000377559ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176666757

+
5CDS-intronENST00000377559ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000265459ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000265459ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000265459ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000265459ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176666757

+
5CDS-intronENST00000265459ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000301894ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000301894ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000301894ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000301894ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176666757

+
5CDS-intronENST00000301894ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000377551ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000377551ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000377551ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000377551ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176666757

+
5CDS-intronENST00000377551ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000409571ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000409571ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000409571ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176666757

+
In-frameENST00000409571ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176666757

+
5CDS-intronENST00000409571ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176666757

+
intron-3CDSENST00000496291ENST00000354179NRXN2chr11

64387766

-NSD1chr5

176666757

+
intron-3CDSENST00000496291ENST00000439151NRXN2chr11

64387766

-NSD1chr5

176666757

+
intron-3CDSENST00000496291ENST00000347982NRXN2chr11

64387766

-NSD1chr5

176666757

+
intron-3CDSENST00000496291ENST00000361032NRXN2chr11

64387766

-NSD1chr5

176666757

+
intron-intronENST00000496291ENST00000511258NRXN2chr11

64387766

-NSD1chr5

176666757

+

Top

FusionProtFeatures for NRXN2_NSD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NRXN2

Q9P2S2

NSD1

Q96L73

Neuronal cell surface protein that may be involved incell recognition and cell adhesion. May mediate intracellularsignaling. Histone methyltransferase. Preferentially methylates'Lys-36' of histone H3 and 'Lys-20' of histone H4 (in vitro).Transcriptional intermediary factor capable of both negatively orpositively influencing transcription, depending on the cellularcontext. {ECO:0000269|PubMed:21196496}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-22231368_137114171713Compositional biasNote=Poly-Thr
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-22231374_137714171713Compositional biasNote=Poly-Thr
HgeneNRXN2chr11:64387766chr5:176666757ENST00000301894-67322_325371667Compositional biasNote=Poly-Thr
HgeneNRXN2chr11:64387766chr5:176666757ENST00000301894-67328_331371667Compositional biasNote=Poly-Thr
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-21221368_137114171713Compositional biasNote=Poly-Thr
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-21221374_137714171713Compositional biasNote=Poly-Thr
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-22231096_113314171713DomainEGF-like 3
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-22231137_134514171713DomainLaminin G-like 6
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-2223202_24214171713DomainEGF-like 1
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-2223289_48614171713DomainLaminin G-like 2
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-222329_20614171713DomainLaminin G-like 1
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-2223493_68614171713DomainLaminin G-like 3
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-2223690_72714171713DomainEGF-like 2
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-2223732_90414171713DomainLaminin G-like 4
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-2223918_109314171713DomainLaminin G-like 5
HgeneNRXN2chr11:64387766chr5:176666757ENST00000301894-6791_299371667DomainLaminin G-like
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-21221096_113314171713DomainEGF-like 3
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-21221137_134514171713DomainLaminin G-like 6
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-2122202_24214171713DomainEGF-like 1
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-2122289_48614171713DomainLaminin G-like 2
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-212229_20614171713DomainLaminin G-like 1
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-2122493_68614171713DomainLaminin G-like 3
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-2122690_72714171713DomainEGF-like 2
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-2122732_90414171713DomainLaminin G-like 4
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-2122918_109314171713DomainLaminin G-like 5
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-19201096_113313471643DomainEGF-like 3
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-19201137_134513471643DomainLaminin G-like 6
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-1920202_24213471643DomainEGF-like 1
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-1920289_48613471643DomainLaminin G-like 2
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-192029_20613471643DomainLaminin G-like 1
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-1920493_68613471643DomainLaminin G-like 3
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-1920690_72713471643DomainEGF-like 2
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-1920732_90413471643DomainLaminin G-like 4
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-1920918_109313471643DomainLaminin G-like 5
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7242207_242111282428Compositional biasNote=Pro-rich
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7242207_242111282428Compositional biasNote=Pro-rich
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3202207_242112942594Compositional biasNote=Pro-rich
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6232207_242113972697Compositional biasNote=Pro-rich
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7241756_181811282428DomainPWWP 2
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7241890_194011282428DomainAWS
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7241942_205911282428DomainSET
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7242066_208211282428DomainPost-SET
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7241756_181811282428DomainPWWP 2
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7241890_194011282428DomainAWS
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7241942_205911282428DomainSET
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7242066_208211282428DomainPost-SET
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3201756_181812942594DomainPWWP 2
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3201890_194012942594DomainAWS
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3201942_205912942594DomainSET
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3202066_208212942594DomainPost-SET
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6231756_181813972697DomainPWWP 2
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6231890_194013972697DomainAWS
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6231942_205913972697DomainSET
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6232066_208213972697DomainPost-SET
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7241952_195411282428RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7241994_199711282428RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7242020_202111282428RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7242060_206611282428RegionNote=Inhibits enzyme activity in the absence of bound histone
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7241952_195411282428RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7241994_199711282428RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7242020_202111282428RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7242060_206611282428RegionNote=Inhibits enzyme activity in the absence of bound histone
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3201952_195412942594RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3201994_199712942594RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3202020_202112942594RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3202060_206612942594RegionNote=Inhibits enzyme activity in the absence of bound histone
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6231952_195413972697RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6231994_199713972697RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6232020_202113972697RegionNote=S-adenosyl-L-methionine binding
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6232060_206613972697RegionNote=Inhibits enzyme activity in the absence of bound histone
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7241543_158911282428Zinc fingerPHD-type 1
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7241590_164611282428Zinc fingerPHD-type 2
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7241707_175111282428Zinc fingerPHD-type 3
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+7242118_216511282428Zinc fingerPHD-type 4%3B atypical
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7241543_158911282428Zinc fingerPHD-type 1
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7241590_164611282428Zinc fingerPHD-type 2
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7241707_175111282428Zinc fingerPHD-type 3
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+7242118_216511282428Zinc fingerPHD-type 4%3B atypical
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3201543_158912942594Zinc fingerPHD-type 1
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3201590_164612942594Zinc fingerPHD-type 2
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3201707_175112942594Zinc fingerPHD-type 3
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+3202118_216512942594Zinc fingerPHD-type 4%3B atypical
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6231543_158913972697Zinc fingerPHD-type 1
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6231590_164613972697Zinc fingerPHD-type 2
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6231707_175113972697Zinc fingerPHD-type 3
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+6232118_216513972697Zinc fingerPHD-type 4%3B atypical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-22231444_144714171713Compositional biasNote=Poly-Pro
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-22231644_164714171713Compositional biasNote=Poly-Ala
HgeneNRXN2chr11:64387766chr5:176666757ENST00000301894-67398_401371667Compositional biasNote=Poly-Pro
HgeneNRXN2chr11:64387766chr5:176666757ENST00000301894-67598_601371667Compositional biasNote=Poly-Ala
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-21221444_144714171713Compositional biasNote=Poly-Pro
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-21221644_164714171713Compositional biasNote=Poly-Ala
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-19201368_137113471643Compositional biasNote=Poly-Thr
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-19201374_137713471643Compositional biasNote=Poly-Thr
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-19201444_144713471643Compositional biasNote=Poly-Pro
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-19201644_164713471643Compositional biasNote=Poly-Ala
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-22231658_171214171713Topological domainCytoplasmic
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-222329_163614171713Topological domainExtracellular
HgeneNRXN2chr11:64387766chr5:176666757ENST00000301894-6751_590371667Topological domainExtracellular
HgeneNRXN2chr11:64387766chr5:176666757ENST00000301894-67612_666371667Topological domainCytoplasmic
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-21221658_171214171713Topological domainCytoplasmic
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-212229_163614171713Topological domainExtracellular
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-19201658_171213471643Topological domainCytoplasmic
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-192029_163613471643Topological domainExtracellular
HgeneNRXN2chr11:64387766chr5:176666757ENST00000265459-22231637_165714171713TransmembraneHelical
HgeneNRXN2chr11:64387766chr5:176666757ENST00000301894-67591_611371667TransmembraneHelical
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377551-21221637_165714171713TransmembraneHelical
HgeneNRXN2chr11:64387766chr5:176666757ENST00000377559-19201637_165713471643TransmembraneHelical
TgeneNSD1chr11:64387766chr5:176666757ENST00000347982+724323_38811282428DomainPWWP 1
TgeneNSD1chr11:64387766chr5:176666757ENST00000354179+724323_38811282428DomainPWWP 1
TgeneNSD1chr11:64387766chr5:176666757ENST00000361032+320323_38812942594DomainPWWP 1
TgeneNSD1chr11:64387766chr5:176666757ENST00000439151+623323_38813972697DomainPWWP 1


Top

FusionGeneSequence for NRXN2_NSD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_1299aa
EIMKVNVKENQLRNFLNPMIXTLDLCPRRGTLAFLKSAMKLVTWRMAXLNLVPHLIQKILVEALPRYLTSQGSENDRGMLQPRCSVKKXK
MMTRQKRFQAQRENXCLTGRPQAPRRLLRKVXNTIPGCLPLKKCRVNAVEELHSRRMSVRIVKNWVSCCYVRLSAVGLSTWSALDXLRCQ
EENLSAMNVAQESIPVLYVSRVGKMLKGAFYPCVESFTMKSVSRSTHPLLCRTRASGAPSTSVXPVMLLIQPMFLHLKVGXCAVSAVLWH
TTPMTFAWLLGQRSLHLIVSSALITLPLGGAAEIMSMLMLAGALCAQKEAAFCAVILALLLFIVNAXTLISLKETGIAMTVKQAKSHTTG
RLSGXKLDDTGGGQLRSAILELFLPTLIRXDMMWESSQSSFLDLMTICGLTRPESSLTWRVTXAARIRWAKEWMGHIKKLFRKLQQGLRN
XRPKKSXDSCRKTERMTRSHHLINIXRXTVLLAGYRSSLQTYLKYPVATVKLLMRTPVGXTLNASTACCSMSATPQCVLPEGAVKTSAFP
SANIQRLKFSAHYSGVGVYGQKQILKRVNLXMSMWVSLXMKKNAELEFAMLKNMISLISICSPXTKTESLMLVPKETMLGSXIIAASPTV
KHRSGLXMEIPVXAFLHXVTLKQALNLPSTTTXNVLGMERLFANVEPRTAVASWVXGQRINPLPRKKSQRNSRRSNRESAGPRVKSQRSE
KMSVLVVGMLASSSPARNQAAQKFTTQTVSIXPSDQQGNGNVRGISVTSAGRKQPPSVRCAPAPFVSSIEKGCFSFPNWMGVCLVLSMTP
VGPILWNLGRSVSMCLPQYRCLQGQALTWQSNQQEWLLRHPKCQINLLLTPTRCCRSPKKLWQGLVRGHCYLKDLLRELTPGPSLXIRSE
TSLGQGPNPNPWFPARGHWTGHQQWQDQDPSXATNPLQXPAQAPHPQSGPNHWKDLWGRLTQGWINPXVLPAQGPSHWRKPQFPLAXDFR
RQTDCSLLAVPNPRLQTGLLTNPMPLCPRDSHLLRKYYQLWSRPLXLKKKHXGLWTRILSQKIELLWXWISXTXLLARRSGQLHLIRSHH
RLMRRCQCWSQVHGLPAKVWGICRELLRKAVCQILFRHLGKQQPLQRTPGKLLNHSPRPDFFLSLLPRPFYMSQQLRPQEELLQGLSRPQ
GLLANPRAWXSRRSRWSEASNYLHLPPRVGNLLGLSGRPQPPSPLKKRSWXPQSKVPGPWEKPHHGQGSGPXWLDRHWHSLAGLLGAHRH

>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_1299aa
EIMKVNVKENQLRNFLNPMIXTLDLCPRRGTLAFLKSAMKLVTWRMAXLNLVPHLIQKILVEALPRYLTSQGSENDRGMLQPRCSVKKXK
MMTRQKRFQAQRENXCLTGRPQAPRRLLRKVXNTIPGCLPLKKCRVNAVEELHSRRMSVRIVKNWVSCCYVRLSAVGLSTWSALDXLRCQ
EENLSAMNVAQESIPVLYVSRVGKMLKGAFYPCVESFTMKSVSRSTHPLLCRTRASGAPSTSVXPVMLLIQPMFLHLKVGXCAVSAVLWH
TTPMTFAWLLGQRSLHLIVSSALITLPLGGAAEIMSMLMLAGALCAQKEAAFCAVILALLLFIVNAXTLISLKETGIAMTVKQAKSHTTG
RLSGXKLDDTGGGQLRSAILELFLPTLIRXDMMWESSQSSFLDLMTICGLTRPESSLTWRVTXAARIRWAKEWMGHIKKLFRKLQQGLRN
XRPKKSXDSCRKTERMTRSHHLINIXRXTVLLAGYRSSLQTYLKYPVATVKLLMRTPVGXTLNASTACCSMSATPQCVLPEGAVKTSAFP
SANIQRLKFSAHYSGVGVYGQKQILKRVNLXMSMWVSLXMKKNAELEFAMLKNMISLISICSPXTKTESLMLVPKETMLGSXIIAASPTV
KHRSGLXMEIPVXAFLHXVTLKQALNLPSTTTXNVLGMERLFANVEPRTAVASWVXGQRINPLPRKKSQRNSRRSNRESAGPRVKSQRSE
KMSVLVVGMLASSSPARNQAAQKFTTQTVSIXPSDQQGNGNVRGISVTSAGRKQPPSVRCAPAPFVSSIEKGCFSFPNWMGVCLVLSMTP
VGPILWNLGRSVSMCLPQYRCLQGQALTWQSNQQEWLLRHPKCQINLLLTPTRCCRSPKKLWQGLVRGHCYLKDLLRELTPGPSLXIRSE
TSLGQGPNPNPWFPARGHWTGHQQWQDQDPSXATNPLQXPAQAPHPQSGPNHWKDLWGRLTQGWINPXVLPAQGPSHWRKPQFPLAXDFR
RQTDCSLLAVPNPRLQTGLLTNPMPLCPRDSHLLRKYYQLWSRPLXLKKKHXGLWTRILSQKIELLWXWISXTXLLARRSGQLHLIRSHH
RLMRRCQCWSQVHGLPAKVWGICRELLRKAVCQILFRHLGKQQPLQRTPGKLLNHSPRPDFFLSLLPRPFYMSQQLRPQEELLQGLSRPQ
GLLANPRAWXSRRSRWSEASNYLHLPPRVGNLLGLSGRPQPPSPLKKRSWXPQSKVPGPWEKPHHGQGSGPXWLDRHWHSLAGLLGAHRH

>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_1299aa
EIMKVNVKENQLRNFLNPMIXTLDLCPRRGTLAFLKSAMKLVTWRMAXLNLVPHLIQKILVEALPRYLTSQGSENDRGMLQPRCSVKKXK
MMTRQKRFQAQRENXCLTGRPQAPRRLLRKVXNTIPGCLPLKKCRVNAVEELHSRRMSVRIVKNWVSCCYVRLSAVGLSTWSALDXLRCQ
EENLSAMNVAQESIPVLYVSRVGKMLKGAFYPCVESFTMKSVSRSTHPLLCRTRASGAPSTSVXPVMLLIQPMFLHLKVGXCAVSAVLWH
TTPMTFAWLLGQRSLHLIVSSALITLPLGGAAEIMSMLMLAGALCAQKEAAFCAVILALLLFIVNAXTLISLKETGIAMTVKQAKSHTTG
RLSGXKLDDTGGGQLRSAILELFLPTLIRXDMMWESSQSSFLDLMTICGLTRPESSLTWRVTXAARIRWAKEWMGHIKKLFRKLQQGLRN
XRPKKSXDSCRKTERMTRSHHLINIXRXTVLLAGYRSSLQTYLKYPVATVKLLMRTPVGXTLNASTACCSMSATPQCVLPEGAVKTSAFP
SANIQRLKFSAHYSGVGVYGQKQILKRVNLXMSMWVSLXMKKNAELEFAMLKNMISLISICSPXTKTESLMLVPKETMLGSXIIAASPTV
KHRSGLXMEIPVXAFLHXVTLKQALNLPSTTTXNVLGMERLFANVEPRTAVASWVXGQRINPLPRKKSQRNSRRSNRESAGPRVKSQRSE
KMSVLVVGMLASSSPARNQAAQKFTTQTVSIXPSDQQGNGNVRGISVTSAGRKQPPSVRCAPAPFVSSIEKGCFSFPNWMGVCLVLSMTP
VGPILWNLGRSVSMCLPQYRCLQGQALTWQSNQQEWLLRHPKCQINLLLTPTRCCRSPKKLWQGLVRGHCYLKDLLRELTPGPSLXIRSE
TSLGQGPNPNPWFPARGHWTGHQQWQDQDPSXATNPLQXPAQAPHPQSGPNHWKDLWGRLTQGWINPXVLPAQGPSHWRKPQFPLAXDFR
RQTDCSLLAVPNPRLQTGLLTNPMPLCPRDSHLLRKYYQLWSRPLXLKKKHXGLWTRILSQKIELLWXWISXTXLLARRSGQLHLIRSHH
RLMRRCQCWSQVHGLPAKVWGICRELLRKAVCQILFRHLGKQQPLQRTPGKLLNHSPRPDFFLSLLPRPFYMSQQLRPQEELLQGLSRPQ
GLLANPRAWXSRRSRWSEASNYLHLPPRVGNLLGLSGRPQPPSPLKKRSWXPQSKVPGPWEKPHHGQGSGPXWLDRHWHSLAGLLGAHRH

>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_1299aa
EIMKVNVKENQLRNFLNPMIXTLDLCPRRGTLAFLKSAMKLVTWRMAXLNLVPHLIQKILVEALPRYLTSQGSENDRGMLQPRCSVKKXK
MMTRQKRFQAQRENXCLTGRPQAPRRLLRKVXNTIPGCLPLKKCRVNAVEELHSRRMSVRIVKNWVSCCYVRLSAVGLSTWSALDXLRCQ
EENLSAMNVAQESIPVLYVSRVGKMLKGAFYPCVESFTMKSVSRSTHPLLCRTRASGAPSTSVXPVMLLIQPMFLHLKVGXCAVSAVLWH
TTPMTFAWLLGQRSLHLIVSSALITLPLGGAAEIMSMLMLAGALCAQKEAAFCAVILALLLFIVNAXTLISLKETGIAMTVKQAKSHTTG
RLSGXKLDDTGGGQLRSAILELFLPTLIRXDMMWESSQSSFLDLMTICGLTRPESSLTWRVTXAARIRWAKEWMGHIKKLFRKLQQGLRN
XRPKKSXDSCRKTERMTRSHHLINIXRXTVLLAGYRSSLQTYLKYPVATVKLLMRTPVGXTLNASTACCSMSATPQCVLPEGAVKTSAFP
SANIQRLKFSAHYSGVGVYGQKQILKRVNLXMSMWVSLXMKKNAELEFAMLKNMISLISICSPXTKTESLMLVPKETMLGSXIIAASPTV
KHRSGLXMEIPVXAFLHXVTLKQALNLPSTTTXNVLGMERLFANVEPRTAVASWVXGQRINPLPRKKSQRNSRRSNRESAGPRVKSQRSE
KMSVLVVGMLASSSPARNQAAQKFTTQTVSIXPSDQQGNGNVRGISVTSAGRKQPPSVRCAPAPFVSSIEKGCFSFPNWMGVCLVLSMTP
VGPILWNLGRSVSMCLPQYRCLQGQALTWQSNQQEWLLRHPKCQINLLLTPTRCCRSPKKLWQGLVRGHCYLKDLLRELTPGPSLXIRSE
TSLGQGPNPNPWFPARGHWTGHQQWQDQDPSXATNPLQXPAQAPHPQSGPNHWKDLWGRLTQGWINPXVLPAQGPSHWRKPQFPLAXDFR
RQTDCSLLAVPNPRLQTGLLTNPMPLCPRDSHLLRKYYQLWSRPLXLKKKHXGLWTRILSQKIELLWXWISXTXLLARRSGQLHLIRSHH
RLMRRCQCWSQVHGLPAKVWGICRELLRKAVCQILFRHLGKQQPLQRTPGKLLNHSPRPDFFLSLLPRPFYMSQQLRPQEELLQGLSRPQ
GLLANPRAWXSRRSRWSEASNYLHLPPRVGNLLGLSGRPQPPSPLKKRSWXPQSKVPGPWEKPHHGQGSGPXWLDRHWHSLAGLLGAHRH

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_1299aa
EIMKVNVKENQLRNFLNPMIXTLDLCPRRGTLAFLKSAMKLVTWRMAXLNLVPHLIQKILVEALPRYLTSQGSENDRGMLQPRCSVKKXK
MMTRQKRFQAQRENXCLTGRPQAPRRLLRKVXNTIPGCLPLKKCRVNAVEELHSRRMSVRIVKNWVSCCYVRLSAVGLSTWSALDXLRCQ
EENLSAMNVAQESIPVLYVSRVGKMLKGAFYPCVESFTMKSVSRSTHPLLCRTRASGAPSTSVXPVMLLIQPMFLHLKVGXCAVSAVLWH
TTPMTFAWLLGQRSLHLIVSSALITLPLGGAAEIMSMLMLAGALCAQKEAAFCAVILALLLFIVNAXTLISLKETGIAMTVKQAKSHTTG
RLSGXKLDDTGGGQLRSAILELFLPTLIRXDMMWESSQSSFLDLMTICGLTRPESSLTWRVTXAARIRWAKEWMGHIKKLFRKLQQGLRN
XRPKKSXDSCRKTERMTRSHHLINIXRXTVLLAGYRSSLQTYLKYPVATVKLLMRTPVGXTLNASTACCSMSATPQCVLPEGAVKTSAFP
SANIQRLKFSAHYSGVGVYGQKQILKRVNLXMSMWVSLXMKKNAELEFAMLKNMISLISICSPXTKTESLMLVPKETMLGSXIIAASPTV
KHRSGLXMEIPVXAFLHXVTLKQALNLPSTTTXNVLGMERLFANVEPRTAVASWVXGQRINPLPRKKSQRNSRRSNRESAGPRVKSQRSE
KMSVLVVGMLASSSPARNQAAQKFTTQTVSIXPSDQQGNGNVRGISVTSAGRKQPPSVRCAPAPFVSSIEKGCFSFPNWMGVCLVLSMTP
VGPILWNLGRSVSMCLPQYRCLQGQALTWQSNQQEWLLRHPKCQINLLLTPTRCCRSPKKLWQGLVRGHCYLKDLLRELTPGPSLXIRSE
TSLGQGPNPNPWFPARGHWTGHQQWQDQDPSXATNPLQXPAQAPHPQSGPNHWKDLWGRLTQGWINPXVLPAQGPSHWRKPQFPLAXDFR
RQTDCSLLAVPNPRLQTGLLTNPMPLCPRDSHLLRKYYQLWSRPLXLKKKHXGLWTRILSQKIELLWXWISXTXLLARRSGQLHLIRSHH
RLMRRCQCWSQVHGLPAKVWGICRELLRKAVCQILFRHLGKQQPLQRTPGKLLNHSPRPDFFLSLLPRPFYMSQQLRPQEELLQGLSRPQ
GLLANPRAWXSRRSRWSEASNYLHLPPRVGNLLGLSGRPQPPSPLKKRSWXPQSKVPGPWEKPHHGQGSGPXWLDRHWHSLAGLLGAHRH

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_1299aa
EIMKVNVKENQLRNFLNPMIXTLDLCPRRGTLAFLKSAMKLVTWRMAXLNLVPHLIQKILVEALPRYLTSQGSENDRGMLQPRCSVKKXK
MMTRQKRFQAQRENXCLTGRPQAPRRLLRKVXNTIPGCLPLKKCRVNAVEELHSRRMSVRIVKNWVSCCYVRLSAVGLSTWSALDXLRCQ
EENLSAMNVAQESIPVLYVSRVGKMLKGAFYPCVESFTMKSVSRSTHPLLCRTRASGAPSTSVXPVMLLIQPMFLHLKVGXCAVSAVLWH
TTPMTFAWLLGQRSLHLIVSSALITLPLGGAAEIMSMLMLAGALCAQKEAAFCAVILALLLFIVNAXTLISLKETGIAMTVKQAKSHTTG
RLSGXKLDDTGGGQLRSAILELFLPTLIRXDMMWESSQSSFLDLMTICGLTRPESSLTWRVTXAARIRWAKEWMGHIKKLFRKLQQGLRN
XRPKKSXDSCRKTERMTRSHHLINIXRXTVLLAGYRSSLQTYLKYPVATVKLLMRTPVGXTLNASTACCSMSATPQCVLPEGAVKTSAFP
SANIQRLKFSAHYSGVGVYGQKQILKRVNLXMSMWVSLXMKKNAELEFAMLKNMISLISICSPXTKTESLMLVPKETMLGSXIIAASPTV
KHRSGLXMEIPVXAFLHXVTLKQALNLPSTTTXNVLGMERLFANVEPRTAVASWVXGQRINPLPRKKSQRNSRRSNRESAGPRVKSQRSE
KMSVLVVGMLASSSPARNQAAQKFTTQTVSIXPSDQQGNGNVRGISVTSAGRKQPPSVRCAPAPFVSSIEKGCFSFPNWMGVCLVLSMTP
VGPILWNLGRSVSMCLPQYRCLQGQALTWQSNQQEWLLRHPKCQINLLLTPTRCCRSPKKLWQGLVRGHCYLKDLLRELTPGPSLXIRSE
TSLGQGPNPNPWFPARGHWTGHQQWQDQDPSXATNPLQXPAQAPHPQSGPNHWKDLWGRLTQGWINPXVLPAQGPSHWRKPQFPLAXDFR
RQTDCSLLAVPNPRLQTGLLTNPMPLCPRDSHLLRKYYQLWSRPLXLKKKHXGLWTRILSQKIELLWXWISXTXLLARRSGQLHLIRSHH
RLMRRCQCWSQVHGLPAKVWGICRELLRKAVCQILFRHLGKQQPLQRTPGKLLNHSPRPDFFLSLLPRPFYMSQQLRPQEELLQGLSRPQ
GLLANPRAWXSRRSRWSEASNYLHLPPRVGNLLGLSGRPQPPSPLKKRSWXPQSKVPGPWEKPHHGQGSGPXWLDRHWHSLAGLLGAHRH

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_1299aa
EIMKVNVKENQLRNFLNPMIXTLDLCPRRGTLAFLKSAMKLVTWRMAXLNLVPHLIQKILVEALPRYLTSQGSENDRGMLQPRCSVKKXK
MMTRQKRFQAQRENXCLTGRPQAPRRLLRKVXNTIPGCLPLKKCRVNAVEELHSRRMSVRIVKNWVSCCYVRLSAVGLSTWSALDXLRCQ
EENLSAMNVAQESIPVLYVSRVGKMLKGAFYPCVESFTMKSVSRSTHPLLCRTRASGAPSTSVXPVMLLIQPMFLHLKVGXCAVSAVLWH
TTPMTFAWLLGQRSLHLIVSSALITLPLGGAAEIMSMLMLAGALCAQKEAAFCAVILALLLFIVNAXTLISLKETGIAMTVKQAKSHTTG
RLSGXKLDDTGGGQLRSAILELFLPTLIRXDMMWESSQSSFLDLMTICGLTRPESSLTWRVTXAARIRWAKEWMGHIKKLFRKLQQGLRN
XRPKKSXDSCRKTERMTRSHHLINIXRXTVLLAGYRSSLQTYLKYPVATVKLLMRTPVGXTLNASTACCSMSATPQCVLPEGAVKTSAFP
SANIQRLKFSAHYSGVGVYGQKQILKRVNLXMSMWVSLXMKKNAELEFAMLKNMISLISICSPXTKTESLMLVPKETMLGSXIIAASPTV
KHRSGLXMEIPVXAFLHXVTLKQALNLPSTTTXNVLGMERLFANVEPRTAVASWVXGQRINPLPRKKSQRNSRRSNRESAGPRVKSQRSE
KMSVLVVGMLASSSPARNQAAQKFTTQTVSIXPSDQQGNGNVRGISVTSAGRKQPPSVRCAPAPFVSSIEKGCFSFPNWMGVCLVLSMTP
VGPILWNLGRSVSMCLPQYRCLQGQALTWQSNQQEWLLRHPKCQINLLLTPTRCCRSPKKLWQGLVRGHCYLKDLLRELTPGPSLXIRSE
TSLGQGPNPNPWFPARGHWTGHQQWQDQDPSXATNPLQXPAQAPHPQSGPNHWKDLWGRLTQGWINPXVLPAQGPSHWRKPQFPLAXDFR
RQTDCSLLAVPNPRLQTGLLTNPMPLCPRDSHLLRKYYQLWSRPLXLKKKHXGLWTRILSQKIELLWXWISXTXLLARRSGQLHLIRSHH
RLMRRCQCWSQVHGLPAKVWGICRELLRKAVCQILFRHLGKQQPLQRTPGKLLNHSPRPDFFLSLLPRPFYMSQQLRPQEELLQGLSRPQ
GLLANPRAWXSRRSRWSEASNYLHLPPRVGNLLGLSGRPQPPSPLKKRSWXPQSKVPGPWEKPHHGQGSGPXWLDRHWHSLAGLLGAHRH

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_1299aa
EIMKVNVKENQLRNFLNPMIXTLDLCPRRGTLAFLKSAMKLVTWRMAXLNLVPHLIQKILVEALPRYLTSQGSENDRGMLQPRCSVKKXK
MMTRQKRFQAQRENXCLTGRPQAPRRLLRKVXNTIPGCLPLKKCRVNAVEELHSRRMSVRIVKNWVSCCYVRLSAVGLSTWSALDXLRCQ
EENLSAMNVAQESIPVLYVSRVGKMLKGAFYPCVESFTMKSVSRSTHPLLCRTRASGAPSTSVXPVMLLIQPMFLHLKVGXCAVSAVLWH
TTPMTFAWLLGQRSLHLIVSSALITLPLGGAAEIMSMLMLAGALCAQKEAAFCAVILALLLFIVNAXTLISLKETGIAMTVKQAKSHTTG
RLSGXKLDDTGGGQLRSAILELFLPTLIRXDMMWESSQSSFLDLMTICGLTRPESSLTWRVTXAARIRWAKEWMGHIKKLFRKLQQGLRN
XRPKKSXDSCRKTERMTRSHHLINIXRXTVLLAGYRSSLQTYLKYPVATVKLLMRTPVGXTLNASTACCSMSATPQCVLPEGAVKTSAFP
SANIQRLKFSAHYSGVGVYGQKQILKRVNLXMSMWVSLXMKKNAELEFAMLKNMISLISICSPXTKTESLMLVPKETMLGSXIIAASPTV
KHRSGLXMEIPVXAFLHXVTLKQALNLPSTTTXNVLGMERLFANVEPRTAVASWVXGQRINPLPRKKSQRNSRRSNRESAGPRVKSQRSE
KMSVLVVGMLASSSPARNQAAQKFTTQTVSIXPSDQQGNGNVRGISVTSAGRKQPPSVRCAPAPFVSSIEKGCFSFPNWMGVCLVLSMTP
VGPILWNLGRSVSMCLPQYRCLQGQALTWQSNQQEWLLRHPKCQINLLLTPTRCCRSPKKLWQGLVRGHCYLKDLLRELTPGPSLXIRSE
TSLGQGPNPNPWFPARGHWTGHQQWQDQDPSXATNPLQXPAQAPHPQSGPNHWKDLWGRLTQGWINPXVLPAQGPSHWRKPQFPLAXDFR
RQTDCSLLAVPNPRLQTGLLTNPMPLCPRDSHLLRKYYQLWSRPLXLKKKHXGLWTRILSQKIELLWXWISXTXLLARRSGQLHLIRSHH
RLMRRCQCWSQVHGLPAKVWGICRELLRKAVCQILFRHLGKQQPLQRTPGKLLNHSPRPDFFLSLLPRPFYMSQQLRPQEELLQGLSRPQ
GLLANPRAWXSRRSRWSEASNYLHLPPRVGNLLGLSGRPQPPSPLKKRSWXPQSKVPGPWEKPHHGQGSGPXWLDRHWHSLAGLLGAHRH

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_1671aa
MPPGGSGPGGCPRRPPALAGPLPPPPPPPPPPLLPLLPLLLLLLLGAAEGARVSSSLSTTHHVHHFHSKHGTVPIAINRMPFLTRGGHAG
TTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYH
VVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYN
GLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSD
DEDLEECEPSTGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRH
AAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATSPKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAF
HLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKG
RLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCN
DCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKK
ALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCP
AGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYA
RFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGK
RRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKL
DGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPPGPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERT
DSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRPQLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLE
KTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKPHASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQK
ERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKGCVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQAS
GRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLPALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLA

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_1671aa
MPPGGSGPGGCPRRPPALAGPLPPPPPPPPPPLLPLLPLLLLLLLGAAEGARVSSSLSTTHHVHHFHSKHGTVPIAINRMPFLTRGGHAG
TTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYH
VVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYN
GLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSD
DEDLEECEPSTGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRH
AAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATSPKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAF
HLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKG
RLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCN
DCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKK
ALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCP
AGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYA
RFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGK
RRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKL
DGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPPGPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERT
DSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRPQLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLE
KTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKPHASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQK
ERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKGCVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQAS
GRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLPALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLA

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_1671aa
MPPGGSGPGGCPRRPPALAGPLPPPPPPPPPPLLPLLPLLLLLLLGAAEGARVSSSLSTTHHVHHFHSKHGTVPIAINRMPFLTRGGHAG
TTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYH
VVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYN
GLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSD
DEDLEECEPSTGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRH
AAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATSPKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAF
HLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKG
RLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCN
DCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKK
ALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCP
AGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYA
RFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGK
RRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKL
DGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPPGPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERT
DSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRPQLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLE
KTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKPHASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQK
ERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKGCVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQAS
GRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLPALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLA

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_1671aa
MPPGGSGPGGCPRRPPALAGPLPPPPPPPPPPLLPLLPLLLLLLLGAAEGARVSSSLSTTHHVHHFHSKHGTVPIAINRMPFLTRGGHAG
TTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYH
VVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYN
GLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSD
DEDLEECEPSTGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRH
AAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATSPKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAF
HLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKG
RLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCN
DCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKK
ALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCP
AGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYA
RFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGK
RRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKL
DGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPPGPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERT
DSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRPQLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLE
KTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKPHASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQK
ERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKGCVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQAS
GRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLPALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLA

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_2717aa
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATRALLLYLDDGGDCDFLELLLVDGRLRLR
FTLSCAEPATLQLDTPVADDRWHMVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGA
GRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGC
LKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGG
GAGSHSSAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGG
LPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRVGCAPSKGPE
TLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGD
ITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKG
NSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIA
DALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFS
THQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERL
AIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSA
ETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGNYESKRQRKPTKKLLESNDLDP
GFMPKKGDLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATS
PKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSG
EDVKRCLLPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICP
NHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAV
PSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPY
KHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKT
DIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKA
GTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPK
VYHADCLNLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPP
GPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPP
AVAGPRPQLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKP
HASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHM
PRAVEKGCVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLP
ALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPA

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_2717aa
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATRALLLYLDDGGDCDFLELLLVDGRLRLR
FTLSCAEPATLQLDTPVADDRWHMVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGA
GRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGC
LKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGG
GAGSHSSAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGG
LPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRVGCAPSKGPE
TLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGD
ITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKG
NSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIA
DALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFS
THQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERL
AIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSA
ETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGNYESKRQRKPTKKLLESNDLDP
GFMPKKGDLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATS
PKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSG
EDVKRCLLPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICP
NHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAV
PSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPY
KHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKT
DIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKA
GTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPK
VYHADCLNLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPP
GPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPP
AVAGPRPQLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKP
HASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHM
PRAVEKGCVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLP
ALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPA

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_2717aa
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATRALLLYLDDGGDCDFLELLLVDGRLRLR
FTLSCAEPATLQLDTPVADDRWHMVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGA
GRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGC
LKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGG
GAGSHSSAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGG
LPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRVGCAPSKGPE
TLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGD
ITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKG
NSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIA
DALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFS
THQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERL
AIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSA
ETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGNYESKRQRKPTKKLLESNDLDP
GFMPKKGDLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATS
PKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSG
EDVKRCLLPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICP
NHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAV
PSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPY
KHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKT
DIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKA
GTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPK
VYHADCLNLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPP
GPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPP
AVAGPRPQLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKP
HASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHM
PRAVEKGCVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLP
ALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPA

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_2717aa
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATRALLLYLDDGGDCDFLELLLVDGRLRLR
FTLSCAEPATLQLDTPVADDRWHMVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGA
GRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGC
LKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGG
GAGSHSSAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGG
LPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRVGCAPSKGPE
TLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGD
ITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKG
NSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIA
DALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFS
THQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERL
AIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSA
ETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGNYESKRQRKPTKKLLESNDLDP
GFMPKKGDLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATS
PKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSG
EDVKRCLLPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICP
NHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAV
PSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPY
KHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKT
DIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKA
GTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPK
VYHADCLNLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPP
GPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPP
AVAGPRPQLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKP
HASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHM
PRAVEKGCVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLP
ALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPA

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_2710aa
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATRALLLYLDDGGDCDFLELLLVDGRLRLR
FTLSCAEPATLQLDTPVADDRWHMVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGA
GRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYK
NNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGGGAGSHSS
AQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGGLPEGGRV
DLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTGFLGRVCE
REATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHK
LNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELN
ARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVN
DNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIG
QVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAV
LVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRI
PYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTL
LADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGNYESKRQRKPTKKLLESNDLDPGFMPKKG
DLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATSPKETVEE
GVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCL
LPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNHFTPRR
GCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKM
RHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNR
PIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEF
VNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN
YNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCL
NLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPPGPSTHLA
EQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRP
QLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKPHASLSQR
LPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKG
CVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLPALAAKSG
QSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSS

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_2710aa
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATRALLLYLDDGGDCDFLELLLVDGRLRLR
FTLSCAEPATLQLDTPVADDRWHMVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGA
GRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYK
NNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGGGAGSHSS
AQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGGLPEGGRV
DLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTGFLGRVCE
REATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHK
LNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELN
ARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVN
DNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIG
QVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAV
LVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRI
PYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTL
LADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGNYESKRQRKPTKKLLESNDLDPGFMPKKG
DLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATSPKETVEE
GVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCL
LPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNHFTPRR
GCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKM
RHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNR
PIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEF
VNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN
YNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCL
NLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPPGPSTHLA
EQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRP
QLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKPHASLSQR
LPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKG
CVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLPALAAKSG
QSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSS

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_2710aa
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATRALLLYLDDGGDCDFLELLLVDGRLRLR
FTLSCAEPATLQLDTPVADDRWHMVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGA
GRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYK
NNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGGGAGSHSS
AQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGGLPEGGRV
DLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTGFLGRVCE
REATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHK
LNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELN
ARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVN
DNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIG
QVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAV
LVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRI
PYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTL
LADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGNYESKRQRKPTKKLLESNDLDPGFMPKKG
DLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATSPKETVEE
GVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCL
LPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNHFTPRR
GCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKM
RHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNR
PIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEF
VNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN
YNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCL
NLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPPGPSTHLA
EQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRP
QLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKPHASLSQR
LPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKG
CVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLPALAAKSG
QSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSS

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_2710aa
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATRALLLYLDDGGDCDFLELLLVDGRLRLR
FTLSCAEPATLQLDTPVADDRWHMVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGA
GRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYK
NNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGGGAGSHSS
AQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGGLPEGGRV
DLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTGFLGRVCE
REATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHK
LNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELN
ARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVN
DNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIG
QVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAV
LVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRI
PYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTL
LADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGNYESKRQRKPTKKLLESNDLDPGFMPKKG
DLGLSKKCYEAGHLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEGELMPHRTATSPKETVEE
GVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCL
LPLCGKFYHEECVQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNHFTPRR
GCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKM
RHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNR
PIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEF
VNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN
YNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCL
NLTKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYVPPPVPLPPGPSTHLA
EQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPERPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRP
QLSDKPSPVTSPSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKPQTSDRPTDKPHASLSQR
LPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLIDLTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKG
CVSDPLQTSGKAAAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLPALAAKSG
QSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_3899nt
GAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGG
ACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTG
GTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAA
ATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAG
GTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGA
ATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAA
GAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTC
TACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCC
ACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCAT
ACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGG
GCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTG
CTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGG
AGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGA
GACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGG
GTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAAT
TAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTC
CTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAG
ACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCA
AGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTG
TGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATA
TGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTG
AAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACT
ACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATC
AACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAG
AAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCA
ATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGT
GCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCT
GTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAG
AGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAG
CTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAG
ACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCC
AGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTG
ACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGC
CGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGAC
TCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGT
CAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCAC
AGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCT
GTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGAC
TTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAG
GGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGC
AATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGG
GAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACAT
TGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTC

>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_3899nt
GAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGG
ACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTG
GTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAA
ATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAG
GTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGA
ATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAA
GAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTC
TACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCC
ACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCAT
ACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGG
GCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTG
CTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGG
AGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGA
GACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGG
GTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAAT
TAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTC
CTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAG
ACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCA
AGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTG
TGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATA
TGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTG
AAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACT
ACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATC
AACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAG
AAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCA
ATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGT
GCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCT
GTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAG
AGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAG
CTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAG
ACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCC
AGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTG
ACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGC
CGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGAC
TCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGT
CAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCAC
AGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCT
GTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGAC
TTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAG
GGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGC
AATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGG
GAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACAT
TGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTC

>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_3899nt
GAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGG
ACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTG
GTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAA
ATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAG
GTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGA
ATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAA
GAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTC
TACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCC
ACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCAT
ACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGG
GCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTG
CTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGG
AGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGA
GACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGG
GTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAAT
TAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTC
CTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAG
ACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCA
AGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTG
TGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATA
TGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTG
AAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACT
ACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATC
AACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAG
AAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCA
ATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGT
GCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCT
GTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAG
AGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAG
CTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAG
ACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCC
AGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTG
ACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGC
CGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGAC
TCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGT
CAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCAC
AGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCT
GTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGAC
TTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAG
GGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGC
AATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGG
GAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACAT
TGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTC

>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_3899nt
GAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGG
ACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTG
GTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAA
ATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAG
GTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGA
ATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAA
GAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTC
TACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCC
ACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCAT
ACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGG
GCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTG
CTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGG
AGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGA
GACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGG
GTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAAT
TAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTC
CTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAG
ACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCA
AGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTG
TGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATA
TGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTG
AAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACT
ACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATC
AACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAG
AAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCA
ATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGT
GCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCT
GTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAG
AGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAG
CTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAG
ACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCC
AGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTG
ACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGC
CGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGAC
TCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGT
CAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCAC
AGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCT
GTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGAC
TTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAG
GGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGC
AATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGG
GAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACAT
TGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTC

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_3899nt
GAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGG
ACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTG
GTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAA
ATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAG
GTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGA
ATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAA
GAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTC
TACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCC
ACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCAT
ACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGG
GCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTG
CTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGG
AGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGA
GACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGG
GTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAAT
TAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTC
CTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAG
ACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCA
AGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTG
TGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATA
TGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTG
AAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACT
ACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATC
AACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAG
AAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCA
ATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGT
GCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCT
GTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAG
AGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAG
CTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAG
ACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCC
AGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTG
ACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGC
CGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGAC
TCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGT
CAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCAC
AGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCT
GTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGAC
TTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAG
GGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGC
AATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGG
GAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACAT
TGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTC

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_3899nt
GAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGG
ACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTG
GTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAA
ATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAG
GTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGA
ATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAA
GAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTC
TACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCC
ACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCAT
ACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGG
GCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTG
CTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGG
AGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGA
GACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGG
GTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAAT
TAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTC
CTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAG
ACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCA
AGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTG
TGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATA
TGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTG
AAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACT
ACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATC
AACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAG
AAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCA
ATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGT
GCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCT
GTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAG
AGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAG
CTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAG
ACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCC
AGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTG
ACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGC
CGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGAC
TCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGT
CAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCAC
AGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCT
GTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGAC
TTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAG
GGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGC
AATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGG
GAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACAT
TGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTC

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_3899nt
GAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGG
ACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTG
GTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAA
ATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAG
GTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGA
ATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAA
GAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTC
TACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCC
ACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCAT
ACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGG
GCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTG
CTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGG
AGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGA
GACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGG
GTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAAT
TAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTC
CTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAG
ACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCA
AGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTG
TGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATA
TGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTG
AAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACT
ACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATC
AACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAG
AAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCA
ATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGT
GCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCT
GTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAG
AGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAG
CTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAG
ACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCC
AGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTG
ACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGC
CGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGAC
TCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGT
CAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCAC
AGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCT
GTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGAC
TTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAG
GGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGC
AATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGG
GAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACAT
TGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTC

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_3899nt
GAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGG
ACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTG
GTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAA
ATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAG
GTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGA
ATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAA
GAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTC
TACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCC
ACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCAT
ACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGG
GCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTG
CTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGG
AGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGA
GACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGG
GTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAAT
TAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTC
CTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAG
ACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCA
AGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTG
TGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATA
TGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTG
AAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACT
ACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATC
AACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAG
AAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCA
ATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGT
GCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCT
GTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAG
AGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAG
CTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAG
ACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCC
AGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTG
ACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGC
CGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGAC
TCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGT
CAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCAC
AGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCT
GTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGAC
TTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAG
GGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGC
AATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGG
GAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACAT
TGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTC

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_5013nt
ATGCCCCCCGGGGGGAGCGGGCCGGGGGGGTGCCCGCGCCGCCCCCCGGCCCTGGCTGGGCCCCTGCCGCCGCCTCCACCGCCGCCGCCG
CCACCTCTGCTGCCGCTGTTGCCGCTGTTGCTGCTGTTGCTGCTGGGGGCGGCCGAGGGGGCCCGGGTCTCCTCCAGCCTCAGCACCACC
CACCACGTCCACCACTTCCACAGCAAGCACGGCACCGTGCCCATCGCCATCAACCGCATGCCCTTCCTCACCCGCGGCGGCCACGCCGGG
ACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCC
GTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGAC
CAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCAC
GTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGAT
AACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTG
ACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAAT
GGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTG
CTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACC
ACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGAT
GATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAAT
GATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACT
GAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCAT
GCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGG
ACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGT
GGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTC
CACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGT
AAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACT
GTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGT
CGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGT
ATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGA
GGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAAT
GACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCAT
CCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGG
ACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAA
GCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAG
CCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAAC
TGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCT
GCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTA
CGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGC
TATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCT
CGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGT
GACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAAC
TGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAG
CGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCA
GGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATC
TGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTG
GATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTA
CCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCT
GACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACT
GACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTG
GACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGG
TCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAG
AAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCT
ACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAA
AAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAG
GAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGT
CTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCC
TGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCA
GGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGC
CAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAG
TTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCA
CAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAAT

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_5013nt
ATGCCCCCCGGGGGGAGCGGGCCGGGGGGGTGCCCGCGCCGCCCCCCGGCCCTGGCTGGGCCCCTGCCGCCGCCTCCACCGCCGCCGCCG
CCACCTCTGCTGCCGCTGTTGCCGCTGTTGCTGCTGTTGCTGCTGGGGGCGGCCGAGGGGGCCCGGGTCTCCTCCAGCCTCAGCACCACC
CACCACGTCCACCACTTCCACAGCAAGCACGGCACCGTGCCCATCGCCATCAACCGCATGCCCTTCCTCACCCGCGGCGGCCACGCCGGG
ACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCC
GTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGAC
CAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCAC
GTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGAT
AACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTG
ACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAAT
GGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTG
CTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACC
ACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGAT
GATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAAT
GATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACT
GAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCAT
GCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGG
ACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGT
GGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTC
CACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGT
AAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACT
GTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGT
CGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGT
ATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGA
GGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAAT
GACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCAT
CCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGG
ACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAA
GCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAG
CCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAAC
TGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCT
GCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTA
CGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGC
TATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCT
CGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGT
GACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAAC
TGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAG
CGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCA
GGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATC
TGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTG
GATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTA
CCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCT
GACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACT
GACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTG
GACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGG
TCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAG
AAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCT
ACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAA
AAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAG
GAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGT
CTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCC
TGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCA
GGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGC
CAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAG
TTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCA
CAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAAT

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_5013nt
ATGCCCCCCGGGGGGAGCGGGCCGGGGGGGTGCCCGCGCCGCCCCCCGGCCCTGGCTGGGCCCCTGCCGCCGCCTCCACCGCCGCCGCCG
CCACCTCTGCTGCCGCTGTTGCCGCTGTTGCTGCTGTTGCTGCTGGGGGCGGCCGAGGGGGCCCGGGTCTCCTCCAGCCTCAGCACCACC
CACCACGTCCACCACTTCCACAGCAAGCACGGCACCGTGCCCATCGCCATCAACCGCATGCCCTTCCTCACCCGCGGCGGCCACGCCGGG
ACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCC
GTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGAC
CAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCAC
GTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGAT
AACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTG
ACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAAT
GGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTG
CTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACC
ACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGAT
GATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAAT
GATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACT
GAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCAT
GCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGG
ACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGT
GGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTC
CACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGT
AAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACT
GTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGT
CGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGT
ATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGA
GGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAAT
GACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCAT
CCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGG
ACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAA
GCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAG
CCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAAC
TGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCT
GCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTA
CGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGC
TATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCT
CGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGT
GACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAAC
TGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAG
CGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCA
GGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATC
TGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTG
GATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTA
CCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCT
GACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACT
GACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTG
GACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGG
TCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAG
AAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCT
ACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAA
AAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAG
GAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGT
CTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCC
TGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCA
GGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGC
CAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAG
TTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCA
CAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAAT

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_5013nt
ATGCCCCCCGGGGGGAGCGGGCCGGGGGGGTGCCCGCGCCGCCCCCCGGCCCTGGCTGGGCCCCTGCCGCCGCCTCCACCGCCGCCGCCG
CCACCTCTGCTGCCGCTGTTGCCGCTGTTGCTGCTGTTGCTGCTGGGGGCGGCCGAGGGGGCCCGGGTCTCCTCCAGCCTCAGCACCACC
CACCACGTCCACCACTTCCACAGCAAGCACGGCACCGTGCCCATCGCCATCAACCGCATGCCCTTCCTCACCCGCGGCGGCCACGCCGGG
ACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCC
GTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGAC
CAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCAC
GTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGAT
AACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTG
ACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAAT
GGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTG
CTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACC
ACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGAT
GATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAAT
GATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACT
GAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCAT
GCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGG
ACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGT
GGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTC
CACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGT
AAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACT
GTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGT
CGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGT
ATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGA
GGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAAT
GACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCAT
CCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGG
ACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAA
GCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAG
CCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAAC
TGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCT
GCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTA
CGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGC
TATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCT
CGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGT
GACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAAC
TGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAG
CGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCA
GGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATC
TGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTG
GATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTA
CCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCT
GACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACT
GACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTG
GACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGG
TCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAG
AAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCT
ACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAA
AAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAG
GAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGT
CTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCC
TGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCA
GGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGC
CAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAG
TTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCA
CAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAAT

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_8151nt
ATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAG
TTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAAC
GCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGC
TTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGAC
GCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTG
TTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCC
AACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGC
AACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTC
TGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCC
GGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTAC
GACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACA
GGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTT
GTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACAC
GCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATG
CTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGC
CTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGG
GACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGC
GCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGT
GGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGA
TCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGC
TCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGT
CTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGAC
CTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACG
CTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGC
TTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCAC
ACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACC
CTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAA
ACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGAC
AACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTT
ATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGAC
ATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCA
CTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGC
AACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGG
AACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCC
CGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGC
AACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCC
GACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTC
TGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATC
TTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGC
ACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTG
GGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTC
ACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTG
GCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAAC
AGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTG
CTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCG
GAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGC
CGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTG
GAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCT
GGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCC
ACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAG
ATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGC
CCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCA
CTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGC
CTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGG
GAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAAC
AAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGC
TGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCT
AATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTG
TGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCA
GGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTT
CCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCC
CGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAA
GCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTAT
AAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACT
GATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGC
TGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACA
GATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAA
CATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAAT
CATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCA
GGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTC
TTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAG
GGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAA
GTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAA
GCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTG
TCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCA
GGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAG
ATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCC
CAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCA
GCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTG
GAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTT
CCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCC
CATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGG
CCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCT
TCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATG
CCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTT
AAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCT
GCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCT
GCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACA
GAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGG
TCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCT

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_8151nt
ATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAG
TTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAAC
GCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGC
TTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGAC
GCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTG
TTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCC
AACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGC
AACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTC
TGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCC
GGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTAC
GACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACA
GGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTT
GTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACAC
GCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATG
CTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGC
CTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGG
GACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGC
GCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGT
GGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGA
TCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGC
TCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGT
CTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGAC
CTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACG
CTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGC
TTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCAC
ACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACC
CTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAA
ACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGAC
AACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTT
ATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGAC
ATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCA
CTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGC
AACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGG
AACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCC
CGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGC
AACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCC
GACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTC
TGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATC
TTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGC
ACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTG
GGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTC
ACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTG
GCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAAC
AGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTG
CTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCG
GAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGC
CGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTG
GAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCT
GGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCC
ACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAG
ATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGC
CCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCA
CTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGC
CTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGG
GAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAAC
AAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGC
TGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCT
AATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTG
TGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCA
GGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTT
CCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCC
CGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAA
GCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTAT
AAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACT
GATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGC
TGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACA
GATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAA
CATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAAT
CATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCA
GGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTC
TTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAG
GGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAA
GTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAA
GCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTG
TCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCA
GGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAG
ATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCC
CAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCA
GCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTG
GAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTT
CCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCC
CATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGG
CCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCT
TCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATG
CCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTT
AAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCT
GCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCT
GCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACA
GAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGG
TCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCT

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_8151nt
ATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAG
TTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAAC
GCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGC
TTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGAC
GCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTG
TTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCC
AACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGC
AACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTC
TGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCC
GGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTAC
GACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACA
GGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTT
GTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACAC
GCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATG
CTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGC
CTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGG
GACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGC
GCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGT
GGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGA
TCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGC
TCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGT
CTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGAC
CTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACG
CTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGC
TTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCAC
ACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACC
CTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAA
ACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGAC
AACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTT
ATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGAC
ATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCA
CTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGC
AACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGG
AACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCC
CGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGC
AACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCC
GACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTC
TGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATC
TTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGC
ACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTG
GGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTC
ACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTG
GCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAAC
AGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTG
CTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCG
GAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGC
CGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTG
GAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCT
GGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCC
ACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAG
ATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGC
CCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCA
CTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGC
CTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGG
GAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAAC
AAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGC
TGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCT
AATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTG
TGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCA
GGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTT
CCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCC
CGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAA
GCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTAT
AAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACT
GATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGC
TGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACA
GATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAA
CATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAAT
CATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCA
GGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTC
TTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAG
GGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAA
GTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAA
GCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTG
TCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCA
GGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAG
ATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCC
CAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCA
GCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTG
GAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTT
CCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCC
CATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGG
CCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCT
TCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATG
CCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTT
AAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCT
GCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCT
GCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACA
GAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGG
TCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCT

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_8151nt
ATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAG
TTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAAC
GCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGC
TTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGAC
GCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTG
TTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCC
AACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGC
AACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTC
TGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCC
GGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTAC
GACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACA
GGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTT
GTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACAC
GCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATG
CTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGC
CTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGG
GACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGC
GCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGT
GGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGA
TCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGC
TCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGT
CTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGAC
CTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACG
CTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGC
TTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCAC
ACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACC
CTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAA
ACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGAC
AACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTT
ATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGAC
ATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCA
CTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGC
AACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGG
AACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCC
CGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGC
AACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCC
GACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTC
TGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATC
TTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGC
ACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTG
GGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTC
ACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTG
GCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAAC
AGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTG
CTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCG
GAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGC
CGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTG
GAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCT
GGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCC
ACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAG
ATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGC
CCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCA
CTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGC
CTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGG
GAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAAC
AAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGC
TGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCT
AATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTG
TGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCA
GGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTT
CCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCC
CGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAA
GCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTAT
AAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACT
GATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGC
TGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACA
GATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAA
CATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAAT
CATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCA
GGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTC
TTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAG
GGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAA
GTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAA
GCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTG
TCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCA
GGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAG
ATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCC
CAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCA
GCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTG
GAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTT
CCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCC
CATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGG
CCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCT
TCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATG
CCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTT
AAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCT
GCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCT
GCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACA
GAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGG
TCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCT

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_8130nt
ATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAG
TTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAAC
GCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGC
TTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGAC
GCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTG
TTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCC
AACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGC
AACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTC
TGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCC
GGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTAC
GACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACA
GGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTT
GTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACAC
GCTATGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTC
TACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAG
AACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAG
GATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATC
TCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCT
GCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGG
GCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGC
AGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTG
GACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGC
CGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCC
CCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAG
AGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCC
CTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGG
GGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAG
CTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAG
ATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAAC
TTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAAT
GCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTAT
GCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTC
ATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAAT
GACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCC
AATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCC
TCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGG
CAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGC
TTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTC
ATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTG
CTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGC
ACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCC
ACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATC
CCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATC
GGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGC
GACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTG
CTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGAC
AGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACT
GGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGG
GACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTT
GGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAA
AATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAA
GGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAG
AATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCA
AGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTT
CTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTC
CACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCA
TACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGG
GGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCT
GCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGG
GAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATG
AGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAG
GGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAA
TTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGT
CCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATA
GACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCC
AAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTT
GTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTAT
ATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGT
GAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAAC
TACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAAT
CAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGA
GAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTC
AATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATG
TGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCC
TGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCA
GAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAA
GCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGA
GACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCC
CAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCT
GACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCG
CCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGA
CTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAG
TCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCA
CAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGC
TGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGA
CTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCA
GGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGG
CAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTG
GGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACA
TTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGT

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_8130nt
ATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAG
TTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAAC
GCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGC
TTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGAC
GCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTG
TTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCC
AACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGC
AACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTC
TGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCC
GGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTAC
GACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACA
GGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTT
GTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACAC
GCTATGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTC
TACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAG
AACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAG
GATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATC
TCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCT
GCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGG
GCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGC
AGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTG
GACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGC
CGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCC
CCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAG
AGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCC
CTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGG
GGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAG
CTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAG
ATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAAC
TTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAAT
GCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTAT
GCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTC
ATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAAT
GACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCC
AATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCC
TCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGG
CAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGC
TTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTC
ATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTG
CTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGC
ACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCC
ACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATC
CCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATC
GGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGC
GACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTG
CTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGAC
AGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACT
GGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGG
GACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTT
GGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAA
AATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAA
GGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAG
AATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCA
AGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTT
CTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTC
CACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCA
TACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGG
GGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCT
GCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGG
GAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATG
AGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAG
GGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAA
TTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGT
CCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATA
GACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCC
AAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTT
GTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTAT
ATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGT
GAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAAC
TACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAAT
CAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGA
GAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTC
AATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATG
TGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCC
TGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCA
GAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAA
GCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGA
GACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCC
CAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCT
GACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCG
CCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGA
CTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAG
TCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCA
CAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGC
TGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGA
CTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCA
GGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGG
CAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTG
GGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACA
TTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGT

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_8130nt
ATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAG
TTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAAC
GCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGC
TTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGAC
GCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTG
TTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCC
AACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGC
AACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTC
TGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCC
GGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTAC
GACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACA
GGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTT
GTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACAC
GCTATGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTC
TACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAG
AACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAG
GATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATC
TCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCT
GCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGG
GCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGC
AGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTG
GACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGC
CGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCC
CCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAG
AGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCC
CTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGG
GGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAG
CTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAG
ATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAAC
TTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAAT
GCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTAT
GCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTC
ATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAAT
GACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCC
AATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCC
TCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGG
CAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGC
TTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTC
ATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTG
CTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGC
ACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCC
ACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATC
CCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATC
GGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGC
GACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTG
CTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGAC
AGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACT
GGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGG
GACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTT
GGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAA
AATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAA
GGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAG
AATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCA
AGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTT
CTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTC
CACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCA
TACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGG
GGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCT
GCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGG
GAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATG
AGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAG
GGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAA
TTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGT
CCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATA
GACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCC
AAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTT
GTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTAT
ATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGT
GAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAAC
TACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAAT
CAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGA
GAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTC
AATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATG
TGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCC
TGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCA
GAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAA
GCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGA
GACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCC
CAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCT
GACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCG
CCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGA
CTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAG
TCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCA
CAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGC
TGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGA
CTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCA
GGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGG
CAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTG
GGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACA
TTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGT

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_8130nt
ATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAG
TTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAAC
GCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGC
TTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGAC
GCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTG
TTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCC
AACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGC
AACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTC
TGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCC
GGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTAC
GACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACA
GGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTT
GTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACAC
GCTATGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTC
TACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAG
AACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAG
GATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATC
TCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCT
GCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGG
GCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGC
AGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTG
GACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGC
CGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCC
CCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAG
AGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCC
CTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGG
GGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAG
CTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAG
ATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAAC
TTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAAT
GCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTAT
GCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTC
ATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAAT
GACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCC
AATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCC
TCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGG
CAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGC
TTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTC
ATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTG
CTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGC
ACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCC
ACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATC
CCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATC
GGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGC
GACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTG
CTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGAC
AGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACT
GGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGG
GACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTT
GGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAA
AATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAA
GGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAG
AATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCA
AGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTT
CTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTC
CACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCA
TACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGG
GGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCT
GCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGG
GAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATG
AGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAG
GGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAA
TTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGT
CCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATA
GACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCC
AAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTT
GTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTAT
ATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGT
GAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAAC
TACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAAT
CAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGA
GAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTC
AATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATG
TGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCC
TGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCA
GAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAA
GCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGA
GACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCC
CAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCT
GACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCG
CCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGA
CTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAG
TCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCA
CAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGC
TGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGA
CTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCA
GGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGG
CAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTG
GGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACA
TTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_13154nt
TGCAGGGATGCGGCGGCGGGAGCAGCCGCCCTGACTCGCGGAGCATCCTCCTCGGAGAGGCACCGCGGCGGGGCGGGCGGGCGGGCGGGG
ACGCGGCGGGGAGGGAGAGAGGCGCGAGGCGGCAGACACCGCTAGCCCTGGCTCTGCCACCCGTCGGAGACGGGGCGGCCCTGTAGCTCT
GCTACCCACCCTCCAGCTTCTGGCGCCCCGAGAACCAGGCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCC
GCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCC
GCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGG
GCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCG
GACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGC
CTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGC
CTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTG
CTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTG
GCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGC
GGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGC
GCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTC
GGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGGCAAGGAGGAGTTTGTGGCG
ACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACC
CTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATC
AACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGA
AACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGAT
TACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTC
ATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAG
CTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCC
CGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGG
GCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTG
GACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGG
CGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTAC
CTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGT
GTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCC
CGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATC
GGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAAC
GCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCT
GCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGGTAAAGGCCCCGAAACGCTGTTTGCGGGGCAC
AAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGA
CAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCC
AACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTC
AATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCC
TATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATT
GTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTC
AATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCAC
TCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTG
GCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATT
GGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGAT
GGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCG
CTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCT
GTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTG
GGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAAC
GCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAG
ATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAG
AGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACC
CTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGG
GACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGT
ACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAG
GGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGAT
TTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTG
AAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAG
GAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGT
CAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATG
CCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGC
CTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCC
CTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTG
GCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGG
CGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCT
GCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTAC
AGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAG
ATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATG
GAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAG
GAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAAC
CGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGG
ATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTT
TCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAA
TTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTC
TATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAAC
TGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTC
AACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAG
AATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAG
CGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGT
CTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAG
ATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGAC
CCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTG
GCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAA
AAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTC
AGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGA
CCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACG
GCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTT
CCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAG
AGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACT
CAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACA
CCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAA
GGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCC
AGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACC
CCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGT
GGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCC
CTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAG
ACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCC
AGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGG
GAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCA
GAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGAC
TTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTC
AGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATGGT
GTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCTGT
GAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAAAT
GTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCACAG
AGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTGTG
CAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCA
TTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACACTC
AGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTAC
CAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGTGC
TCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAA
CGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTGGT
GCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTT
GTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCTTA
GTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGGAG
GGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGGTT
GAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAA
TCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAAAA
GGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACATTA
AAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTCAT
ATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTG
TCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGGAG
GGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGAC
AGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCATTC
TCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATG
GACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGCAG
CATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTTGG
AGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAATTG
GAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAG
AGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAATA
CATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCC
AGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACTTA
AATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTATGG
TCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGTTG
CCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTTTA
CCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCCCA
GTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGA
CATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTGCA
ACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCTAA
TTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAGAA
AAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGT
GGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTGGA
GCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTG
CTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTAAC
ATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAA
GGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCCAG
GGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGC
ACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGGGT
CGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTA
GTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAACATGTACTGTAATTCTTTGTATATAGAAAAAAAATTTACTGTAAAGTAAA

>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_13159nt
TGCAGGGATGCGGCGGCGGGAGCAGCCGCCCTGACTCGCGGAGCATCCTCCTCGGAGAGGCACCGCGGCGGGGCGGGCGGGCGGGCGGGG
ACGCGGCGGGGAGGGAGAGAGGCGCGAGGCGGCAGACACCGCTAGCCCTGGCTCTGCCACCCGTCGGAGACGGGGCGGCCCTGTAGCTCT
GCTACCCACCCTCCAGCTTCTGGCGCCCCGAGAACCAGGCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCC
GCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCC
GCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGG
GCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCG
GACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGC
CTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGC
CTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTG
CTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTG
GCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGC
GGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGC
GCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTC
GGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGGCAAGGAGGAGTTTGTGGCG
ACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACC
CTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATC
AACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGA
AACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGAT
TACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTC
ATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAG
CTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCC
CGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGG
GCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTG
GACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGG
CGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTAC
CTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGT
GTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCC
CGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATC
GGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAAC
GCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCT
GCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGGTAAAGGCCCCGAAACGCTGTTTGCGGGGCAC
AAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGA
CAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCC
AACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTC
AATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCC
TATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATT
GTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTC
AATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCAC
TCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTG
GCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATT
GGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGAT
GGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCG
CTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCT
GTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTG
GGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAAC
GCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAG
ATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAG
AGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACC
CTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGG
GACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGT
ACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAG
GGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGAT
TTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTG
AAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAG
GAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGT
CAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATG
CCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGC
CTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCC
CTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTG
GCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGG
CGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCT
GCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTAC
AGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAG
ATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATG
GAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAG
GAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAAC
CGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGG
ATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTT
TCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAA
TTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTC
TATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAAC
TGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTC
AACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAG
AATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAG
CGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGT
CTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAG
ATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGAC
CCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTG
GCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAA
AAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTC
AGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGA
CCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACG
GCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTT
CCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAG
AGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACT
CAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACA
CCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAA
GGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCC
AGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACC
CCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGT
GGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCC
CTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAG
ACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCC
AGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGG
GAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCA
GAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGAC
TTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTC
AGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATGGT
GTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCTGT
GAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAAAT
GTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCACAG
AGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTGTG
CAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCA
TTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACACTC
AGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTAC
CAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGTGC
TCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAA
CGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTGGT
GCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTT
GTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCTTA
GTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGGAG
GGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGGTT
GAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAA
TCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAAAA
GGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACATTA
AAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTCAT
ATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTG
TCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGGAG
GGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGAC
AGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCATTC
TCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATG
GACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGCAG
CATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTTGG
AGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAATTG
GAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAG
AGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAATA
CATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCC
AGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACTTA
AATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTATGG
TCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGTTG
CCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTTTA
CCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCCCA
GTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGA
CATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTGCA
ACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCTAA
TTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAGAA
AAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGT
GGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTGGA
GCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTG
CTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTAAC
ATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAA
GGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCCAG
GGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGC
ACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGGGT
CGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTA
GTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAACATGTACTGTAATTCTTTGTATATAGAAAAAAAATTTACTGTAAAGTAAA

>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_8706nt
TGCAGGGATGCGGCGGCGGGAGCAGCCGCCCTGACTCGCGGAGCATCCTCCTCGGAGAGGCACCGCGGCGGGGCGGGCGGGCGGGCGGGG
ACGCGGCGGGGAGGGAGAGAGGCGCGAGGCGGCAGACACCGCTAGCCCTGGCTCTGCCACCCGTCGGAGACGGGGCGGCCCTGTAGCTCT
GCTACCCACCCTCCAGCTTCTGGCGCCCCGAGAACCAGGCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCC
GCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCC
GCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGG
GCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCG
GACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGC
CTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGC
CTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTG
CTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTG
GCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGC
GGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGC
GCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTC
GGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGGCAAGGAGGAGTTTGTGGCG
ACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACC
CTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATC
AACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGA
AACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGAT
TACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTC
ATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAG
CTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCC
CGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGG
GCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTG
GACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGG
CGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTAC
CTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGT
GTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCC
CGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATC
GGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAAC
GCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCT
GCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGGTAAAGGCCCCGAAACGCTGTTTGCGGGGCAC
AAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGA
CAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCC
AACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTC
AATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCC
TATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATT
GTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTC
AATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCAC
TCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTG
GCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATT
GGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGAT
GGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCG
CTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCT
GTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTG
GGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAAC
GCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAG
ATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAG
AGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACC
CTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGG
GACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGT
ACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAG
GGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGAT
TTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTG
AAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAG
GAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGT
CAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATG
CCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGC
CTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCC
CTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTG
GCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGG
CGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCT
GCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTAC
AGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAG
ATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATG
GAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAG
GAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAAC
CGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGG
ATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTT
TCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAA
TTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTC
TATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAAC
TGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTC
AACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAG
AATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAG
CGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGT
CTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAG
ATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGAC
CCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTG
GCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAA
AAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTC
AGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGA
CCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACG
GCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTT
CCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAG
AGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACT
CAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACA
CCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAA
GGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCC
AGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACC
CCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGT
GGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCC
CTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAG
ACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCC
AGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGG
GAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCA
GAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGAC

>In-frame_NRXN2_ENST00000377559_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_13154nt
TGCAGGGATGCGGCGGCGGGAGCAGCCGCCCTGACTCGCGGAGCATCCTCCTCGGAGAGGCACCGCGGCGGGGCGGGCGGGCGGGCGGGG
ACGCGGCGGGGAGGGAGAGAGGCGCGAGGCGGCAGACACCGCTAGCCCTGGCTCTGCCACCCGTCGGAGACGGGGCGGCCCTGTAGCTCT
GCTACCCACCCTCCAGCTTCTGGCGCCCCGAGAACCAGGCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCC
GCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCC
GCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGG
GCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCG
GACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGC
CTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGC
CTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTG
CTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTG
GCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGC
GGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGC
GCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTC
GGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGGCAAGGAGGAGTTTGTGGCG
ACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACC
CTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATC
AACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGA
AACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAGGAT
TACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAACTTC
ATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAG
CTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCC
CGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGG
GCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTGCTG
GACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGATGGG
CGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTGTAC
CTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGCTGT
GTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCC
CGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGCATC
GGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCTAAC
GCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAGTCT
GCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGGTAAAGGCCCCGAAACGCTGTTTGCGGGGCAC
AAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGA
CAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCC
AACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTC
AATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCC
TATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATT
GTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTC
AATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCAC
TCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTG
GCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATT
GGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGAT
GGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCG
CTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCT
GTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTG
GGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAAC
GCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAG
ATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAG
AGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACC
CTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGG
GACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGT
ACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAG
GGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGAT
TTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTG
AAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAG
GAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGT
CAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATG
CCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGC
CTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCC
CTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTG
GCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGG
CGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCT
GCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTAC
AGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAG
ATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATG
GAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAG
GAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAAC
CGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGG
ATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTT
TCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAA
TTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTC
TATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAAC
TGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTC
AACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAG
AATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAG
CGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGT
CTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAG
ATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGAC
CCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTG
GCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAA
AAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTC
AGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGA
CCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACG
GCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTT
CCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAG
AGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACT
CAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACA
CCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAA
GGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCC
AGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACC
CCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGT
GGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCC
CTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAG
ACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCC
AGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGG
GAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCA
GAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGAC
TTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTC
AGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATGGT
GTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCTGT
GAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAAAT
GTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCACAG
AGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTGTG
CAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCA
TTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACACTC
AGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTAC
CAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGTGC
TCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAA
CGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTGGT
GCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTT
GTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCTTA
GTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGGAG
GGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGGTT
GAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAA
TCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAAAA
GGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACATTA
AAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTCAT
ATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTG
TCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGGAG
GGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGAC
AGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCATTC
TCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATG
GACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGCAG
CATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTTGG
AGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAATTG
GAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAG
AGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAATA
CATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCC
AGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACTTA
AATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTATGG
TCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGTTG
CCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTTTA
CCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCCCA
GTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGA
CATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTGCA
ACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCTAA
TTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAGAA
AAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGT
GGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTGGA
GCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTG
CTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTAAC
ATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAA
GGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCCAG
GGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGC
ACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGGGT
CGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTA
GTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAACATGTACTGTAATTCTTTGTATATAGAAAAAAAATTTACTGTAAAGTAAA

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_13364nt
TGCAGGGATGCGGCGGCGGGAGCAGCCGCCCTGACTCGCGGAGCATCCTCCTCGGAGAGGCACCGCGGCGGGGCGGGCGGGCGGGCGGGG
ACGCGGCGGGGAGGGAGAGAGGCGCGAGGCGGCAGACACCGCTAGCCCTGGCTCTGCCACCCGTCGGAGACGGGGCGGCCCTGTAGCTCT
GCTACCCACCCTCCAGCTTCTGGCGCCCCGAGAACCAGGCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCC
GCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCC
GCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGG
GCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCG
GACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGC
CTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGC
CTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTG
CTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTG
GCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGC
GGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGC
GCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTC
GGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCC
GAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAG
TTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTG
ATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCC
TTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCA
GGGATTGGACACGCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAG
GATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAAC
TTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATG
AAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTG
CCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGG
CGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTG
CTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGAT
GGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTG
TACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGC
TGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGC
TCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGC
ATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCT
AACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAG
TCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGT
AAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAG
CTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACG
GAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGC
AAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGC
AGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTG
TTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCC
TTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTC
AAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAG
AATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCA
GACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCC
AACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGG
ACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCC
GTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGAC
CAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCAC
GTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGAT
AACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTG
ACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAAT
GGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTG
CTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACC
ACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGAT
GATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAAT
GATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACT
GAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCAT
GCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGG
ACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGT
GGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTC
CACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGT
AAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACT
GTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGT
CGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGT
ATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGA
GGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAAT
GACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCAT
CCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGG
ACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAA
GCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAG
CCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAAC
TGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCT
GCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTA
CGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGC
TATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCT
CGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGT
GACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAAC
TGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAG
CGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCA
GGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATC
TGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTG
GATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTA
CCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCT
GACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACT
GACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTG
GACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGG
TCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAG
AAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCT
ACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAA
AAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAG
GAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGT
CTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCC
TGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCA
GGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGC
CAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAG
TTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCA
CAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAAT
ACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACA
AGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCAC
TGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCC
AGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGG
AGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAG
GGCACCTAGGAACCCTTGGGAGGAAATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTGCTAGTC
ACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGG
GGCCCTGGGGCTTTAGACTCATTTTGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGTGTGCAT
GGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGG
GTCGCCGCTGCTGCTTTTGTCTGGGCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTCTGTGCG
AATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTATTTTTCTCTTTGTACATGAAT
CCACCCCATCCCTATTTCCCTAAAACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAAGCTCTG
AGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCC
TCTTCTTCGCCTCCCTGAGAATTGCTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCTTCCCTG
AAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGC
TGGGGCCCAAGGGCTGGGAAATCTGTTGGTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGTTTGGCT
AGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCG
GCCCTAACGTCTCCTGGCCATTATCTCTTAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAAGTTCTT
ATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGC
TTTTATTTCCCAAAGTCTGTCTCTGAGGTTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTTAGGGGC
CTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACAT
CATCAAAGAGGAAAAGCTCTTTGTTCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGAAAAAGA
TATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAATAAATATATAACTGCAGCTAG
TAGGTCCCTTTCCCTAATCTTTTAGGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTGTAGTTG
TGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAAT
AAACTGTGAATTTGGGGGGGGCGGGGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCTTCTCTA
AAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGC
TTTGTGGTTTTATTTTGGTTCTTTCCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGAGCCATT
TTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTAGAAAACCACTGGAAACTAGA
AATTTGAGCTATTGGGCCCACCAGTAGCAGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGCAGAGTC
ACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAAT
AAGACCCCTTTTCCAAAGGGATGTGAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTGGTATTT
GGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGA
AATTCTCCATGGGTAGCTAGAAAGCCAATACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATTCAAAGC
CTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATCCTCATTTTTAAATGTCTGCT
TTACCCTGTTACTGAGTTTGAGATGACTTAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGTTATTTT
ATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAG
CCGGACTCCCAGGTTGTAATTCTAATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGGAGTAAT
GAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTAAATGATACTGTCATCCTCTT
GGGGTTTATCAGCCAGGTTAGAGGAGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTTCTTGCT
GAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAG
TTCTCAGCTGAGCTTCCTAGGGCCAGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTTGTACAC
ACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGG
TTCCTGTTTGGGAGGAGATTTTATGTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGCACCCAA
CCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCT
TGTCCATAGCCTCCGTCCACGCTGCCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCCTCTCTA
CCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCA
CAACCTCGGAAGAAGTGTTTCGAGTTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTTTCAAAA
CATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGA
AATAAATGGTTCTATGTTTTCAACTTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTGTGTGTA
GATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATA
GACATCTACCTATATTGTTAAGAAAGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCCGCCCCC
ATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAACATGTACTGTAATTCTTTGT

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_13369nt
TGCAGGGATGCGGCGGCGGGAGCAGCCGCCCTGACTCGCGGAGCATCCTCCTCGGAGAGGCACCGCGGCGGGGCGGGCGGGCGGGCGGGG
ACGCGGCGGGGAGGGAGAGAGGCGCGAGGCGGCAGACACCGCTAGCCCTGGCTCTGCCACCCGTCGGAGACGGGGCGGCCCTGTAGCTCT
GCTACCCACCCTCCAGCTTCTGGCGCCCCGAGAACCAGGCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCC
GCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCC
GCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGG
GCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCG
GACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGC
CTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGC
CTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTG
CTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTG
GCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGC
GGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGC
GCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTC
GGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCC
GAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAG
TTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTG
ATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCC
TTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCA
GGGATTGGACACGCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAG
GATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAAC
TTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATG
AAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTG
CCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGG
CGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTG
CTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGAT
GGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTG
TACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGC
TGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGC
TCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGC
ATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCT
AACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAG
TCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGT
AAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAG
CTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACG
GAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGC
AAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGC
AGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTG
TTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCC
TTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTC
AAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAG
AATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCA
GACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCC
AACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGG
ACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCC
GTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGAC
CAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCAC
GTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGAT
AACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTG
ACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAAT
GGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTG
CTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACC
ACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGAT
GATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAAT
GATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACT
GAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCAT
GCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGG
ACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGT
GGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTC
CACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGT
AAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACT
GTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGT
CGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGT
ATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGA
GGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAAT
GACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCAT
CCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGG
ACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAA
GCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAG
CCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAAC
TGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCT
GCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTA
CGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGC
TATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCT
CGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGT
GACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAAC
TGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAG
CGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCA
GGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATC
TGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTG
GATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTA
CCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCT
GACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACT
GACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTG
GACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGG
TCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAG
AAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCT
ACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAA
AAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAG
GAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGT
CTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCC
TGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCA
GGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGC
CAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAG
TTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCA
CAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAAT
ACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACA
AGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCAC
TGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCC
AGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGG
AGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAG
GGCACCTAGGAACCCTTGGGAGGAAATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTGCTAGTC
ACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGG
GGCCCTGGGGCTTTAGACTCATTTTGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGTGTGCAT
GGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGG
GTCGCCGCTGCTGCTTTTGTCTGGGCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTCTGTGCG
AATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTATTTTTCTCTTTGTACATGAAT
CCACCCCATCCCTATTTCCCTAAAACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAAGCTCTG
AGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCC
TCTTCTTCGCCTCCCTGAGAATTGCTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCTTCCCTG
AAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGC
TGGGGCCCAAGGGCTGGGAAATCTGTTGGTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGTTTGGCT
AGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCG
GCCCTAACGTCTCCTGGCCATTATCTCTTAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAAGTTCTT
ATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGC
TTTTATTTCCCAAAGTCTGTCTCTGAGGTTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTTAGGGGC
CTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACAT
CATCAAAGAGGAAAAGCTCTTTGTTCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGAAAAAGA
TATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAATAAATATATAACTGCAGCTAG
TAGGTCCCTTTCCCTAATCTTTTAGGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTGTAGTTG
TGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAAT
AAACTGTGAATTTGGGGGGGGCGGGGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCTTCTCTA
AAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGC
TTTGTGGTTTTATTTTGGTTCTTTCCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGAGCCATT
TTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTAGAAAACCACTGGAAACTAGA
AATTTGAGCTATTGGGCCCACCAGTAGCAGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGCAGAGTC
ACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAAT
AAGACCCCTTTTCCAAAGGGATGTGAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTGGTATTT
GGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGA
AATTCTCCATGGGTAGCTAGAAAGCCAATACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATTCAAAGC
CTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATCCTCATTTTTAAATGTCTGCT
TTACCCTGTTACTGAGTTTGAGATGACTTAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGTTATTTT
ATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAG
CCGGACTCCCAGGTTGTAATTCTAATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGGAGTAAT
GAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTAAATGATACTGTCATCCTCTT
GGGGTTTATCAGCCAGGTTAGAGGAGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTTCTTGCT
GAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAG
TTCTCAGCTGAGCTTCCTAGGGCCAGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTTGTACAC
ACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGG
TTCCTGTTTGGGAGGAGATTTTATGTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGCACCCAA
CCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCT
TGTCCATAGCCTCCGTCCACGCTGCCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCCTCTCTA
CCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCA
CAACCTCGGAAGAAGTGTTTCGAGTTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTTTCAAAA
CATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGA
AATAAATGGTTCTATGTTTTCAACTTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTGTGTGTA
GATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATA
GACATCTACCTATATTGTTAAGAAAGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCCGCCCCC
ATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAACATGTACTGTAATTCTTTGT

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_8916nt
TGCAGGGATGCGGCGGCGGGAGCAGCCGCCCTGACTCGCGGAGCATCCTCCTCGGAGAGGCACCGCGGCGGGGCGGGCGGGCGGGCGGGG
ACGCGGCGGGGAGGGAGAGAGGCGCGAGGCGGCAGACACCGCTAGCCCTGGCTCTGCCACCCGTCGGAGACGGGGCGGCCCTGTAGCTCT
GCTACCCACCCTCCAGCTTCTGGCGCCCCGAGAACCAGGCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCC
GCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCC
GCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGG
GCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCG
GACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGC
CTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGC
CTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTG
CTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTG
GCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGC
GGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGC
GCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTC
GGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCC
GAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAG
TTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTG
ATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCC
TTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCA
GGGATTGGACACGCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAG
GATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAAC
TTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATG
AAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTG
CCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGG
CGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTG
CTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGAT
GGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTG
TACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGC
TGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGC
TCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGC
ATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCT
AACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAG
TCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGT
AAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAG
CTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACG
GAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGC
AAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGC
AGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTG
TTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCC
TTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTC
AAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAG
AATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCA
GACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCC
AACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGG
ACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCC
GTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGAC
CAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCAC
GTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGAT
AACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTG
ACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAAT
GGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTG
CTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACC
ACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGAT
GATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAAT
GATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACT
GAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCAT
GCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGG
ACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGT
GGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTC
CACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGT
AAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACT
GTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGT
CGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGT
ATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGA
GGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAAT
GACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCAT
CCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGG
ACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAA
GCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAG
CCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAAC
TGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCT
GCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTA
CGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGC
TATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCT
CGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGT
GACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAAC
TGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAG
CGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCA
GGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATC
TGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTG
GATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTA
CCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCT
GACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACT
GACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTG
GACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGG
TCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAG
AAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCT
ACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAA
AAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAG
GAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGT
CTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCC
TGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCA
GGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGC
CAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAG
TTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCA
CAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAAT
ACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACA
AGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCAC
TGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCC
AGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGG

>In-frame_NRXN2_ENST00000265459_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_13364nt
TGCAGGGATGCGGCGGCGGGAGCAGCCGCCCTGACTCGCGGAGCATCCTCCTCGGAGAGGCACCGCGGCGGGGCGGGCGGGCGGGCGGGG
ACGCGGCGGGGAGGGAGAGAGGCGCGAGGCGGCAGACACCGCTAGCCCTGGCTCTGCCACCCGTCGGAGACGGGGCGGCCCTGTAGCTCT
GCTACCCACCCTCCAGCTTCTGGCGCCCCGAGAACCAGGCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCC
GCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCC
GCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGG
GCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCG
GACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGC
CTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGC
CTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTG
CTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTG
GCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGC
GGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGC
GCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTC
GGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCC
GAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAG
TTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTG
ATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCC
TTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCA
GGGATTGGACACGCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCACCACAGGCTACACGCAGGAG
GATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGGGCTCGCCCGTCAGCAACAAC
TTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAAAGGAAGGGGACCCCAAGATG
AAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTCCCGAGGCCTTTGTGGCGCTG
CCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGCTGCTCTTCAGCCAGGGCCGG
CGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGGACGGCCACCTCTATCTTCTG
CTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTCACGTGGACTTCCAGAGGGAT
GGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTCTGGACCTGGAGAGTGAGCTG
TACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCACTCCGGGCAGGCTACGTGGGC
TGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTGTGGGCGTTGCCCCCTTTTGC
TCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGAACCGCTTCATCTGTGACTGC
ATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGTACATGAAGATCATGCTGCCT
AACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGATGGCCACCACTTCCAGGGAG
TCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGCGCGTCGGCTGCGCACCCAGT
AAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCCGGCGTGGCAAGAGCCTGCAG
CTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACATTGAGACGGGCATCATGACG
GAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCCAGCCCTACATGGACCAGTGC
AAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCGTCACCTTCAAGAGTCGCAGC
AGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGGCCCCTGATGGGCTTCTTCTG
TTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTGACCTGGGGAATGGCCCGTCC
TTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACCCAGGCAACGTGCACACGCTC
AAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGTACATTGGCGGTCTGAGCAAG
AATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGGACCTCAACGGACGTCTCCCA
GACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCTGCACTGAAGAGTCCTGTGCC
AACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCCCTGTCTGCAATGATCCCGGG
ACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCC
GTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGAC
CAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCAC
GTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGAT
AACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTG
ACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAAT
GGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTG
CTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACC
ACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGAT
GATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAAT
GATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACT
GAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCAT
GCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGG
ACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGT
GGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTC
CACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGT
AAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACT
GTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGT
CGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGT
ATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGA
GGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAAT
GACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCAT
CCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGG
ACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAA
GCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAG
CCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAAC
TGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCT
GCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTA
CGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGC
TATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCT
CGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGT
GACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAAC
TGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAG
CGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCA
GGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATC
TGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTG
GATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTA
CCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCT
GACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACT
GACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTG
GACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGG
TCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAG
AAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCT
ACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAA
AAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAG
GAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGT
CTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCC
TGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCA
GGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGC
CAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAG
TTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCA
CAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAAT
ACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACA
AGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCAC
TGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCC
AGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGG
AGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAG
GGCACCTAGGAACCCTTGGGAGGAAATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTGCTAGTC
ACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGG
GGCCCTGGGGCTTTAGACTCATTTTGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGTGTGCAT
GGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGG
GTCGCCGCTGCTGCTTTTGTCTGGGCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTCTGTGCG
AATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTATTTTTCTCTTTGTACATGAAT
CCACCCCATCCCTATTTCCCTAAAACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAAGCTCTG
AGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCC
TCTTCTTCGCCTCCCTGAGAATTGCTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCTTCCCTG
AAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGC
TGGGGCCCAAGGGCTGGGAAATCTGTTGGTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGTTTGGCT
AGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCG
GCCCTAACGTCTCCTGGCCATTATCTCTTAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAAGTTCTT
ATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGC
TTTTATTTCCCAAAGTCTGTCTCTGAGGTTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTTAGGGGC
CTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACAT
CATCAAAGAGGAAAAGCTCTTTGTTCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGAAAAAGA
TATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAATAAATATATAACTGCAGCTAG
TAGGTCCCTTTCCCTAATCTTTTAGGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTGTAGTTG
TGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAAT
AAACTGTGAATTTGGGGGGGGCGGGGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCTTCTCTA
AAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGC
TTTGTGGTTTTATTTTGGTTCTTTCCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGAGCCATT
TTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTAGAAAACCACTGGAAACTAGA
AATTTGAGCTATTGGGCCCACCAGTAGCAGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGCAGAGTC
ACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAAT
AAGACCCCTTTTCCAAAGGGATGTGAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTGGTATTT
GGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGA
AATTCTCCATGGGTAGCTAGAAAGCCAATACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATTCAAAGC
CTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATCCTCATTTTTAAATGTCTGCT
TTACCCTGTTACTGAGTTTGAGATGACTTAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGTTATTTT
ATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAG
CCGGACTCCCAGGTTGTAATTCTAATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGGAGTAAT
GAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTAAATGATACTGTCATCCTCTT
GGGGTTTATCAGCCAGGTTAGAGGAGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTTCTTGCT
GAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAG
TTCTCAGCTGAGCTTCCTAGGGCCAGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTTGTACAC
ACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGG
TTCCTGTTTGGGAGGAGATTTTATGTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGCACCCAA
CCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCT
TGTCCATAGCCTCCGTCCACGCTGCCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCCTCTCTA
CCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCA
CAACCTCGGAAGAAGTGTTTCGAGTTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTTTCAAAA
CATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGA
AATAAATGGTTCTATGTTTTCAACTTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTGTGTGTA
GATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATA
GACATCTACCTATATTGTTAAGAAAGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCCGCCCCC
ATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAACATGTACTGTAATTCTTTGT

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_10276nt
GGCAGCAGCGGCGCGGCCGGCCCCAGTCGCCGTCGGTCTCCCGCCTTCGGGGGAACCAGGTCTCCGTCCCTCTTCTCTCCTCCAGCCCGC
ACCGCCCCGCTCCCCAGCTCGGTTTTTCCGCAGGATTTCCCTCGCTCTCCCCTCCCTGCTTGGCCCCCGCGCTCCCCTCCCTCTCCACTC
GGCACCATGCCCCCTCCCCCGGGCGCTCCCCCGGGTTTCTGACGGCCCTCTGCGCCGCTCCGACCCCGCCGGGATGCAGAGAGACCCCTA
GCTCCTCGCGATGGACCCAGGCATCCTGGACCTTGGCGTTGCCGCTCCGCGGACCCCCGATTTCCCGGCGGGATCCAGTTGATTTTGTTG
GCTCCGGACCGAGGCTTGGGCCCTGGTTTACCTCCGCTTCATCCCTACCCCGCTCCCGGAGCTCGGAGCCGGAGGGGGGCTTCGCGGGGC
TGCGCAGCCCCGCGTCCCCGCCCCCGGCCATGGGGCTGTGAGGCGGTCGCCCCCGGGCCGAAATGCCCCCCGGGGGGAGCGGGCCGGGGG
GGTGCCCGCGCCGCCCCCCGGCCCTGGCTGGGCCCCTGCCGCCGCCTCCACCGCCGCCGCCGCCACCTCTGCTGCCGCTGTTGCCGCTGT
TGCTGCTGTTGCTGCTGGGGGCGGCCGAGGGGGCCCGGGTCTCCTCCAGCCTCAGCACCACCCACCACGTCCACCACTTCCACAGCAAGC
ACGGCACCGTGCCCATCGCCATCAACCGCATGCCCTTCCTCACCCGCGGCGGCCACGCCGGGACCACATACATCTTTGGGAAGGGGGGAG
CGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCG
CTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACG
TGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCA
ACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGA
GAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCA
AGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCG
AGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCA
CCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGA
GGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCA
GTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGA
AGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAG
ATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAG
TGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTG
AGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCT
GTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGA
TGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGT
GCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCT
CCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTG
TGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTA
GGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCC
CTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACT
ACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATA
AGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACA
TGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTG
AGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAA
ACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTG
GGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCT
TTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTG
AATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATT
TCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCA
ACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCT
TCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAA
AGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGG
AGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACT
GTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTG
AGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATG
ACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACC
TGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCA
AAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGG
TCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAA
GACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGA
CGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGAC
TTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCC
AGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATA
CTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCA
CACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGA
AAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGG
CCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGA
CCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGA
GTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGG
CCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACAC
AGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTT
CCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAG
GGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACT
CAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAG
ACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGG
TCAGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATG
GTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCT
GTGAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAA
ATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCAC
AGAGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTG
TGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGG
CATTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACAC
TCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGT
ACCAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGT
GCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGC
AACGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTG
GTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCT
TTGTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCT
TAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGG
AGGGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGG
TTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGG
AATCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAA
AAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACAT
TAAAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTC
ATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCAC
TGTCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGG
AGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTG
ACAGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCAT
TCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGA
TGGACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGC
AGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTT
GGAGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAAT
TGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCA
AGAGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAA
TACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAAC
CCAGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACT
TAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTAT
GGTCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGT
TGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTT
TACCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCC
CAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTA
GACATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTG
CAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCT
AATTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAG
AAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAG
GTGGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTG
GAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTAC
TGCTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTA
ACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGT
AAGGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCC
AGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCA
GCACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGG
GTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCC
TAGTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAACATGTACTGTAATTCTTTGTATATAGAAAAAAAATTTACTGTAAAGTA

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_10281nt
GGCAGCAGCGGCGCGGCCGGCCCCAGTCGCCGTCGGTCTCCCGCCTTCGGGGGAACCAGGTCTCCGTCCCTCTTCTCTCCTCCAGCCCGC
ACCGCCCCGCTCCCCAGCTCGGTTTTTCCGCAGGATTTCCCTCGCTCTCCCCTCCCTGCTTGGCCCCCGCGCTCCCCTCCCTCTCCACTC
GGCACCATGCCCCCTCCCCCGGGCGCTCCCCCGGGTTTCTGACGGCCCTCTGCGCCGCTCCGACCCCGCCGGGATGCAGAGAGACCCCTA
GCTCCTCGCGATGGACCCAGGCATCCTGGACCTTGGCGTTGCCGCTCCGCGGACCCCCGATTTCCCGGCGGGATCCAGTTGATTTTGTTG
GCTCCGGACCGAGGCTTGGGCCCTGGTTTACCTCCGCTTCATCCCTACCCCGCTCCCGGAGCTCGGAGCCGGAGGGGGGCTTCGCGGGGC
TGCGCAGCCCCGCGTCCCCGCCCCCGGCCATGGGGCTGTGAGGCGGTCGCCCCCGGGCCGAAATGCCCCCCGGGGGGAGCGGGCCGGGGG
GGTGCCCGCGCCGCCCCCCGGCCCTGGCTGGGCCCCTGCCGCCGCCTCCACCGCCGCCGCCGCCACCTCTGCTGCCGCTGTTGCCGCTGT
TGCTGCTGTTGCTGCTGGGGGCGGCCGAGGGGGCCCGGGTCTCCTCCAGCCTCAGCACCACCCACCACGTCCACCACTTCCACAGCAAGC
ACGGCACCGTGCCCATCGCCATCAACCGCATGCCCTTCCTCACCCGCGGCGGCCACGCCGGGACCACATACATCTTTGGGAAGGGGGGAG
CGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCG
CTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACG
TGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCA
ACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGA
GAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCA
AGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCG
AGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCA
CCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGA
GGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCA
GTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGA
AGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAG
ATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAG
TGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTG
AGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCT
GTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGA
TGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGT
GCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCT
CCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTG
TGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTA
GGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCC
CTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACT
ACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATA
AGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACA
TGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTG
AGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAA
ACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTG
GGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCT
TTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTG
AATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATT
TCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCA
ACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCT
TCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAA
AGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGG
AGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACT
GTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTG
AGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATG
ACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACC
TGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCA
AAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGG
TCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAA
GACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGA
CGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGAC
TTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCC
AGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATA
CTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCA
CACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGA
AAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGG
CCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGA
CCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGA
GTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGG
CCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACAC
AGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTT
CCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAG
GGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACT
CAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAG
ACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGG
TCAGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATG
GTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCT
GTGAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAA
ATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCAC
AGAGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTG
TGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGG
CATTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACAC
TCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGT
ACCAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGT
GCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGC
AACGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTG
GTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCT
TTGTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCT
TAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGG
AGGGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGG
TTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGG
AATCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAA
AAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACAT
TAAAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTC
ATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCAC
TGTCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGG
AGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTG
ACAGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCAT
TCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGA
TGGACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGC
AGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTT
GGAGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAAT
TGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCA
AGAGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAA
TACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAAC
CCAGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACT
TAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTAT
GGTCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGT
TGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTT
TACCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCC
CAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTA
GACATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTG
CAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCT
AATTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAG
AAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAG
GTGGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTG
GAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTAC
TGCTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTA
ACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGT
AAGGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCC
AGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCA
GCACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGG
GTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCC
TAGTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAACATGTACTGTAATTCTTTGTATATAGAAAAAAAATTTACTGTAAAGTA

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_5828nt
GGCAGCAGCGGCGCGGCCGGCCCCAGTCGCCGTCGGTCTCCCGCCTTCGGGGGAACCAGGTCTCCGTCCCTCTTCTCTCCTCCAGCCCGC
ACCGCCCCGCTCCCCAGCTCGGTTTTTCCGCAGGATTTCCCTCGCTCTCCCCTCCCTGCTTGGCCCCCGCGCTCCCCTCCCTCTCCACTC
GGCACCATGCCCCCTCCCCCGGGCGCTCCCCCGGGTTTCTGACGGCCCTCTGCGCCGCTCCGACCCCGCCGGGATGCAGAGAGACCCCTA
GCTCCTCGCGATGGACCCAGGCATCCTGGACCTTGGCGTTGCCGCTCCGCGGACCCCCGATTTCCCGGCGGGATCCAGTTGATTTTGTTG
GCTCCGGACCGAGGCTTGGGCCCTGGTTTACCTCCGCTTCATCCCTACCCCGCTCCCGGAGCTCGGAGCCGGAGGGGGGCTTCGCGGGGC
TGCGCAGCCCCGCGTCCCCGCCCCCGGCCATGGGGCTGTGAGGCGGTCGCCCCCGGGCCGAAATGCCCCCCGGGGGGAGCGGGCCGGGGG
GGTGCCCGCGCCGCCCCCCGGCCCTGGCTGGGCCCCTGCCGCCGCCTCCACCGCCGCCGCCGCCACCTCTGCTGCCGCTGTTGCCGCTGT
TGCTGCTGTTGCTGCTGGGGGCGGCCGAGGGGGCCCGGGTCTCCTCCAGCCTCAGCACCACCCACCACGTCCACCACTTCCACAGCAAGC
ACGGCACCGTGCCCATCGCCATCAACCGCATGCCCTTCCTCACCCGCGGCGGCCACGCCGGGACCACATACATCTTTGGGAAGGGGGGAG
CGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCG
CTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACG
TGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCA
ACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGA
GAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCA
AGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCG
AGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCA
CCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGA
GGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCA
GTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGA
AGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAG
ATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAG
TGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTG
AGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCT
GTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGA
TGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGT
GCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCT
CCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTG
TGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTA
GGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCC
CTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACT
ACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATA
AGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACA
TGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTG
AGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAA
ACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTG
GGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCT
TTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTG
AATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATT
TCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCA
ACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCT
TCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAA
AGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGG
AGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACT
GTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTG
AGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATG
ACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACC
TGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCA
AAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGG
TCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAA
GACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGA
CGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGAC
TTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCC
AGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATA
CTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCA
CACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGA
AAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGG
CCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGA
CCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGA
GTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGG
CCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACAC
AGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTT
CCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAG
GGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACT
CAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAG

>In-frame_NRXN2_ENST00000301894_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_10276nt
GGCAGCAGCGGCGCGGCCGGCCCCAGTCGCCGTCGGTCTCCCGCCTTCGGGGGAACCAGGTCTCCGTCCCTCTTCTCTCCTCCAGCCCGC
ACCGCCCCGCTCCCCAGCTCGGTTTTTCCGCAGGATTTCCCTCGCTCTCCCCTCCCTGCTTGGCCCCCGCGCTCCCCTCCCTCTCCACTC
GGCACCATGCCCCCTCCCCCGGGCGCTCCCCCGGGTTTCTGACGGCCCTCTGCGCCGCTCCGACCCCGCCGGGATGCAGAGAGACCCCTA
GCTCCTCGCGATGGACCCAGGCATCCTGGACCTTGGCGTTGCCGCTCCGCGGACCCCCGATTTCCCGGCGGGATCCAGTTGATTTTGTTG
GCTCCGGACCGAGGCTTGGGCCCTGGTTTACCTCCGCTTCATCCCTACCCCGCTCCCGGAGCTCGGAGCCGGAGGGGGGCTTCGCGGGGC
TGCGCAGCCCCGCGTCCCCGCCCCCGGCCATGGGGCTGTGAGGCGGTCGCCCCCGGGCCGAAATGCCCCCCGGGGGGAGCGGGCCGGGGG
GGTGCCCGCGCCGCCCCCCGGCCCTGGCTGGGCCCCTGCCGCCGCCTCCACCGCCGCCGCCGCCACCTCTGCTGCCGCTGTTGCCGCTGT
TGCTGCTGTTGCTGCTGGGGGCGGCCGAGGGGGCCCGGGTCTCCTCCAGCCTCAGCACCACCCACCACGTCCACCACTTCCACAGCAAGC
ACGGCACCGTGCCCATCGCCATCAACCGCATGCCCTTCCTCACCCGCGGCGGCCACGCCGGGACCACATACATCTTTGGGAAGGGGGGAG
CGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCG
CTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACG
TGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCA
ACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGA
GAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCA
AGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCG
AGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCA
CCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGA
GGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCA
GTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGA
AGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAG
ATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAG
TGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTG
AGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCT
GTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGA
TGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGT
GCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCT
CCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTG
TGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTA
GGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCC
CTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACT
ACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATA
AGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACA
TGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTG
AGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAA
ACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTG
GGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCT
TTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTG
AATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATT
TCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCA
ACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCT
TCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAA
AGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGG
AGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACT
GTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTG
AGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATG
ACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACC
TGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCA
AAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGG
TCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAA
GACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGA
CGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGAC
TTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCC
AGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATA
CTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCA
CACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGA
AAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGG
CCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGA
CCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGA
GTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGG
CCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACAC
AGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTT
CCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAG
GGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACT
CAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAG
ACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGG
TCAGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATG
GTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCT
GTGAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAA
ATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCAC
AGAGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTG
TGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGG
CATTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACAC
TCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGT
ACCAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGT
GCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGC
AACGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTG
GTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCT
TTGTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCT
TAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGG
AGGGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGG
TTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGG
AATCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAA
AAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACAT
TAAAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTC
ATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCAC
TGTCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGG
AGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTG
ACAGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCAT
TCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGA
TGGACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGC
AGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTT
GGAGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAAT
TGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCA
AGAGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAA
TACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAAC
CCAGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACT
TAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTAT
GGTCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGT
TGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTT
TACCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCC
CAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTA
GACATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTG
CAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCT
AATTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAG
AAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAG
GTGGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTG
GAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTAC
TGCTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTA
ACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGT
AAGGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCC
AGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCA
GCACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGG
GTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCC
TAGTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAACATGTACTGTAATTCTTTGTATATAGAAAAAAAATTTACTGTAAAGTA

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_13114nt
GGCGGGGGAGGGGCGCCGCCGCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTG
TGAGCCTGCAAGGGAGCCCCGCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCC
GGGGGCCGGGCGGGGCCGGGGCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGC
TGGCGCTGGCGGCGCGCGCGGACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCA
GCGGCGAGCTCAGCTTCAGCCTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGC
TGCTGCTGGTGGACGGCCGCCTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACG
ACCGCTGGCACATGGTGCTGCTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCA
AGCGGCGCGAGATGCAGGTGGCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCA
AGTACGAGCCGCCCTTCCGCGGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCG
CCACCGCCGACCCGCTGTGCGCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCG
ACTGCAGCCACACGGGCTTCGGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAG
TAGGGTCCTTACTGTTCTCCGAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGG
CGACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCA
CCCTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCA
TCAACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCC
GAAACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCA
CCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGG
GCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAA
AGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTC
CCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGC
TGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGG
ACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTC
ACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTC
TGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCAC
TCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTG
TGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGA
ACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGT
ACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGA
TGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGC
GCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCC
GGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACA
TTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCC
AGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCG
TCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGG
CCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTG
ACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACC
CAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGT
ACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGG
ACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCT
GCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCC
CTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCA
CGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACT
ACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAG
TAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGT
ACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGC
TCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGG
TGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGG
TGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCA
CCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCT
CTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTA
AGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTC
ACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGA
AGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGG
GAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAA
AAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGG
CTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAA
TCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTG
TCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCA
ATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAA
AGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGT
GCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTG
AAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGT
GGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTG
GATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAG
TGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAG
ACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTAT
CTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGT
GCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACAT
TACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAG
AATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTG
GTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTG
TAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTT
GCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCA
AGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGC
TCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTC
CGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGA
TGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTG
AGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAA
TGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTG
AAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGG
TTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAA
GCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCC
CAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAAC
CCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCC
AGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAG
ACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTT
CATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAG
CAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATG
AGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGG
CGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCC
TCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAG
TGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAG
ACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAAT
CAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATC
TGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTG
TGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTG
AAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAA
CCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTG
TTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGA
AGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGT
CTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCA
GCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAG
GGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTAT
TTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAG
GGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCC
CTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGG
CAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTAT
CTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTGGTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCA
ACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACT
TAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCTTAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGT
CCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAA
AGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGGTTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGG
GCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCA
TCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGA
ATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAAT
AAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTC
TCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGT
AGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTG
ATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGA
AAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGG
AAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTA
GAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGCAGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACT
ATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGA
CGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTC
CTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCC
AGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAATACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATG
TTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATC
CTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACTTAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCA
TTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCG
GCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAG
ATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTA
AATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTG
CCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGT
CATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAA
TAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACT
GGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCC
TCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTT
TCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAG
CTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAA
AGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTG
CTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGG
GCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGG
GTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGC
AAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGC
GCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAA

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_13119nt
GGCGGGGGAGGGGCGCCGCCGCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTG
TGAGCCTGCAAGGGAGCCCCGCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCC
GGGGGCCGGGCGGGGCCGGGGCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGC
TGGCGCTGGCGGCGCGCGCGGACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCA
GCGGCGAGCTCAGCTTCAGCCTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGC
TGCTGCTGGTGGACGGCCGCCTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACG
ACCGCTGGCACATGGTGCTGCTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCA
AGCGGCGCGAGATGCAGGTGGCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCA
AGTACGAGCCGCCCTTCCGCGGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCG
CCACCGCCGACCCGCTGTGCGCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCG
ACTGCAGCCACACGGGCTTCGGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAG
TAGGGTCCTTACTGTTCTCCGAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGG
CGACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCA
CCCTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCA
TCAACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCC
GAAACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCA
CCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGG
GCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAA
AGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTC
CCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGC
TGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGG
ACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTC
ACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTC
TGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCAC
TCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTG
TGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGA
ACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGT
ACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGA
TGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGC
GCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCC
GGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACA
TTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCC
AGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCG
TCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGG
CCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTG
ACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACC
CAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGT
ACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGG
ACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCT
GCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCC
CTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCA
CGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACT
ACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAG
TAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGT
ACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGC
TCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGG
TGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGG
TGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCA
CCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCT
CTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTA
AGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTC
ACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGA
AGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGG
GAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAA
AAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGG
CTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAA
TCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTG
TCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCA
ATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAA
AGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGT
GCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTG
AAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGT
GGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTG
GATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAG
TGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAG
ACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTAT
CTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGT
GCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACAT
TACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAG
AATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTG
GTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTG
TAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTT
GCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCA
AGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGC
TCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTC
CGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGA
TGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTG
AGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAA
TGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTG
AAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGG
TTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAA
GCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCC
CAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAAC
CCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCC
AGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAG
ACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTT
CATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAG
CAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATG
AGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGG
CGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCC
TCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAG
TGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAG
ACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAAT
CAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATC
TGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTG
TGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTG
AAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAA
CCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTG
TTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGA
AGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGT
CTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCA
GCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAG
GGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTAT
TTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAG
GGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCC
CTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGG
CAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTAT
CTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTGGTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCA
ACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACT
TAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCTTAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGT
CCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAA
AGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGGTTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGG
GCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCA
TCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGA
ATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAAT
AAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTC
TCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGT
AGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTG
ATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGA
AAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGG
AAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTA
GAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGCAGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACT
ATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGA
CGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTC
CTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCC
AGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAATACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATG
TTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATC
CTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACTTAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCA
TTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCG
GCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAG
ATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTA
AATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTG
CCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGT
CATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAA
TAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACT
GGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCC
TCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTT
TCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAG
CTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAA
AGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTG
CTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGG
GCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGG
GTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGC
AAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGC
GCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAA

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_8666nt
GGCGGGGGAGGGGCGCCGCCGCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTG
TGAGCCTGCAAGGGAGCCCCGCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCC
GGGGGCCGGGCGGGGCCGGGGCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGC
TGGCGCTGGCGGCGCGCGCGGACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCA
GCGGCGAGCTCAGCTTCAGCCTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGC
TGCTGCTGGTGGACGGCCGCCTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACG
ACCGCTGGCACATGGTGCTGCTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCA
AGCGGCGCGAGATGCAGGTGGCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCA
AGTACGAGCCGCCCTTCCGCGGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCG
CCACCGCCGACCCGCTGTGCGCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCG
ACTGCAGCCACACGGGCTTCGGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAG
TAGGGTCCTTACTGTTCTCCGAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGG
CGACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCA
CCCTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCA
TCAACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCC
GAAACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCA
CCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGG
GCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAA
AGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTC
CCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGC
TGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGG
ACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTC
ACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTC
TGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCAC
TCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTG
TGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGA
ACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGT
ACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGA
TGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGC
GCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCC
GGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACA
TTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCC
AGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCG
TCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGG
CCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTG
ACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACC
CAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGT
ACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGG
ACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCT
GCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCC
CTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCA
CGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACT
ACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAG
TAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGT
ACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGC
TCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGG
TGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGG
TGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCA
CCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCT
CTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTA
AGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTC
ACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGA
AGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGG
GAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAA
AAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGG
CTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAA
TCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTG
TCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCA
ATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAA
AGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGT
GCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTG
AAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGT
GGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTG
GATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAG
TGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAG
ACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTAT
CTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGT
GCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACAT
TACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAG
AATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTG
GTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTG
TAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTT
GCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCA
AGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGC
TCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTC
CGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGA
TGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTG
AGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAA
TGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTG
AAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGG
TTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAA
GCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCC
CAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAAC
CCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCC
AGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAG
ACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTT
CATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAG
CAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATG
AGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGG
CGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCC
TCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAG
TGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAG
ACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAAT
CAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATC
TGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTG
TGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTG

>In-frame_NRXN2_ENST00000377551_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_13114nt
GGCGGGGGAGGGGCGCCGCCGCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCGCGCCTCGCCCCGCGGCCGGGCCCATGGCACTG
TGAGCCTGCAAGGGAGCCCCGCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCATGCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCC
GGGGGCCGGGCGGGGCCGGGGCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCCGACACCGCCGCCGCTGCTGTTGCTGCTGCTGC
TGGCGCTGGCGGCGCGCGCGGACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGCTCGCTACGCGCGCTGGGCGGGCGCGGCGAGCA
GCGGCGAGCTCAGCTTCAGCCTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCTGGACGACGGCGGCGACTGCGACTTCCTGGAGC
TGCTGCTGGTGGACGGCCGCCTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGCCACGCTGCAGCTGGACACGCCGGTGGCCGACG
ACCGCTGGCACATGGTGCTGCTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGACGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCA
AGCGGCGCGAGATGCAGGTGGCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGTGCGCCTCTCGGCGCTTACGCTGAGCACCGTCA
AGTACGAGCCGCCCTTCCGCGGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCCCGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCG
CCACCGCCGACCCGCTGTGCGCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTGCACCGTGCTGGCCCCCGGCGAGGTGGGCTGCG
ACTGCAGCCACACGGGCTTCGGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGAAGGTCCGGCTCACCTGACGTTAAACAGCGAAG
TAGGGTCCTTACTGTTCTCCGAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCACCAGCCAACAAAAGGCAAGGAGGAGTTTGTGG
CGACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAGCAGCACTGATGAGATCACACTGGCCTTCCGCA
CCCTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCTGTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCA
TCAACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAACGACAACGCCTGGCACGACGTCCGGGTCACCC
GAAACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTAAACAAACTGCATTATCTGGTGACCATCTCGGTGGACGGGATCCTGACCA
CCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGCTGACCTGCCGG
GCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATCCCGCCTGGCAA
AGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGACCTTTGAGAGTC
CCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCCCAATGGGCTGC
TGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCATGGAGCTATTGG
ACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGGCGAGTGGTGTC
ACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGACAGCGAGATTC
TGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTGGACAGCAGCAC
TCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGCTCAGGGGGCTG
TGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCGAGAAGGCTGGA
ACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGATGGCTCCATGT
ACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTACGGACTCATGA
TGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCTCGACTGCCTGC
GCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGTGAGGGTGGTCC
GGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGAGTTCCACAACA
TTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGTGTTCAATGGCC
AGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGTGGCCGATCCCG
TCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTTCAAGACCACGG
CCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCACTACGTGTTTG
ACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGTGTCCAGGGACC
CAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAAAGGGGAGTTGT
ACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCTGGCCTCAGTGG
ACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCCCAGCACCACCT
GCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTCCTATGGAGGCC
CTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGACAGGCCCAGCA
CGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGGCCTTGGAGACT
ACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCCCAACGCCATAG
TAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGTCAACGAGCGGT
ACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGATGAGTGGCTGC
TCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTTCCAGGGCCAGG
TGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCACCTGCGCCTGG
TGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCATGGAGACTACCA
CCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCTGCTGGTGGCCT
CTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTA
AGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTATGAAGCTGGTC
ACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGA
AGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCCAGGCTCAGAGG
GAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAA
AAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCTGTTATGTGAGG
CTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAA
TCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCATGAAGAGTGTG
TCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCA
ATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGCTGCTGGGTCAA
AGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGT
GCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACATTGATATCCCTG
AAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGT
GGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGTCCTCTTTTTTG
GATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAG
TGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACAGCTGCAGGAAG
ACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTAT
CTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCTGCTCTATGAGT
GCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACAT
TACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTATAGATGAAGAAG
AATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTG
GTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGGAGATACCCGTG
TAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTT
GCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTCAAAGAAATTCA
AGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGC
TCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAAATGGGAATGTC
CGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGA
TGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGGGGAGATCCGTG
AGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAA
TGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCCATTGCTACCTG
AAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGG
TTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGTGACCAGCCCAA
GCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCC
CAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAGCAGTCCCAAAC
CCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCC
AGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGATGGATCTCATAG
ACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTT
CATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATCTGGGAAAGCAG
CAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATG
AGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCTGGTGAAGCAGG
CGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCC
TCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCTCTGGCCCATAG
TGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAG
ACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAAGTAGTACCAAT
CAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATC
TGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGCTTATGGTTGTG
TGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTG
AAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTCAAAGCGATTTCCCCAA
CCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTG
TTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAGGAACCTTTGACCAGGA
AGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGT
CTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGGTGCTGCATTGAGGCCA
GCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAG
GGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGCTTTTGTTTCTACCTAT
TTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAG
GGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTTTCCCCATTCCTTTTCC
CTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGG
CAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCTATTAACTGCTGATTAT
CTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTGGTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCA
ACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCTCTCTGCTTTGCCAACT
TAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCTTAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGT
CCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCATTTGCGCTTTATCTAA
AGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGGTTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGG
GCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCCTAGTTCTCCCCTTTCA
TCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGA
ATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTATCATGTGTGAGAATAAT
AAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTC
TCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTGTGTGTTAAATTACCGT
AGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTG
ATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGACAGGAGGGAGTGAGGGA
AAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGG
AAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGCCATTGAATGGGAACTA
GAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGCAGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACT
ATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCTTGCCAGCCCTGTGGGA
CGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTC
CTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCCCCAGGAGGCCTTTTCC
AGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAATACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATG
TTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCATTGATACAGAAACATC
CTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACTTAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCA
TTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGATCCCTTCCCAGGCTCG
GCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAG
ATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATTTTACTAAGGTTTTTTA
AATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTG
CCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGTTGCTGTGGGAGCCTGT
CATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAA
TAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGCCAAGGGTTGAGGGACT
GGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCC
TCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGAAGGTGGCCATTGAGTT
TCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAG
CTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATTTTCTAAGGAAGTGGAA
AGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTG
CTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTTCGTGGACAAGACATGG
GCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGG
GTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCGCCTCCTAGGTCTTGGC
AAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGC
GCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGTTAGGAGTCCCCATAAA

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000354179_chr5_176666757_+_13125nt
GCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCCGCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCG
CGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCCGCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCAT
GCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGGGCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCC
GACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGC
TCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCT
GGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGC
CACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGA
CGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGT
GCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCC
CGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTG
CACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGA
AGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCA
CCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAG
CAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCT
GTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAA
CGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTGACCATCTCGGTGGACGG
GATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGC
TGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATC
CCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGAC
CTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCC
CAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCAT
GGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGG
CGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGA
CAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTG
GACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGC
TCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCG
AGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGA
TGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTA
CGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCT
CGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGT
GAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGA
GTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGT
GTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGT
GGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTT
CAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCA
CTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGT
GTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAA
AGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCT
GGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCC
CAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTC
CTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGA
CAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGG
CCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCC
CAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGT
CAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGA
TGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTT
CCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCA
CCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCAT
GGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCT
GCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAG
AAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTA
TGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGA
CAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCC
AGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCC
TGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCT
GTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATG
TCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCA
TGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGC
TAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGC
TGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAA
TGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACAT
TGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACG
ATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGT
CCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGAT
GGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACA
GCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCAC
TGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCT
GCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAAT
TTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTAT
AGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAAT
CATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGG
AGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGG
AAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTC
AAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGA
TGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAA
ATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCA
TCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGG
GGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCA
GGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCC
ATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATC
CCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGT
GACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGG
TGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAG
CAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATC
AGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGAT
GGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTT
GGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATC
TGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGC
CTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCT
GGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGC
CCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCT
CTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGG
AAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAA
GTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAA
AAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGC
TTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACA
TGGTCATCGTGAAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTCAAAGC
GATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGA
GCATTCACGTGTTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAGGAACC
TTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGT
TGAGGAAGTGTCTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGGTGCTG
CATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAG
CAGGTGGTCAGGGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGCTTTTG
TTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGC
AGTGGACATAGGGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTTTCCCC
ATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACT
TAGCTCAAAGGCAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCTATTAA
CTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTGGTGCTACCCTGCCCTACCATTCACCCAGCTC
ACAGACTGCCAACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCTCTCTG
CTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCTTAGTTATGGCTTTCACGCTCTCAATAGGATT
CTGTATTTGGTCCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCATTTGC
GCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGGTTGAGACACTTGAACTCAGGCAGAGGGACGA
GGCTGGGCAGGGCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCCTAGTT
CTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTT
CTTTTAAAAGAATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTATCATGT
GTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCT
GTGCCCTTTTCTCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTGTGTGT
TAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGT
GGAGAAGTTTGATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGACAGGAG
GGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAG
ACCTGCCTGGGAAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGCCATTG
AATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGCAGCATGTGATACTAGATGGTTAAAATCATGA
AAGCAGTCACTATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCTTGCCA
GCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAA
AACTTCTGGTCCTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCCCCAGG
AGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAATACATCTAGCCCTGCTAAGTCAGAAAAAGAT
TATGAAAAATGTTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCATTGAT
ACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACTTAAATCACTGTGTTGACCCTCTTCTGAACCA
AATCTTTAGCATTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGATCCCT
TCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTT
AGTCCTGACAGATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATTTTACT
AAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAG
AGAAGGAGCTGCCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGTTGCTG
TGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAAT
TGAAATAAGAATAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGCCAAGG
GTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAG
AAGGAAGATCCTCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGAAGGTG
GCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGG
GTCTTCCTCAGCTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATTTTCTA
AGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTT
CTCTAGAGCTGCTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTTCGTGG
ACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCT
CATCGAGGTGGGTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCGCCTCC
TAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGC
TTTTTTGCCGCGCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGTTAGGA

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000439151_chr5_176666757_+_13130nt
GCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCCGCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCG
CGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCCGCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCAT
GCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGGGCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCC
GACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGC
TCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCT
GGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGC
CACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGA
CGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGT
GCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCC
CGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTG
CACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGA
AGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCA
CCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAG
CAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCT
GTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAA
CGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTGACCATCTCGGTGGACGG
GATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGC
TGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATC
CCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGAC
CTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCC
CAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCAT
GGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGG
CGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGA
CAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTG
GACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGC
TCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCG
AGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGA
TGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTA
CGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCT
CGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGT
GAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGA
GTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGT
GTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGT
GGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTT
CAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCA
CTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGT
GTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAA
AGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCT
GGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCC
CAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTC
CTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGA
CAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGG
CCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCC
CAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGT
CAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGA
TGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTT
CCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCA
CCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCAT
GGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCT
GCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAG
AAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTA
TGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGA
CAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCC
AGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCC
TGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCT
GTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATG
TCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCA
TGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGC
TAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGC
TGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAA
TGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACAT
TGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACG
ATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGT
CCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGAT
GGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACA
GCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCAC
TGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCT
GCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAAT
TTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTAT
AGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAAT
CATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGG
AGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGG
AAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTC
AAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGA
TGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAA
ATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCA
TCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGG
GGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCA
GGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCC
ATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATC
CCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGT
GACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGG
TGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAG
CAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATC
AGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGAT
GGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTT
GGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATC
TGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGC
CTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCT
GGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGC
CCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCT
CTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGG
AAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAA
GTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAA
AAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGC
TTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACA
TGGTCATCGTGAAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTCAAAGC
GATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGA
GCATTCACGTGTTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAGGAACC
TTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGT
TGAGGAAGTGTCTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGGTGCTG
CATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAG
CAGGTGGTCAGGGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGCTTTTG
TTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGC
AGTGGACATAGGGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTTTCCCC
ATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACT
TAGCTCAAAGGCAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCTATTAA
CTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTGGTGCTACCCTGCCCTACCATTCACCCAGCTC
ACAGACTGCCAACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCTCTCTG
CTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCTTAGTTATGGCTTTCACGCTCTCAATAGGATT
CTGTATTTGGTCCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCATTTGC
GCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGGTTGAGACACTTGAACTCAGGCAGAGGGACGA
GGCTGGGCAGGGCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCCTAGTT
CTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTT
CTTTTAAAAGAATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTATCATGT
GTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCT
GTGCCCTTTTCTCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTGTGTGT
TAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGT
GGAGAAGTTTGATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGACAGGAG
GGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAG
ACCTGCCTGGGAAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGCCATTG
AATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGCAGCATGTGATACTAGATGGTTAAAATCATGA
AAGCAGTCACTATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCTTGCCA
GCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAA
AACTTCTGGTCCTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCCCCAGG
AGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAATACATCTAGCCCTGCTAAGTCAGAAAAAGAT
TATGAAAAATGTTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCATTGAT
ACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACTTAAATCACTGTGTTGACCCTCTTCTGAACCA
AATCTTTAGCATTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGATCCCT
TCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTT
AGTCCTGACAGATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATTTTACT
AAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAG
AGAAGGAGCTGCCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGTTGCTG
TGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAAT
TGAAATAAGAATAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGCCAAGG
GTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAG
AAGGAAGATCCTCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGAAGGTG
GCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGG
GTCTTCCTCAGCTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATTTTCTA
AGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTT
CTCTAGAGCTGCTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTTCGTGG
ACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCT
CATCGAGGTGGGTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCGCCTCC
TAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGC
TTTTTTGCCGCGCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGTTAGGA

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000347982_chr5_176666757_+_8677nt
GCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCCGCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCG
CGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCCGCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCAT
GCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGGGCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCC
GACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGC
TCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCT
GGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGC
CACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGA
CGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGT
GCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCC
CGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTG
CACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGA
AGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCA
CCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAG
CAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCT
GTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAA
CGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTGACCATCTCGGTGGACGG
GATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGC
TGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATC
CCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGAC
CTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCC
CAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCAT
GGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGG
CGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGA
CAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTG
GACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGC
TCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCG
AGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGA
TGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTA
CGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCT
CGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGT
GAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGA
GTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGT
GTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGT
GGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTT
CAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCA
CTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGT
GTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAA
AGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCT
GGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCC
CAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTC
CTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGA
CAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGG
CCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCC
CAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGT
CAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGA
TGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTT
CCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCA
CCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCAT
GGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCT
GCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAG
AAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTA
TGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGA
CAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCC
AGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCC
TGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCT
GTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATG
TCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCA
TGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGC
TAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGC
TGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAA
TGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACAT
TGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACG
ATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGT
CCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGAT
GGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACA
GCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCAC
TGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCT
GCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAAT
TTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTAT
AGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAAT
CATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGG
AGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGG
AAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTC
AAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGA
TGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAA
ATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCA
TCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGG
GGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCA
GGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCC
ATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATC
CCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGT
GACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGG
TGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAG
CAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATC
AGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGAT
GGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTT
GGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATC
TGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGC
CTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCT
GGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGC
CCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCT
CTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGG
AAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAA
GTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAA
AAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGC
TTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACA

>In-frame_NRXN2_ENST00000409571_chr11_64387766_-_NSD1_ENST00000361032_chr5_176666757_+_13125nt
GCATCCCTCCCTGCTCTTCTGTCGGAGCCCGCGGCGGGGGAGGGGCGCCGCCGCCGCCGCCTGAGGGAAGCCGGCATCTGGGCCTCTGCG
CGCCTCGCCCCGCGGCCGGGCCCATGGCACTGTGAGCCTGCAAGGGAGCCCCGCTCAGCGCGGGGAGCGCCCGGCCCCCTCCCGCCCCAT
GCGCCCGCGGCTCTGAAGCCTGAGCGGGGGCCGGGGGCCGGGCGGGGCCGGGGCCGCCGTAGGCATGGCGTCCGGGAGCCGGTGGCGGCC
GACACCGCCGCCGCTGCTGTTGCTGCTGCTGCTGGCGCTGGCGGCGCGCGCGGACGGCCTGGAGTTCGGCGGCGGCCCCGGGCAGTGGGC
TCGCTACGCGCGCTGGGCGGGCGCGGCGAGCAGCGGCGAGCTCAGCTTCAGCCTGCGCACCAACGCCACGCGCGCGCTGCTGCTCTACCT
GGACGACGGCGGCGACTGCGACTTCCTGGAGCTGCTGCTGGTGGACGGCCGCCTGCGGCTGCGCTTCACGCTTTCGTGCGCCGAGCCGGC
CACGCTGCAGCTGGACACGCCGGTGGCCGACGACCGCTGGCACATGGTGCTGCTGACCCGCGACGCGCGCCGCACGGCGCTGGCGGTGGA
CGGCGAGGCCCGCGCCGCCGAGGTGCGCTCCAAGCGGCGCGAGATGCAGGTGGCCAGCGACCTGTTCGTGGGCGGCATCCCGCCCGACGT
GCGCCTCTCGGCGCTTACGCTGAGCACCGTCAAGTACGAGCCGCCCTTCCGCGGCCTCTTGGCCAACCTGAAGCTGGGCGAGCGGCCCCC
CGCGCTGCTGGGCAGCCAGGGCCTGCGCGGCGCCACCGCCGACCCGCTGTGCGCGCCCGCGCGCAACCCCTGCGCCAACGGCGGCCTCTG
CACCGTGCTGGCCCCCGGCGAGGTGGGCTGCGACTGCAGCCACACGGGCTTCGGCGGCAAGTTCTGCAGCGAAGAGGAGCACCCCATGGA
AGGTCCGGCTCACCTGACGTTAAACAGCGAAGTAGGGTCCTTACTGTTCTCCGAGGGGGGGGCCGGGAGAGGAGGAGCCGGCGATGTGCA
CCAGCCAACAAAAGGCAAGGAGGAGTTTGTGGCGACCTTCAAAGGCAATGAGTTCTTCTGCTACGACCTGTCACACAACCCCATCCAGAG
CAGCACTGATGAGATCACACTGGCCTTCCGCACCCTGCAACGCAACGGCCTGATGCTGCATACAGGCAAGTCGGCCGACTACGTCAACCT
GTCCCTCAAGTCTGGGGCTGTCTGGCTGGTCATCAACCTAGGCTCAGGTGCCTTCGAGGCCCTTGTGGAACCCGTCAATGGCAAGTTCAA
CGACAACGCCTGGCACGACGTCCGGGTCACCCGAAACCTGCGCCAGCACGCAGGGATTGGACACGCTATGGTGACCATCTCGGTGGACGG
GATCCTGACCACCACAGGCTACACGCAGGAGGATTACACCATGCTGGGCTCTGATGACTTCTTCTACATTGGGGGCAGCCCCAACACAGC
TGACCTGCCGGGCTCGCCCGTCAGCAACAACTTCATGGGCTGCCTCAAGGACGTGGTCTATAAGAACAATGACTTCAAATTGGAACTATC
CCGCCTGGCAAAGGAAGGGGACCCCAAGATGAAGCTGCAGGGGGACTTGTCATTCCGCTGTGAGGATGTGGCTGCCCTGGACCCTGTGAC
CTTTGAGAGTCCCGAGGCCTTTGTGGCGCTGCCCCGCTGGAGCGCTAAGCGCACTGGCTCCATCTCCCTAGACTTCCGCACCACCGAGCC
CAATGGGCTGCTGCTCTTCAGCCAGGGCCGGCGGGCTGGGGGTGGAGCTGGCAGCCACAGCTCTGCTCAGCGGGCCGACTACTTTGCCAT
GGAGCTATTGGACGGCCACCTCTATCTTCTGCTGGACATGGGATCTGGGGGCATCAAGCTGCGGGCATCCAGCCGCAAGGTCAATGATGG
CGAGTGGTGTCACGTGGACTTCCAGAGGGATGGGCGAAAAGGCTCCATCTCAGTGAATAGTCGCAGCACGCCGTTCTTGGCCACTGGAGA
CAGCGAGATTCTGGACCTGGAGAGTGAGCTGTACCTGGGCGGTCTCCCTGAGGGGGGCCGGGTGGACCTGCCCCTGCCCCCAGAGGTGTG
GACAGCAGCACTCCGGGCAGGCTACGTGGGCTGTGTGCGGGACCTCTTCATAGATGGGCGTAGCCGAGACCTCCGGGGCCTGGCTGAGGC
TCAGGGGGCTGTGGGCGTTGCCCCCTTTTGCTCCCGGGAGACGCTGAAGCAGTGTGCATCTGCCCCCTGTCGCAATGGGGGCGTCTGTCG
AGAAGGCTGGAACCGCTTCATCTGTGACTGCATCGGGACCGGCTTTCTTGGGCGGGTCTGTGAGAGAGAGGCCACGGTCCTGAGCTACGA
TGGCTCCATGTACATGAAGATCATGCTGCCTAACGCCATGCACACGGAGGCAGAGGATGTGTCCCTGCGTTTCATGTCCCAGCGGGCCTA
CGGACTCATGATGGCCACCACTTCCAGGGAGTCTGCCGACACCCTACGCCTGGAGCTGGATGGGGGGCAGATGAAGCTCACTGTCAACCT
CGACTGCCTGCGCGTCGGCTGCGCACCCAGTAAAGGCCCCGAAACGCTGTTTGCGGGGCACAAGCTCAATGACAATGAGTGGCACACGGT
GAGGGTGGTCCGGCGTGGCAAGAGCCTGCAGCTGTCTGTGGACAACGTGACTGTGGAGGGACAGATGGCAGGAGCCCATATGCGGCTGGA
GTTCCACAACATTGAGACGGGCATCATGACGGAGCGGCGGTTTATCTCCGTGGTGCCCTCCAACTTCATCGGGCATCTGAGTGGGCTCGT
GTTCAATGGCCAGCCCTACATGGACCAGTGCAAGGATGGTGACATCACCTACTGTGAGCTCAATGCTCGCTTTGGCCTGCGTGCCATCGT
GGCCGATCCCGTCACCTTCAAGAGTCGCAGCAGCTACCTGGCACTCGCCACGCTCCAAGCCTATGCTTCCATGCACCTCTTCTTCCAGTT
CAAGACCACGGCCCCTGATGGGCTTCTTCTGTTCAACTCGGGCAACGGCAATGACTTCATTGTCATCGAGCTGGTCAAGGGGTACATCCA
CTACGTGTTTGACCTGGGGAATGGCCCGTCCTTGATGAAGGGGAACTCAGACAAACCAGTCAATGACAACCAGTGGCACAACGTGGTGGT
GTCCAGGGACCCAGGCAACGTGCACACGCTCAAGATTGACTCCCGCACTGTCACGCAGCACTCCAATGGCGCCCGAAACCTCGATCTCAA
AGGGGAGTTGTACATTGGCGGTCTGAGCAAGAATATGTTCAGCAACCTGCCCAAGCTGGTGGCCTCCCGGGATGGCTTTCAGGGCTGCCT
GGCCTCAGTGGACCTCAACGGACGTCTCCCAGACCTCATCGCCGACGCCCTGCACCGCATTGGGCAGGTGGAGAGGGGCTGTGATGGCCC
CAGCACCACCTGCACTGAAGAGTCCTGTGCCAACCAGGGCGTCTGCTTGCAGCAGTGGGATGGCTTCACCTGCGACTGCACCATGACTTC
CTATGGAGGCCCTGTCTGCAATGATCCCGGGACCACATACATCTTTGGGAAGGGGGGAGCGCTCATCACCTACACGTGGCCCCCCAATGA
CAGGCCCAGCACGAGGATGGATCGCCTGGCCGTGGGCTTCAGCACCCACCAGCGGAGCGCTGTGCTGGTGCGGGTGGACAGCGCCTCCGG
CCTTGGAGACTACCTGCAGCTGCACATCGACCAGGGCACCGTGGGGGTGATCTTTAACGTGGGCACGGACGACATTACCATCGACGAGCC
CAACGCCATAGTAAGCGACGGCAAATACCACGTGGTGCGCTTCACTCGAAGCGGCGGCAACGCCACCCTGCAGGTGGACAGCTGGCCGGT
CAACGAGCGGTACCCGGCAGGAAACTTTGATAACGAGCGCCTGGCGATTGCTAGACAGAGAATCCCCTACCGGCTTGGTCGAGTAGTAGA
TGAGTGGCTGCTCGACAAAGGCCGCCAGCTGACCATCTTCAACAGCCAGGCTGCCATCAAGATCGGGGGCCGGGATCAGGGCCGCCCCTT
CCAGGGCCAGGTGTCCGGCCTCTACTACAATGGGCTCAAGGTGCTGGCGCTGGCCGCCGAGAGCGACCCCAATGTGCGGACTGAGGGTCA
CCTGCGCCTGGTGGGGGAGGGGCCGTCCGTGCTGCTCAGTGCGGAGACCACGGCCACCACCCTGCTGGCTGACATGGCCACCACCATCAT
GGAGACTACCACCACCATGGCCACTACCACCACGCGCCGGGGCCGCTCCCCCACACTGAGGGACAGCACCACCCAGAACACAGATGACCT
GCTGGTGGCCTCTGCTGAGTGTCCAAGCGATGATGAGGACCTGGAGGAGTGTGAGCCCAGTACTGGAAATTATGAAAGTAAACGTCAAAG
AAAACCAACTAAGAAACTTCTTGAATCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAGTGCTA
TGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCAAAAGATTTTGGTGGAGGCACTACCAAGATATTTGA
CAAGCCAAGGAAGCGAAAACGACAGAGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAGATTCC
AGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACTGTTGAGGAAGGTGTAGAACACGATCCCGGGATGCC
TGCCTCTAAAAAAATGCAGGGTGAACGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAGCTGCT
GTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACTGAGATGCCAAGAGGAAAATTTATCTGCAATGAATG
TCGCACAGGAATCCATACCTGTTTTGTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTTTACCA
TGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGGTGCTCCCTCCACATCTGTATAACCTGTCATGCTGC
TAATCCAGCCAATGTTTCTGCATCTAAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGCCTGGC
TGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACCCCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAA
TGTTAGCTGGTGCTTTGTGTGCTCAGAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTGAACAT
TGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCACACTACAGGGAGATTGTCTGGGTAAAAGTTGGACG
ATACAGGTGGTGGCCAGCTGAGATCTGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTCCCAGT
CCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCTTACATGGAGGGTGACGTGAGCAGCAAGGATAAGAT
GGGCAAAGGAGTGGATGGGACATATAAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTAAGACA
GCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAGGTAAACCGTCCTATTGGCAGGGTACAGATCTTCAC
TGCAGACTTATCTGAAATACCCCGTTGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGCATGCT
GCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAGTGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAAT
TTTCCGCACATTACAGCGGGGTTGGGGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAGCTTAT
AGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACTAATTTCTATATGCTCACCCTAGACAAAGACCGAAT
CATTGATGCTGGTCCCAAAGGAAACTATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTGAATGG
AGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTTACCTTCAACTACAACCTAGAATGTCTTGGGAATGG
AAAGACTGTTTGCAAATGTGGAGCCCCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAAAAGTC
AAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACAAAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGA
TGCTGGCCAGCTCGTCTCCTGCAAGAAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCAGGGAA
ATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTCTGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCA
TCGAGAAGGGATGCTTTTCATTTCCAAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAACCTGG
GGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACTCACCTGGCAGAGCAATCAACAGGAATGGCTGCTCA
GGCACCCAAAATGTCAGATAAACCTCCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAGAGGCC
ATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGATAAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATC
CCAATCCTTGGTTTCCAGCCAGAGGCCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCTCCAGT
GACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTGGGGACGGCTGACCCAAGGCTGGATAAATCCATAGG
TGCTGCCAGCCCAAGGCCCCAGTCACTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATTACTAG
CAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTGTCCCAGAGACTCCCACCTCCTGAGAAAGTACTATC
AGCTGTGGTCCAGACCCTTGTAGCTAAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTGGTGAT
GGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAGGTCACACCACAGGCTGATGAGAAGATGCCAGTGTT
GGAGTCAAGTTCATGGCCTGCCAGCAAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAGACATC
TGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACCCAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGC
CTTTTTATATGAGCCAACAACTCAGGCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCGGGCCT
GGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCCAAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGC
CCCAGCCTCCCTCCCCACTGAAGAAAAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCAGGGCT
CTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGCACACAGACATTGGCACAGACTTGCTGGTCTCTTGG
AAGAGGGCAAGACCCCAAACCAGAGCAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAACAGAA
GTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGGGGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAA
AAAAACACATCTGCCCCGAACACTTTCCCACTGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTGGGGGC
TTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAGACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACA
TGGTCATCGTGAAATAAAAAGTCCACTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTCAAAGC
GATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGAAATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGA
GCATTCACGTGTTCTAGGCCGGGTGCTAGTCACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAGGAACC
TTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTTTGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGT
TGAGGAAGTGTCTCTTGGCTGCGGTGTGCATGGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGGTGCTG
CATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGGGCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAG
CAGGTGGTCAGGGGCAGTCGGGCTCTGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGCTTTTG
TTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAAACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGC
AGTGGACATAGGGAATCTCTGGCAAGCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTTTCCCC
ATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTGCTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACT
TAGCTCAAAGGCAAGCCAGAACCCTTCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCTATTAA
CTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCTGTTGGTGCTACCCTGCCCTACCATTCACCCAGCTC
ACAGACTGCCAACAGGAAGTGCTGTTTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCTCTCTG
CTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTATCTCTTAGTTATGGCTTTCACGCTCTCAATAGGATT
CTGTATTTGGTCCCAATTTCCTCAAGTTCTTATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCATTTGC
GCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCTGAGGTTGAGACACTTGAACTCAGGCAGAGGGACGA
GGCTGGGCAGGGCTGTCCTGAGTTTAGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCCTAGTT
CTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGTTCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTT
CTTTTAAAAGAATTTTAAACCATGAAAAAGATATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTATCATGT
GTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTAGGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCT
GTGCCCTTTTCTCTCCAGTCATCTGTAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTGTGTGT
TAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGGGGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGT
GGAGAAGTTTGATTCTAAAGTAGCTTCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGACAGGAG
GGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTTCCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAG
ACCTGCCTGGGAAAACAGCTTCTGAGCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGCCATTG
AATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAGTAGCAGCATGTGATACTAGATGGTTAAAATCATGA
AAGCAGTCACTATCCAATTAGAAGCAGAGTCACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCTTGCCA
GCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGTGAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAA
AACTTCTGGTCCTTAACGCAGGGTGGTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCCCCAGG
AGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAGCCAATACATCTAGCCCTGCTAAGTCAGAAAAAGAT
TATGAAAAATGTTGAAATTTACATTCAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCATTGAT
ACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGATGACTTAAATCACTGTGTTGACCCTCTTCTGAACCA
AATCTTTAGCATTGATGAAAATAGTTATTTTATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGATCCCT
TCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTAATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTT
AGTCCTGACAGATTCCCCCATAGGGAGTAATGAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATTTTACT
AAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGGAGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAG
AGAAGGAGCTGCCTCCAGCCCCTTTCTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGTTGCTG
TGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCCAGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAAT
TGAAATAAGAATAGATCATTGTTTTGTACACACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGCCAAGG
GTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTATGTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAG
AAGGAAGATCCTCAGTGAAGCCTGCACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGAAGGTG
GCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTGCCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGG
GTCTTCCTCAGCTCCCTTCTGCCCCTCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATTTTCTA
AGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAGTTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTT
CTCTAGAGCTGCTTTCCCATGGCTTTCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTTCGTGG
ACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAACTTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCT
CATCGAGGTGGGTGCTACCTGTGTGTGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCGCCTCC
TAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAAAGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGC
TTTTTTGCCGCGCCCCCCCCCCCCCGCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGTTAGGA


Top

FusionGenePPI for NRXN2_NSD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NRXN2NLGN1, NLGN2, MLLT4, MAPK6, MACF1NSD1ZNF496, AR, RELA, AFF1, SIRT7, HIST4H4, TNFRSF21, RARA, RXRA, ESR1, PPARG, VDR, THRB, RORA, RORB, HNF4G, NR2F6, ESRRA, NR5A2, NR6A1, NR2F1, NR2F2, NR2E1, HIST3H3, HIST1H1B, ATRX, SNORD3A, HIST1H1D, HIST1H1C, GAR1, HIST1H3A, HIST1H4A, POLR2A, ZFY, ZBTB48, ZNF692, MECP2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NRXN2_NSD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NRXN2_NSD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNRXN2C0036341Schizophrenia1PSYGENET
HgeneNRXN2C1510586Autism Spectrum Disorders1CTD_human
TgeneNSD1C0175695Sotos' syndrome14CTD_human;ORPHANET;UNIPROT
TgeneNSD1C0004352Autistic Disorder1CTD_human
TgeneNSD1C0010606Adenoid Cystic Carcinoma1CTD_human
TgeneNSD1C0265210Weaver syndrome1CTD_human;ORPHANET
TgeneNSD1C3714756Intellectual Disability1CTD_human