FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24778

FusionGeneSummary for NR1D2_UBE2E2

check button Fusion gene summary
Fusion gene informationFusion gene name: NR1D2_UBE2E2
Fusion gene ID: 24778
HgeneTgene
Gene symbol

NR1D2

UBE2E2

Gene ID

9975

7325

Gene namenuclear receptor subfamily 1 group D member 2ubiquitin conjugating enzyme E2 E2
SynonymsBD73|EAR-1R|REVERBB|REVERBbeta|RVRUBCH8
Cytomap

3p24.2

3p24.3

Type of geneprotein-codingprotein-coding
Descriptionnuclear receptor subfamily 1 group D member 2V-erbA-related protein 1-relatednuclear receptor Rev-ErbA beta variant 1nuclear receptor Rev-ErbA beta variant 2orphan nuclear hormone receptor BD73rev-erb alpha-related receptorrev-erb-betarev-erba-alphubiquitin-conjugating enzyme E2 E2E2 ubiquitin-conjugating enzyme E2ubiquitin carrier protein E2ubiquitin conjugating enzyme E2E 2ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast)ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5
Modification date2018052320180523
UniProtAcc

Q14995

Q96LR5

Ensembl transtripts involved in fusion geneENST00000312521, ENST00000492552, 
ENST00000425792, ENST00000396703, 
Fusion gene scores* DoF score2 X 2 X 2=86 X 5 X 4=120
# samples 26
** MAII scorelog2(2/8*10)=1.32192809488736log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NR1D2 [Title/Abstract] AND UBE2E2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTranscription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNR1D2

GO:0045892

negative regulation of transcription, DNA-templated

17892483|17996965

TgeneUBE2E2

GO:0032020

ISG15-protein conjugation

16428300

TgeneUBE2E2

GO:0070534

protein K63-linked ubiquitination

20061386

TgeneUBE2E2

GO:0070936

protein K48-linked ubiquitination

20061386

TgeneUBE2E2

GO:0070979

protein K11-linked ubiquitination

20061386


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-55-A57B-01ANR1D2chr3

24004096

+UBE2E2chr3

23574045

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000312521ENST00000425792NR1D2chr3

24004096

+UBE2E2chr3

23574045

+
In-frameENST00000312521ENST00000396703NR1D2chr3

24004096

+UBE2E2chr3

23574045

+
3UTR-3CDSENST00000492552ENST00000425792NR1D2chr3

24004096

+UBE2E2chr3

23574045

+
3UTR-3CDSENST00000492552ENST00000396703NR1D2chr3

24004096

+UBE2E2chr3

23574045

+

Top

FusionProtFeatures for NR1D2_UBE2E2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NR1D2

Q14995

UBE2E2

Q96LR5

Transcriptional repressor which coordinates circadianrhythm and metabolic pathways in a heme-dependent manner. Integralcomponent of the complex transcription machinery that governscircadian rhythmicity and forms a critical negative limb of thecircadian clock by directly repressing the expression of coreclock components ARNTL/BMAL1 and CLOCK. Also regulates genesinvolved in metabolic functions, including lipid metabolism andthe inflammatory response. Acts as a receptor for heme whichstimulates its interaction with the NCOR1/HDAC3 corepressorcomplex, enhancing transcriptional repression. Recognizes twoclasses of DNA response elements within the promoter of its targetgenes and can bind to DNA as either monomers or homodimers,depending on the nature of the response element. Binds as amonomer to a response element composed of the consensus half-sitemotif 5'-[A/G]GGTCA-3' preceded by an A/T-rich 5' sequence(RevRE), or as a homodimer to a direct repeat of the core motifspaced by two nuclegotides (RevDR-2). Acts as a potent competitiverepressor of ROR alpha (RORA) function and also negativelyregulates the expression of NR1D1. Regulates lipid and energyhomeostasis in the skeletal muscle via repression of genesinvolved in lipid metabolism and myogenesis including: CD36,FABP3, FABP4, UCP3, SCD1 and MSTN. Regulates hepatic lipidmetabolism via the repression of APOC3. Represses gene expressionat a distance in macrophages by inhibiting the transcription ofenhancer-derived RNAs (eRNAs). In addition to its activity as arepressor, can also act as a transcriptional activator. Acts as atranscriptional activator of the sterol regulatory element-bindingprotein 1 (SREBF1) and the inflammatory mediator interleukin-6(IL6) in the skeletal muscle. {ECO:0000269|PubMed:17892483,ECO:0000269|PubMed:17996965}. Accepts ubiquitin from the E1 complex and catalyzes itscovalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination.Catalyzes the ISGylation of influenza A virus NS1 protein.{ECO:0000269|PubMed:20061386, ECO:0000269|PubMed:20133869,ECO:0000269|PubMed:9371400}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNR1D2chr3:24004096chr3:23574045ENST00000312521+5813_20382580Compositional biasNote=Poly-Ser
HgeneNR1D2chr3:24004096chr3:23574045ENST00000312521+5835_39382580Compositional biasNote=Poly-Ser
HgeneNR1D2chr3:24004096chr3:23574045ENST00000312521+58100_176382580DNA bindingNuclear receptor
HgeneNR1D2chr3:24004096chr3:23574045ENST00000312521+58124_249382580RegionNote=Hinge
HgeneNR1D2chr3:24004096chr3:23574045ENST00000312521+581_99382580RegionNote=Modulating
HgeneNR1D2chr3:24004096chr3:23574045ENST00000312521+58103_123382580Zinc fingerNR C4-type
HgeneNR1D2chr3:24004096chr3:23574045ENST00000312521+58140_164382580Zinc fingerNR C4-type

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNR1D2chr3:24004096chr3:23574045ENST00000312521+58369_579382580DomainNR LBD


Top

FusionGeneSequence for NR1D2_UBE2E2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NR1D2_ENST00000312521_chr3_24004096_+_UBE2E2_ENST00000425792_chr3_23574045_+_464aa
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSH
SGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQE
QQENSAESMQPQRGERIPKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPI
DGFSQNENKNSYLCNTGGRMHLVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH

>In-frame_NR1D2_ENST00000312521_chr3_24004096_+_UBE2E2_ENST00000396703_chr3_23574045_+_464aa
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSH
SGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQE
QQENSAESMQPQRGERIPKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPI
DGFSQNENKNSYLCNTGGRMHLVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NR1D2_ENST00000312521_chr3_24004096_+_UBE2E2_ENST00000425792_chr3_23574045_+_1392nt
ATGGAGGTGAATGCAGGAGGTGTGATTGCCTATATCAGTTCTTCCAGCTCAGCCTCAAGCCCTGCCTCTTGTCACAGTGAGGGTTCTGAG
AATAGTTTCCAGTCCTCCTCCTCTTCTGTTCCATCTTCTCCAAATAGCTCTAATTCTGATACCAATGGTAATCCCAAGAATGGTGATCTC
GCCAATATTGAAGGCATCTTGAAGAATGATCGAATAGATTGTTCTATGAAAACAAGCAAATCGAGTGCACCTGGGATGACAAAAAGTCAT
AGTGGTGTGACAAAATTTAGTGGCATGGTTCTACTGTGTAAAGTCTGTGGGGATGTGGCGTCAGGATTCCACTATGGAGTTCATGCTTGC
GAAGGCTGTAAGGGTTTCTTTCGGAGAAGTATTCAACAAAACATCCAGTACAAGAAGTGCCTGAAGAATGAAAACTGTTCTATAATGAGA
ATGAATAGGAACAGATGTCAGCAATGTCGCTTCAAAAAGTGTCTGTCTGTTGGAATGTCAAGAGATGCTGTTCGGTTTGGTCGTATTCCT
AAGCGTGAAAAACAGAGGATGCTAATTGAAATGCAAAGTGCAATGAAGACCATGATGAACAGCCAGTTCAGTGGTCACTTGCAAAATGAC
ACATTAGTAGAACATCATGAACAGACAGCCTTGCCAGCCCAGGAACAGCTGCGACCCAAGCCCCAACTGGAGCAAGAAAACATCAAAAGC
TCTTCTCCTCCATCTTCTGATTTTGCAAAGGAAGAAGTGATTGGCATGGTGACCAGAGCTCACAAGGATACCTTTATGTATAATCAAGAG
CAGCAAGAAAACTCAGCTGAGAGCATGCAGCCCCAGAGAGGAGAACGGATTCCCAAGAACATGGAGCAATATAATTTAAATCATGATCAT
TGCGGCAATGGGCTTAGCAGCCATTTTCCCTGTAGTGAGAGCCAGCAGCATCTCAATGGACAGTTCAAAGGGAGGAATATAATGCATTAC
CCAAATGGTCATGCCATTTGTATTGCAAATGGACATTGTATGAACTTCTCCAATGCTTATACTCAAAGAGTATGTGATAGAGTTCCGATA
GATGGATTTTCTCAGAATGAGAACAAGAATAGTTACCTGTGCAACACTGGAGGAAGAATGCATCTGGTTACCTTCCGAACAAGAATCTAT
CACTGTAATATTAACAGCCAAGGTGTGATCTGTCTGGACATCTTAAAGGACAACTGGAGTCCGGCTTTAACTATTTCTAAAGTTCTCCTC
TCCATCTGCTCACTTCTTACAGATTGCAACCCTGCTGACCCTCTGGTGGGCAGCATCGCCACACAGTACATGACCAACAGAGCAGAGCAT

>In-frame_NR1D2_ENST00000312521_chr3_24004096_+_UBE2E2_ENST00000396703_chr3_23574045_+_1392nt
ATGGAGGTGAATGCAGGAGGTGTGATTGCCTATATCAGTTCTTCCAGCTCAGCCTCAAGCCCTGCCTCTTGTCACAGTGAGGGTTCTGAG
AATAGTTTCCAGTCCTCCTCCTCTTCTGTTCCATCTTCTCCAAATAGCTCTAATTCTGATACCAATGGTAATCCCAAGAATGGTGATCTC
GCCAATATTGAAGGCATCTTGAAGAATGATCGAATAGATTGTTCTATGAAAACAAGCAAATCGAGTGCACCTGGGATGACAAAAAGTCAT
AGTGGTGTGACAAAATTTAGTGGCATGGTTCTACTGTGTAAAGTCTGTGGGGATGTGGCGTCAGGATTCCACTATGGAGTTCATGCTTGC
GAAGGCTGTAAGGGTTTCTTTCGGAGAAGTATTCAACAAAACATCCAGTACAAGAAGTGCCTGAAGAATGAAAACTGTTCTATAATGAGA
ATGAATAGGAACAGATGTCAGCAATGTCGCTTCAAAAAGTGTCTGTCTGTTGGAATGTCAAGAGATGCTGTTCGGTTTGGTCGTATTCCT
AAGCGTGAAAAACAGAGGATGCTAATTGAAATGCAAAGTGCAATGAAGACCATGATGAACAGCCAGTTCAGTGGTCACTTGCAAAATGAC
ACATTAGTAGAACATCATGAACAGACAGCCTTGCCAGCCCAGGAACAGCTGCGACCCAAGCCCCAACTGGAGCAAGAAAACATCAAAAGC
TCTTCTCCTCCATCTTCTGATTTTGCAAAGGAAGAAGTGATTGGCATGGTGACCAGAGCTCACAAGGATACCTTTATGTATAATCAAGAG
CAGCAAGAAAACTCAGCTGAGAGCATGCAGCCCCAGAGAGGAGAACGGATTCCCAAGAACATGGAGCAATATAATTTAAATCATGATCAT
TGCGGCAATGGGCTTAGCAGCCATTTTCCCTGTAGTGAGAGCCAGCAGCATCTCAATGGACAGTTCAAAGGGAGGAATATAATGCATTAC
CCAAATGGTCATGCCATTTGTATTGCAAATGGACATTGTATGAACTTCTCCAATGCTTATACTCAAAGAGTATGTGATAGAGTTCCGATA
GATGGATTTTCTCAGAATGAGAACAAGAATAGTTACCTGTGCAACACTGGAGGAAGAATGCATCTGGTTACCTTCCGAACAAGAATCTAT
CACTGTAATATTAACAGCCAAGGTGTGATCTGTCTGGACATCTTAAAGGACAACTGGAGTCCGGCTTTAACTATTTCTAAAGTTCTCCTC
TCCATCTGCTCACTTCTTACAGATTGCAACCCTGCTGACCCTCTGGTGGGCAGCATCGCCACACAGTACATGACCAACAGAGCAGAGCAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NR1D2_ENST00000312521_chr3_24004096_+_UBE2E2_ENST00000425792_chr3_23574045_+_2102nt
GTCACATGGTCGCGGCTGCCCTCCCCGTCAGCCGCCCTCGCCGCCGCGGTGCGCTGGCTGCAGGAAGCCGCCGCGCCGCCGCTTTTGTTG
TCAGGGACCCAGCGAGGAGCGCCGCTCGCCGGCCGCCGCCACCCTCTCTCGCTGCAGCCTGCTGTGCGCTGCACGGCCTGGGGCCCGGGA
GCCCCGCCCGCTCTGCCCATGAGGGGGCCCCGCGACCACCGCTGCTTCCAGCCCGGGGCGGCGCGGCGCTGAGGCGGCGGCGGCGGCGCT
GCCCCCTCTGCGGGAAGCGGGCGGCCCCGGCCGCCTCCGCGAGGGCACCATGGAGGTGAATGCAGGAGGTGTGATTGCCTATATCAGTTC
TTCCAGCTCAGCCTCAAGCCCTGCCTCTTGTCACAGTGAGGGTTCTGAGAATAGTTTCCAGTCCTCCTCCTCTTCTGTTCCATCTTCTCC
AAATAGCTCTAATTCTGATACCAATGGTAATCCCAAGAATGGTGATCTCGCCAATATTGAAGGCATCTTGAAGAATGATCGAATAGATTG
TTCTATGAAAACAAGCAAATCGAGTGCACCTGGGATGACAAAAAGTCATAGTGGTGTGACAAAATTTAGTGGCATGGTTCTACTGTGTAA
AGTCTGTGGGGATGTGGCGTCAGGATTCCACTATGGAGTTCATGCTTGCGAAGGCTGTAAGGGTTTCTTTCGGAGAAGTATTCAACAAAA
CATCCAGTACAAGAAGTGCCTGAAGAATGAAAACTGTTCTATAATGAGAATGAATAGGAACAGATGTCAGCAATGTCGCTTCAAAAAGTG
TCTGTCTGTTGGAATGTCAAGAGATGCTGTTCGGTTTGGTCGTATTCCTAAGCGTGAAAAACAGAGGATGCTAATTGAAATGCAAAGTGC
AATGAAGACCATGATGAACAGCCAGTTCAGTGGTCACTTGCAAAATGACACATTAGTAGAACATCATGAACAGACAGCCTTGCCAGCCCA
GGAACAGCTGCGACCCAAGCCCCAACTGGAGCAAGAAAACATCAAAAGCTCTTCTCCTCCATCTTCTGATTTTGCAAAGGAAGAAGTGAT
TGGCATGGTGACCAGAGCTCACAAGGATACCTTTATGTATAATCAAGAGCAGCAAGAAAACTCAGCTGAGAGCATGCAGCCCCAGAGAGG
AGAACGGATTCCCAAGAACATGGAGCAATATAATTTAAATCATGATCATTGCGGCAATGGGCTTAGCAGCCATTTTCCCTGTAGTGAGAG
CCAGCAGCATCTCAATGGACAGTTCAAAGGGAGGAATATAATGCATTACCCAAATGGTCATGCCATTTGTATTGCAAATGGACATTGTAT
GAACTTCTCCAATGCTTATACTCAAAGAGTATGTGATAGAGTTCCGATAGATGGATTTTCTCAGAATGAGAACAAGAATAGTTACCTGTG
CAACACTGGAGGAAGAATGCATCTGGTTACCTTCCGAACAAGAATCTATCACTGTAATATTAACAGCCAAGGTGTGATCTGTCTGGACAT
CTTAAAGGACAACTGGAGTCCGGCTTTAACTATTTCTAAAGTTCTCCTCTCCATCTGCTCACTTCTTACAGATTGCAACCCTGCTGACCC
TCTGGTGGGCAGCATCGCCACACAGTACATGACCAACAGAGCAGAGCATGACCGGATGGCCAGACAGTGGACCAAGCGGTACGCCACATA
GGGGCCTGCTGCCTGCCGCCCCGCGGGACCTGTGCAAGCACATTCACCAAGTGCATCGGTAGCCCTGCCCACCCCTCCAGACCTCGGTTC
TTATTTTCCTATTTTTATTAAATTTGGAACCATTTTGTGATGGTATGTTGTCCATCTTCCCATCCCAGTTCTTCCTGCCCCCCTTCCTCT
CTCCCACGCTCTCTTTTATCTCTCATTTTATTCCCTTGTTGATTTCTGTTAACTTGAAAGATTTGGGATTTTTTCCCACCTCATCATAGA
TGGGAACTTTTGTTTTCAGTGCAAACAATGTTGGAGCTGTAATAGTAAGAGCTTTCTTACAAAGCTTTGTATTACTGTGTGGTTTTGTTT

>In-frame_NR1D2_ENST00000312521_chr3_24004096_+_UBE2E2_ENST00000396703_chr3_23574045_+_3673nt
GTCACATGGTCGCGGCTGCCCTCCCCGTCAGCCGCCCTCGCCGCCGCGGTGCGCTGGCTGCAGGAAGCCGCCGCGCCGCCGCTTTTGTTG
TCAGGGACCCAGCGAGGAGCGCCGCTCGCCGGCCGCCGCCACCCTCTCTCGCTGCAGCCTGCTGTGCGCTGCACGGCCTGGGGCCCGGGA
GCCCCGCCCGCTCTGCCCATGAGGGGGCCCCGCGACCACCGCTGCTTCCAGCCCGGGGCGGCGCGGCGCTGAGGCGGCGGCGGCGGCGCT
GCCCCCTCTGCGGGAAGCGGGCGGCCCCGGCCGCCTCCGCGAGGGCACCATGGAGGTGAATGCAGGAGGTGTGATTGCCTATATCAGTTC
TTCCAGCTCAGCCTCAAGCCCTGCCTCTTGTCACAGTGAGGGTTCTGAGAATAGTTTCCAGTCCTCCTCCTCTTCTGTTCCATCTTCTCC
AAATAGCTCTAATTCTGATACCAATGGTAATCCCAAGAATGGTGATCTCGCCAATATTGAAGGCATCTTGAAGAATGATCGAATAGATTG
TTCTATGAAAACAAGCAAATCGAGTGCACCTGGGATGACAAAAAGTCATAGTGGTGTGACAAAATTTAGTGGCATGGTTCTACTGTGTAA
AGTCTGTGGGGATGTGGCGTCAGGATTCCACTATGGAGTTCATGCTTGCGAAGGCTGTAAGGGTTTCTTTCGGAGAAGTATTCAACAAAA
CATCCAGTACAAGAAGTGCCTGAAGAATGAAAACTGTTCTATAATGAGAATGAATAGGAACAGATGTCAGCAATGTCGCTTCAAAAAGTG
TCTGTCTGTTGGAATGTCAAGAGATGCTGTTCGGTTTGGTCGTATTCCTAAGCGTGAAAAACAGAGGATGCTAATTGAAATGCAAAGTGC
AATGAAGACCATGATGAACAGCCAGTTCAGTGGTCACTTGCAAAATGACACATTAGTAGAACATCATGAACAGACAGCCTTGCCAGCCCA
GGAACAGCTGCGACCCAAGCCCCAACTGGAGCAAGAAAACATCAAAAGCTCTTCTCCTCCATCTTCTGATTTTGCAAAGGAAGAAGTGAT
TGGCATGGTGACCAGAGCTCACAAGGATACCTTTATGTATAATCAAGAGCAGCAAGAAAACTCAGCTGAGAGCATGCAGCCCCAGAGAGG
AGAACGGATTCCCAAGAACATGGAGCAATATAATTTAAATCATGATCATTGCGGCAATGGGCTTAGCAGCCATTTTCCCTGTAGTGAGAG
CCAGCAGCATCTCAATGGACAGTTCAAAGGGAGGAATATAATGCATTACCCAAATGGTCATGCCATTTGTATTGCAAATGGACATTGTAT
GAACTTCTCCAATGCTTATACTCAAAGAGTATGTGATAGAGTTCCGATAGATGGATTTTCTCAGAATGAGAACAAGAATAGTTACCTGTG
CAACACTGGAGGAAGAATGCATCTGGTTACCTTCCGAACAAGAATCTATCACTGTAATATTAACAGCCAAGGTGTGATCTGTCTGGACAT
CTTAAAGGACAACTGGAGTCCGGCTTTAACTATTTCTAAAGTTCTCCTCTCCATCTGCTCACTTCTTACAGATTGCAACCCTGCTGACCC
TCTGGTGGGCAGCATCGCCACACAGTACATGACCAACAGAGCAGAGCATGACCGGATGGCCAGACAGTGGACCAAGCGGTACGCCACATA
GGGGCCTGCTGCCTGCCGCCCCGCGGGACCTGTGCAAGCACATTCACCAAGTGCATCGGTAGCCCTGCCCACCCCTCCAGACCTCGGTTC
TTATTTTCCTATTTTTATTAAATTTGGAACCATTTTGTGATGGTATGTTGTCCATCTTCCCATCCCAGTTCTTCCTGCCCCCCTTCCTCT
CTCCCACGCTCTCTTTTATCTCTCATTTTATTCCCTTGTTGATTTCTGTTAACTTGAAAGATTTGGGATTTTTTCCCACCTCATCATAGA
TGGGAACTTTTGTTTTCAGTGCAAACAATGTTGGAGCTGTAATAGTAAGAGCTTTCTTACAAAGCTTTGTATTACTGTGTGGTTTTGTTT
TTTTTGTTGTTGTTTATTTGATTTTGATTTTTTTTTCTTTTATGTGATCTTTGGGAAAACACATTCAGAATTATATCTCGTTTCTACTTA
AATGTAGTGCTTAGGGTTAATTTTTTGTACTGAAGTCTTTATTGGTGGGTGCATGCTACTGGGAACAAGTTTTTGTACAAAAGCTTCAAT
CAGAATCACTGTGCATTACTGAGACTCTGTTTATCACTAGCCTTCTGTCCCTCCCGCAGAAGACTGTTGGATTGAACAAAATAATATGTA
TTTTGATTTACTTAAAGTGCTTGTAAATTTCTTAGGGACCTGCCACTTTTGACTGTGGATCAGTTGATGTACACTTGTATTATTAAAGCA
CTCAATAAATCACTGTGGCTGATAACTGCACTTCTGGTAACCCGACATTTGCTTTGTGTCCTGGTGACCGCTGTAGCCCTACGTGCAGTG
AGGCTTGTCTAATTCAATTACAGGTTCAAGTGTATTTTTCATCTCAAACCTCTAATATTTCTTTGGAGTTGAGTTGCTTAGCATGTGGAA
TTTCTCCAGCTGTCAGTAGCCTGATGATTTTATGGTTGTTATAGTAAATTGCTATCATTTTACATATTGACTGGGCATTCTTTCTGTTAC
AGCCTTCTTTATCAACAATTAAAATATGTAACTCCAAAAATAGCCTTCTTGTGAAAGTGAAGTCTGAGCTAATCATTGTGTTCAGCCACT
TTCAACTTTATTTCTCTCAAAATTGTTACAGTGATTGCCCTCAAGCTTTGTATTGTTCATTTTTGTTGTTGTTGTTGTTGTTGTTGCTGC
TCTTTTTTCTCCATGATTTTAGCAAAAGAAGTAAACTCAACTGTATTGGTCACGGTCAGCCCATTCAATGACAAGGGTGTCTGTCTGGCT
TCACCTTCAGGCTATTTTAGTGTGCAGCTATAGGAGGCAGAGGAAACGTGGGTGGTGTAGTTTCTAAAACACGCTGACTTGCTGATTGAT
AATTCAGGGTTATTAGTGTAACAAAGCGTAGTGGAAACTCCTACTCCTGCTGCACCATACAGTTACAGACCCTACCATACTCTTGGTCTC
ATTTAAGGAACCATTAACACCTTCACTGCTGAAAAGCAGGATTTATAAGCATAAGTCATCCACCTCTAAATATTTTAACATTTAAAATGC
CTGATTCAAAAGATACAGTTTTTGTTGTTTTTAACTAGTTAAAAATAAATCCTAAGAAAATATATTTAAATATTGCAAATGCCACTTCTA
AACCAAAATACCTGAGAATATTTTTTGTCTTTTTAATAACGATTTTACCATTCATTTTATTTAAAAACATTTCTCAGCATAGCAGGGCAC
TGTATGGTCTCTGATGCACTACTCAACCCTCTAGTTGTAGTAGAGGGAGCCACAGACAGTACATAAATGCATTGGGCAGAGCTATATTCC
AGTGAAACTTTATTTACCACCATAGGCATGGGATTTGGCCCATGGGTTGTAGTTTGCCAATCCCTGACACAGACCAACATAGACTGGGGG


Top

FusionGenePPI for NR1D2_UBE2E2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NR1D2NCOR1, TAF9, GTF2B, TAF6, SIN3B, HDAC1, KAT5, PRMT6, TRIM27, RBPMS, MID2, KRTAP4-2, KRT40, KRTAP10-9, NOTCH2NL, CSNK2A2, RORC, CLOCK, CSNK1E, DEC1, CRY1, USP48, NR1D1, SATB2, ZNF703, TRIM25UBE2E2RNF14, RNF8, STUB1, PCGF2, RNF5, ZNRF1, RNF114, RNF11, ARIH2, DTX3L, DZIP3, TRIM23, TRIM39, RNF185, RNF2, RNF25, XIAP, RNF125, RNF4, UBOX5, RING1, MARCH3, DTX3, RLIM, CHFR, MID1, MKRN3, RNF10, RNF111, RNF166, TRIM2, RUNX1T1, PRAM1, SIAH1, HDAC2, PARK2, BRCA1, ELAVL1, MID2, TRIM32, TRIM50, TRIM37, TRIM38, TRIM45, TRIM27, TRIM31, SPEN, UBA1, IPO11, RNF103, NFE2L2, CUL3, TRIM28, BARD1, MDM2, APP, PTBP2, UNG, SRPK2, SRPK1, UBE2E2, ARIH1, MUL1, DAZAP2, ARRDC3, FAM9B, DDA1, PDLIM2, RC3H2, OTUB1, DTL, RBX1, DET1, USP15, NEDD4L


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneNR1D2chr3:24004096chr3:23574045ENST00000312521+58397_579382580ZNHIT1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NR1D2_UBE2E2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NR1D2_UBE2E2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNR1D2C0014175Endometriosis1CTD_human
TgeneUBE2E2C0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human