FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24641

FusionGeneSummary for NOTCH2_REG4

check button Fusion gene summary
Fusion gene informationFusion gene name: NOTCH2_REG4
Fusion gene ID: 24641
HgeneTgene
Gene symbol

NOTCH2

REG4

Gene ID

4853

83998

Gene namenotch 2regenerating family member 4
SynonymsAGS2|HJCYS|hN2GISP|REG-IV|RELP
Cytomap

1p12

1p12

Type of geneprotein-codingprotein-coding
Descriptionneurogenic locus notch homolog protein 2Notch homolog 2regenerating islet-derived protein 4REG-4REG-like proteingastrointestinal secretory proteinreg IVregenerating gene type IVregenerating islet-derived family, member 4regenerating islet-derived protein IV
Modification date2018051920180523
UniProtAcc

Q04721

Q9BYZ8

Ensembl transtripts involved in fusion geneENST00000256646, ENST00000602566, 
ENST00000493703, 
ENST00000354219, 
ENST00000256585, ENST00000530654, 
ENST00000369401, 
Fusion gene scores* DoF score9 X 8 X 8=5764 X 4 X 4=64
# samples 125
** MAII scorelog2(12/576*10)=-2.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/64*10)=-0.356143810225275
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NOTCH2 [Title/Abstract] AND REG4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNOTCH2

GO:0007050

cell cycle arrest

11306509

HgeneNOTCH2

GO:0007219

Notch signaling pathway

11306509|25985737

HgeneNOTCH2

GO:0010629

negative regulation of gene expression

11306509

HgeneNOTCH2

GO:0045967

negative regulation of growth rate

11306509

HgeneNOTCH2

GO:0046579

positive regulation of Ras protein signal transduction

11306509

HgeneNOTCH2

GO:0070374

positive regulation of ERK1 and ERK2 cascade

11306509


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSKCMTCGA-D3-A5GU-06ANOTCH2chr1

120611948

-REG4chr1

120345788

-
TCGALDSKCMTCGA-GN-A264-06ANOTCH2chr1

120496166

-REG4chr1

120345788

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000256646ENST00000354219NOTCH2chr1

120611948

-REG4chr1

120345788

-
Frame-shitENST00000256646ENST00000256585NOTCH2chr1

120611948

-REG4chr1

120345788

-
Frame-shitENST00000256646ENST00000530654NOTCH2chr1

120611948

-REG4chr1

120345788

-
Frame-shitENST00000256646ENST00000369401NOTCH2chr1

120611948

-REG4chr1

120345788

-
intron-3CDSENST00000602566ENST00000354219NOTCH2chr1

120611948

-REG4chr1

120345788

-
intron-3CDSENST00000602566ENST00000256585NOTCH2chr1

120611948

-REG4chr1

120345788

-
intron-3CDSENST00000602566ENST00000530654NOTCH2chr1

120611948

-REG4chr1

120345788

-
intron-3CDSENST00000602566ENST00000369401NOTCH2chr1

120611948

-REG4chr1

120345788

-
intron-3CDSENST00000493703ENST00000354219NOTCH2chr1

120611948

-REG4chr1

120345788

-
intron-3CDSENST00000493703ENST00000256585NOTCH2chr1

120611948

-REG4chr1

120345788

-
intron-3CDSENST00000493703ENST00000530654NOTCH2chr1

120611948

-REG4chr1

120345788

-
intron-3CDSENST00000493703ENST00000369401NOTCH2chr1

120611948

-REG4chr1

120345788

-
In-frameENST00000256646ENST00000354219NOTCH2chr1

120496166

-REG4chr1

120345788

-
In-frameENST00000256646ENST00000256585NOTCH2chr1

120496166

-REG4chr1

120345788

-
In-frameENST00000256646ENST00000530654NOTCH2chr1

120496166

-REG4chr1

120345788

-
In-frameENST00000256646ENST00000369401NOTCH2chr1

120496166

-REG4chr1

120345788

-
intron-3CDSENST00000602566ENST00000354219NOTCH2chr1

120496166

-REG4chr1

120345788

-
intron-3CDSENST00000602566ENST00000256585NOTCH2chr1

120496166

-REG4chr1

120345788

-
intron-3CDSENST00000602566ENST00000530654NOTCH2chr1

120496166

-REG4chr1

120345788

-
intron-3CDSENST00000602566ENST00000369401NOTCH2chr1

120496166

-REG4chr1

120345788

-
intron-3CDSENST00000493703ENST00000354219NOTCH2chr1

120496166

-REG4chr1

120345788

-
intron-3CDSENST00000493703ENST00000256585NOTCH2chr1

120496166

-REG4chr1

120345788

-
intron-3CDSENST00000493703ENST00000530654NOTCH2chr1

120496166

-REG4chr1

120345788

-
intron-3CDSENST00000493703ENST00000369401NOTCH2chr1

120496166

-REG4chr1

120345788

-

Top

FusionProtFeatures for NOTCH2_REG4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NOTCH2

Q04721

REG4

Q9BYZ8

Functions as a receptor for membrane-bound ligandsJagged1, Jagged2 and Delta1 to regulate cell-fate determination.Upon ligand activation through the released notch intracellulardomain (NICD) it forms a transcriptional activator complex withRBPJ/RBPSUH and activates genes of the enhancer of split locus.Affects the implementation of differentiation, proliferation andapoptotic programs (By similarity). Involved in bone remodelingand homeostasis. In collaboration with RELA/p65 enhances NFATc1promoter activity and positively regulates RANKL-inducedosteoclast differentiation (PubMed:29149593). Positively regulatesself-renewal of liver cancer cells (PubMed:25985737).{ECO:0000250|UniProtKB:O35516, ECO:0000269|PubMed:21378985,ECO:0000269|PubMed:21378989, ECO:0000269|PubMed:25985737,ECO:0000269|PubMed:29149593}. Calcium-independent lectin displaying mannose-bindingspecificity and able to maintain carbohydrate recognition activityin an acidic environment. May be involved in inflammatory andmetaplastic responses of the gastrointestinal epithelium.{ECO:0000269|PubMed:12819006, ECO:0000269|PubMed:20692269}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434105_1437882472DomainEGF-like 3
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434144_1807882472DomainEGF-like 4
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434182_2197882472DomainEGF-like 5%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434221_2587882472DomainEGF-like 6
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434260_2967882472DomainEGF-like 7%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-143426_637882472DomainEGF-like 1
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434298_3367882472DomainEGF-like 8%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434338_3747882472DomainEGF-like 9%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434375_4137882472DomainEGF-like 10
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434415_4547882472DomainEGF-like 11%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434456_4927882472DomainEGF-like 12%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434494_5307882472DomainEGF-like 13%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434532_5687882472DomainEGF-like 14%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434570_6057882472DomainEGF-like 15%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434607_6437882472DomainEGF-like 16%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434645_6807882472DomainEGF-like 17%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-143464_1027882472DomainEGF-like 2
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434682_7187882472DomainEGF-like 18%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434720_7557882472DomainEGF-like 19
TgeneREG4chr1:120496166chr1:120345788ENST00000256585-1637_15522159DomainC-type lectin
TgeneREG4chr1:120496166chr1:120345788ENST00000354219-2737_15522159DomainC-type lectin
TgeneREG4chr1:120496166chr1:120345788ENST00000369401-1337_15522135DomainC-type lectin
TgeneREG4chr1:120496166chr1:120345788ENST00000256585-16135_13722159RegionNote=Carbohydrate-binding
TgeneREG4chr1:120496166chr1:120345788ENST00000256585-1698_10322159RegionNote=Carbohydrate-binding
TgeneREG4chr1:120496166chr1:120345788ENST00000354219-27135_13722159RegionNote=Carbohydrate-binding
TgeneREG4chr1:120496166chr1:120345788ENST00000354219-2798_10322159RegionNote=Carbohydrate-binding
TgeneREG4chr1:120496166chr1:120345788ENST00000369401-13135_13722135RegionNote=Carbohydrate-binding
TgeneREG4chr1:120496166chr1:120345788ENST00000369401-1398_10322135RegionNote=Carbohydrate-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341645_16487882472Compositional biasNote=Poly-Ala
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341994_19977882472Compositional biasNote=Poly-Leu
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14342426_24297882472Compositional biasNote=Poly-Ser
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341025_10617882472DomainEGF-like 27%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341063_10997882472DomainEGF-like 28
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341101_11477882472DomainEGF-like 29
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341149_11857882472DomainEGF-like 30%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341187_12237882472DomainEGF-like 31%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341225_12627882472DomainEGF-like 32%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341264_13027882472DomainEGF-like 33
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341304_13437882472DomainEGF-like 34
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341374_14127882472DomainEGF-like 35
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434757_7937882472DomainEGF-like 20%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434795_8317882472DomainEGF-like 21%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434833_8717882472DomainEGF-like 22
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434873_9097882472DomainEGF-like 23%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434911_9477882472DomainEGF-like 24%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434949_9857882472DomainEGF-like 25%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-1434987_10237882472DomainEGF-like 26%3B calcium-binding
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341425_16777882472RegionNote=Negative regulatory region (NRR)
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341425_14657882472RepeatNote=LNR 1
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341466_15027882472RepeatNote=LNR 2
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341503_15447882472RepeatNote=LNR 3
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341827_18717882472RepeatNote=ANK 1
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341876_19057882472RepeatNote=ANK 2
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341909_19397882472RepeatNote=ANK 3
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341943_19727882472RepeatNote=ANK 4
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341976_20057882472RepeatNote=ANK 5
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14342009_20387882472RepeatNote=ANK 6
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341699_24717882472Topological domainCytoplasmic
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-143426_16777882472Topological domainExtracellular
HgeneNOTCH2chr1:120496166chr1:120345788ENST00000256646-14341678_16987882472TransmembraneHelical


Top

FusionGeneSequence for NOTCH2_REG4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000354219_chr1_120345788_-_925aa
MPALRPALLWALLALWLCCAAPAHALQCRDGTEPCVNEGMCVTYHNGTGYCKCPEGFLGETCQHRDPCEKNRCQNGGTCVAQAMLGKATC
RCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTTECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLTVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQ
NGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGTGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQTICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGTAG
PRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGTECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQ
CNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGTKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKDIIMRPSCAPGWFYHKSNCTGY
FRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGTQRSQPIWIGLHDPQKRQQWQWIDGAMTLYRSWSGKSMGGNKHCAEMSS

>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000256585_chr1_120345788_-_925aa
MPALRPALLWALLALWLCCAAPAHALQCRDGTEPCVNEGMCVTYHNGTGYCKCPEGFLGETCQHRDPCEKNRCQNGGTCVAQAMLGKATC
RCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTTECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLTVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQ
NGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGTGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQTICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGTAG
PRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGTECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQ
CNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGTKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKDIIMRPSCAPGWFYHKSNCTGY
FRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGTQRSQPIWIGLHDPQKRQQWQWIDGAMTLYRSWSGKSMGGNKHCAEMSS

>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000530654_chr1_120345788_-_870aa
MPALRPALLWALLALWLCCAAPAHALQCRDGTEPCVNEGMCVTYHNGTGYCKCPEGFLGETCQHRDPCEKNRCQNGGTCVAQAMLGKATC
RCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTTECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLTVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQ
NGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGTGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQTICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGTAG
PRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGTECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQ
CNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGTKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKDIIMRPSCAPGWFYHKSNCTGY

>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000369401_chr1_120345788_-_901aa
MPALRPALLWALLALWLCCAAPAHALQCRDGTEPCVNEGMCVTYHNGTGYCKCPEGFLGETCQHRDPCEKNRCQNGGTCVAQAMLGKATC
RCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTTECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLTVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQ
NGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGTGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQTICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGTAG
PRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGTECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQ
CNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGTKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKDIIMRPSCAPGWFYHKSNCTGY
FRKLRNWSDAEVRNLLPAWPGLSRAKDQPEPQISFDSGSSVLPGHTEEKPLWLVKWREEGCVFNSFNSVSIAEAGAVCQTLDGLQAHTDT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000354219_chr1_120345788_-_2775nt
ATGCCCGCCCTGCGCCCCGCTCTGCTGTGGGCGCTGCTGGCGCTCTGGCTGTGCTGCGCGGCCCCCGCGCATGCATTGCAGTGTCGAGAT
GGCTATGAACCCTGTGTAAATGAAGGAATGTGTGTTACCTACCACAATGGCACAGGATACTGCAAATGTCCAGAAGGCTTCTTGGGGGAA
TATTGTCAACATCGAGACCCCTGTGAGAAGAACCGCTGCCAGAATGGTGGGACTTGTGTGGCCCAGGCCATGCTGGGGAAAGCCACGTGC
CGATGTGCCTCAGGGTTTACAGGAGAGGACTGCCAGTACTCAACATCTCATCCATGCTTTGTGTCTCGACCCTGCCTGAATGGCGGCACA
TGCCATATGCTCAGCCGGGATACCTATGAGTGCACCTGTCAAGTCGGGTTTACAGGTAAGGAGTGCCAATGGACGGATGCCTGCCTGTCT
CATCCCTGTGCAAATGGAAGTACCTGTACCACTGTGGCCAACCAGTTCTCCTGCAAATGCCTCACAGGCTTCACAGGGCAGAAATGTGAG
ACTGATGTCAATGAGTGTGACATTCCAGGACACTGCCAGCATGGTGGCACCTGCCTCAACCTGCCTGGTTCCTACCAGTGCCAGTGCCCT
CAGGGCTTCACAGGCCAGTACTGTGACAGCCTGTATGTGCCCTGTGCACCCTCACCTTGTGTCAATGGAGGCACCTGTCGGCAGACTGGT
GACTTCACTTTTGAGTGCAACTGCCTTCCAGGTTTTGAAGGGAGCACCTGTGAGAGGAATATTGATGACTGCCCTAACCACAGGTGTCAG
AATGGAGGGGTTTGTGTGGATGGGGTCAACACTTACAACTGCCGCTGTCCCCCACAATGGACAGGACAGTTCTGCACAGAGGATGTGGAT
GAATGCCTGCTGCAGCCCAATGCCTGTCAAAATGGGGGCACCTGTGCCAACCGCAATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGG
AGTGGAGATGACTGCAGTGAGAACATTGATGATTGTGCCTTCGCCTCCTGTACTCCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTC
TCTTGCATGTGCCCAGAGGGGAAGGCAGGTCTCCTGTGTCATCTGGATGATGCATGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGT
GACACCAACCCCCTAAATGGGCAATATATTTGCACCTGCCCACAAGGCTACAAAGGGGCTGACTGCACAGAAGATGTGGATGAATGTGCC
ATGGCCAATAGCAATCCTTGTGAGCATGCAGGAAAATGTGTGAACACGGATGGCGCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGA
CCTCGTTGTGAGATGGACATCAATGAGTGCCATTCAGACCCCTGCCAGAATGATGCTACCTGTCTGGATAAGATTGGAGGCTTCACATGT
CTGTGCATGCCAGGTTTCAAAGGTGTGCATTGTGAATTAGAAATAAATGAATGTCAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTG
GATAAAGTCAATCGTTTCCAGTGCCTGTGTCCTCCTGGTTTCACTGGGCCAGTTTGCCAGATTGATATTGATGACTGTTCCAGTACTCCG
TGTCTGAATGGGGCAAAGTGTATCGATCACCCGAATGGCTATGAATGCCAGTGTGCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAAC
ATTGACAACTGTGACCCCGATCCTTGCCACCATGGTCAGTGTCAGGATGGTATTGATTCCTACACCTGCATCTGCAATCCCGGGTACATG
GGCGCCATCTGCAGTGACCAGATTGATGAATGTTACAGCAGCCCTTGCCTGAACGATGGTCGCTGCATTGACCTGGTCAATGGCTACCAG
TGCAACTGCCAGCCAGGCACGTCAGGGGTTAATTGTGAAATTAATTTTGATGACTGTGCAAGTAACCCTTGTATCCATGGAATCTGTATG
GATGGCATTAATCGCTACAGTTGTGTCTGCTCACCAGGATTCACAGGGCAGAGATGTAACATTGACATTGATGAGTGTGCCTCCAATCCC
TGTCGCAAGGGTGCAACATGTATCAACGGTGTGAATGGTTTCCGCTGTATATGCCCCGAGGGACCCCATCACCCCAGCTGCTACTCACAG
GTGAACGAATGCCTGAGCAATCCCTGCATCCATGGAAACTGTACTGGAGGTCTCAGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTT
GGCATCAACTGTGAAGTGGACAAAAATGAATGCCTTTCGAATCCATGCCAGAATGGAGGAACTTGTGACAATCTGGTGAATGGATACAGG
TGTACTTGCAAGAAGGGCTTTAAAGATATCATCATGAGACCCAGCTGTGCTCCTGGATGGTTTTACCACAAGTCCAATTGCTATGGTTAC
TTCAGGAAGCTGAGGAACTGGTCTGATGCCGAGCTCGAGTGTCAGTCTTACGGAAACGGAGCCCACCTGGCATCTATCCTGAGTTTAAAG
GAAGCCAGCACCATAGCAGAGTACATAAGTGGCTATCAGAGAAGCCAGCCGATATGGATTGGCCTGCACGACCCACAGAAGAGGCAGCAG
TGGCAGTGGATTGATGGGGCCATGTATCTGTACAGATCCTGGTCTGGCAAGTCCATGGGTGGGAACAAGCACTGTGCTGAGATGAGCTCC

>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000256585_chr1_120345788_-_2775nt
ATGCCCGCCCTGCGCCCCGCTCTGCTGTGGGCGCTGCTGGCGCTCTGGCTGTGCTGCGCGGCCCCCGCGCATGCATTGCAGTGTCGAGAT
GGCTATGAACCCTGTGTAAATGAAGGAATGTGTGTTACCTACCACAATGGCACAGGATACTGCAAATGTCCAGAAGGCTTCTTGGGGGAA
TATTGTCAACATCGAGACCCCTGTGAGAAGAACCGCTGCCAGAATGGTGGGACTTGTGTGGCCCAGGCCATGCTGGGGAAAGCCACGTGC
CGATGTGCCTCAGGGTTTACAGGAGAGGACTGCCAGTACTCAACATCTCATCCATGCTTTGTGTCTCGACCCTGCCTGAATGGCGGCACA
TGCCATATGCTCAGCCGGGATACCTATGAGTGCACCTGTCAAGTCGGGTTTACAGGTAAGGAGTGCCAATGGACGGATGCCTGCCTGTCT
CATCCCTGTGCAAATGGAAGTACCTGTACCACTGTGGCCAACCAGTTCTCCTGCAAATGCCTCACAGGCTTCACAGGGCAGAAATGTGAG
ACTGATGTCAATGAGTGTGACATTCCAGGACACTGCCAGCATGGTGGCACCTGCCTCAACCTGCCTGGTTCCTACCAGTGCCAGTGCCCT
CAGGGCTTCACAGGCCAGTACTGTGACAGCCTGTATGTGCCCTGTGCACCCTCACCTTGTGTCAATGGAGGCACCTGTCGGCAGACTGGT
GACTTCACTTTTGAGTGCAACTGCCTTCCAGGTTTTGAAGGGAGCACCTGTGAGAGGAATATTGATGACTGCCCTAACCACAGGTGTCAG
AATGGAGGGGTTTGTGTGGATGGGGTCAACACTTACAACTGCCGCTGTCCCCCACAATGGACAGGACAGTTCTGCACAGAGGATGTGGAT
GAATGCCTGCTGCAGCCCAATGCCTGTCAAAATGGGGGCACCTGTGCCAACCGCAATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGG
AGTGGAGATGACTGCAGTGAGAACATTGATGATTGTGCCTTCGCCTCCTGTACTCCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTC
TCTTGCATGTGCCCAGAGGGGAAGGCAGGTCTCCTGTGTCATCTGGATGATGCATGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGT
GACACCAACCCCCTAAATGGGCAATATATTTGCACCTGCCCACAAGGCTACAAAGGGGCTGACTGCACAGAAGATGTGGATGAATGTGCC
ATGGCCAATAGCAATCCTTGTGAGCATGCAGGAAAATGTGTGAACACGGATGGCGCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGA
CCTCGTTGTGAGATGGACATCAATGAGTGCCATTCAGACCCCTGCCAGAATGATGCTACCTGTCTGGATAAGATTGGAGGCTTCACATGT
CTGTGCATGCCAGGTTTCAAAGGTGTGCATTGTGAATTAGAAATAAATGAATGTCAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTG
GATAAAGTCAATCGTTTCCAGTGCCTGTGTCCTCCTGGTTTCACTGGGCCAGTTTGCCAGATTGATATTGATGACTGTTCCAGTACTCCG
TGTCTGAATGGGGCAAAGTGTATCGATCACCCGAATGGCTATGAATGCCAGTGTGCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAAC
ATTGACAACTGTGACCCCGATCCTTGCCACCATGGTCAGTGTCAGGATGGTATTGATTCCTACACCTGCATCTGCAATCCCGGGTACATG
GGCGCCATCTGCAGTGACCAGATTGATGAATGTTACAGCAGCCCTTGCCTGAACGATGGTCGCTGCATTGACCTGGTCAATGGCTACCAG
TGCAACTGCCAGCCAGGCACGTCAGGGGTTAATTGTGAAATTAATTTTGATGACTGTGCAAGTAACCCTTGTATCCATGGAATCTGTATG
GATGGCATTAATCGCTACAGTTGTGTCTGCTCACCAGGATTCACAGGGCAGAGATGTAACATTGACATTGATGAGTGTGCCTCCAATCCC
TGTCGCAAGGGTGCAACATGTATCAACGGTGTGAATGGTTTCCGCTGTATATGCCCCGAGGGACCCCATCACCCCAGCTGCTACTCACAG
GTGAACGAATGCCTGAGCAATCCCTGCATCCATGGAAACTGTACTGGAGGTCTCAGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTT
GGCATCAACTGTGAAGTGGACAAAAATGAATGCCTTTCGAATCCATGCCAGAATGGAGGAACTTGTGACAATCTGGTGAATGGATACAGG
TGTACTTGCAAGAAGGGCTTTAAAGATATCATCATGAGACCCAGCTGTGCTCCTGGATGGTTTTACCACAAGTCCAATTGCTATGGTTAC
TTCAGGAAGCTGAGGAACTGGTCTGATGCCGAGCTCGAGTGTCAGTCTTACGGAAACGGAGCCCACCTGGCATCTATCCTGAGTTTAAAG
GAAGCCAGCACCATAGCAGAGTACATAAGTGGCTATCAGAGAAGCCAGCCGATATGGATTGGCCTGCACGACCCACAGAAGAGGCAGCAG
TGGCAGTGGATTGATGGGGCCATGTATCTGTACAGATCCTGGTCTGGCAAGTCCATGGGTGGGAACAAGCACTGTGCTGAGATGAGCTCC

>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000530654_chr1_120345788_-_2610nt
ATGCCCGCCCTGCGCCCCGCTCTGCTGTGGGCGCTGCTGGCGCTCTGGCTGTGCTGCGCGGCCCCCGCGCATGCATTGCAGTGTCGAGAT
GGCTATGAACCCTGTGTAAATGAAGGAATGTGTGTTACCTACCACAATGGCACAGGATACTGCAAATGTCCAGAAGGCTTCTTGGGGGAA
TATTGTCAACATCGAGACCCCTGTGAGAAGAACCGCTGCCAGAATGGTGGGACTTGTGTGGCCCAGGCCATGCTGGGGAAAGCCACGTGC
CGATGTGCCTCAGGGTTTACAGGAGAGGACTGCCAGTACTCAACATCTCATCCATGCTTTGTGTCTCGACCCTGCCTGAATGGCGGCACA
TGCCATATGCTCAGCCGGGATACCTATGAGTGCACCTGTCAAGTCGGGTTTACAGGTAAGGAGTGCCAATGGACGGATGCCTGCCTGTCT
CATCCCTGTGCAAATGGAAGTACCTGTACCACTGTGGCCAACCAGTTCTCCTGCAAATGCCTCACAGGCTTCACAGGGCAGAAATGTGAG
ACTGATGTCAATGAGTGTGACATTCCAGGACACTGCCAGCATGGTGGCACCTGCCTCAACCTGCCTGGTTCCTACCAGTGCCAGTGCCCT
CAGGGCTTCACAGGCCAGTACTGTGACAGCCTGTATGTGCCCTGTGCACCCTCACCTTGTGTCAATGGAGGCACCTGTCGGCAGACTGGT
GACTTCACTTTTGAGTGCAACTGCCTTCCAGGTTTTGAAGGGAGCACCTGTGAGAGGAATATTGATGACTGCCCTAACCACAGGTGTCAG
AATGGAGGGGTTTGTGTGGATGGGGTCAACACTTACAACTGCCGCTGTCCCCCACAATGGACAGGACAGTTCTGCACAGAGGATGTGGAT
GAATGCCTGCTGCAGCCCAATGCCTGTCAAAATGGGGGCACCTGTGCCAACCGCAATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGG
AGTGGAGATGACTGCAGTGAGAACATTGATGATTGTGCCTTCGCCTCCTGTACTCCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTC
TCTTGCATGTGCCCAGAGGGGAAGGCAGGTCTCCTGTGTCATCTGGATGATGCATGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGT
GACACCAACCCCCTAAATGGGCAATATATTTGCACCTGCCCACAAGGCTACAAAGGGGCTGACTGCACAGAAGATGTGGATGAATGTGCC
ATGGCCAATAGCAATCCTTGTGAGCATGCAGGAAAATGTGTGAACACGGATGGCGCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGA
CCTCGTTGTGAGATGGACATCAATGAGTGCCATTCAGACCCCTGCCAGAATGATGCTACCTGTCTGGATAAGATTGGAGGCTTCACATGT
CTGTGCATGCCAGGTTTCAAAGGTGTGCATTGTGAATTAGAAATAAATGAATGTCAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTG
GATAAAGTCAATCGTTTCCAGTGCCTGTGTCCTCCTGGTTTCACTGGGCCAGTTTGCCAGATTGATATTGATGACTGTTCCAGTACTCCG
TGTCTGAATGGGGCAAAGTGTATCGATCACCCGAATGGCTATGAATGCCAGTGTGCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAAC
ATTGACAACTGTGACCCCGATCCTTGCCACCATGGTCAGTGTCAGGATGGTATTGATTCCTACACCTGCATCTGCAATCCCGGGTACATG
GGCGCCATCTGCAGTGACCAGATTGATGAATGTTACAGCAGCCCTTGCCTGAACGATGGTCGCTGCATTGACCTGGTCAATGGCTACCAG
TGCAACTGCCAGCCAGGCACGTCAGGGGTTAATTGTGAAATTAATTTTGATGACTGTGCAAGTAACCCTTGTATCCATGGAATCTGTATG
GATGGCATTAATCGCTACAGTTGTGTCTGCTCACCAGGATTCACAGGGCAGAGATGTAACATTGACATTGATGAGTGTGCCTCCAATCCC
TGTCGCAAGGGTGCAACATGTATCAACGGTGTGAATGGTTTCCGCTGTATATGCCCCGAGGGACCCCATCACCCCAGCTGCTACTCACAG
GTGAACGAATGCCTGAGCAATCCCTGCATCCATGGAAACTGTACTGGAGGTCTCAGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTT
GGCATCAACTGTGAAGTGGACAAAAATGAATGCCTTTCGAATCCATGCCAGAATGGAGGAACTTGTGACAATCTGGTGAATGGATACAGG
TGTACTTGCAAGAAGGGCTTTAAAGATATCATCATGAGACCCAGCTGTGCTCCTGGATGGTTTTACCACAAGTCCAATTGCTATGGTTAC
TTCAGGAAGCTGAGGAACTGGTCTGATGCCGAGCTCGAGTGTCAGTCTTACGGAAACGGAGCCCACCTGGCATCTATCCTGAGTTTAAAG
GAAGCCAGCACCATAGCAGAGTACATAAGTGGCTATCAGAGAAGCCAGCCGATATGGATTGGCCTGCACGACCCACAGAAGACTTTTTAA

>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000369401_chr1_120345788_-_2703nt
ATGCCCGCCCTGCGCCCCGCTCTGCTGTGGGCGCTGCTGGCGCTCTGGCTGTGCTGCGCGGCCCCCGCGCATGCATTGCAGTGTCGAGAT
GGCTATGAACCCTGTGTAAATGAAGGAATGTGTGTTACCTACCACAATGGCACAGGATACTGCAAATGTCCAGAAGGCTTCTTGGGGGAA
TATTGTCAACATCGAGACCCCTGTGAGAAGAACCGCTGCCAGAATGGTGGGACTTGTGTGGCCCAGGCCATGCTGGGGAAAGCCACGTGC
CGATGTGCCTCAGGGTTTACAGGAGAGGACTGCCAGTACTCAACATCTCATCCATGCTTTGTGTCTCGACCCTGCCTGAATGGCGGCACA
TGCCATATGCTCAGCCGGGATACCTATGAGTGCACCTGTCAAGTCGGGTTTACAGGTAAGGAGTGCCAATGGACGGATGCCTGCCTGTCT
CATCCCTGTGCAAATGGAAGTACCTGTACCACTGTGGCCAACCAGTTCTCCTGCAAATGCCTCACAGGCTTCACAGGGCAGAAATGTGAG
ACTGATGTCAATGAGTGTGACATTCCAGGACACTGCCAGCATGGTGGCACCTGCCTCAACCTGCCTGGTTCCTACCAGTGCCAGTGCCCT
CAGGGCTTCACAGGCCAGTACTGTGACAGCCTGTATGTGCCCTGTGCACCCTCACCTTGTGTCAATGGAGGCACCTGTCGGCAGACTGGT
GACTTCACTTTTGAGTGCAACTGCCTTCCAGGTTTTGAAGGGAGCACCTGTGAGAGGAATATTGATGACTGCCCTAACCACAGGTGTCAG
AATGGAGGGGTTTGTGTGGATGGGGTCAACACTTACAACTGCCGCTGTCCCCCACAATGGACAGGACAGTTCTGCACAGAGGATGTGGAT
GAATGCCTGCTGCAGCCCAATGCCTGTCAAAATGGGGGCACCTGTGCCAACCGCAATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGG
AGTGGAGATGACTGCAGTGAGAACATTGATGATTGTGCCTTCGCCTCCTGTACTCCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTC
TCTTGCATGTGCCCAGAGGGGAAGGCAGGTCTCCTGTGTCATCTGGATGATGCATGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGT
GACACCAACCCCCTAAATGGGCAATATATTTGCACCTGCCCACAAGGCTACAAAGGGGCTGACTGCACAGAAGATGTGGATGAATGTGCC
ATGGCCAATAGCAATCCTTGTGAGCATGCAGGAAAATGTGTGAACACGGATGGCGCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGA
CCTCGTTGTGAGATGGACATCAATGAGTGCCATTCAGACCCCTGCCAGAATGATGCTACCTGTCTGGATAAGATTGGAGGCTTCACATGT
CTGTGCATGCCAGGTTTCAAAGGTGTGCATTGTGAATTAGAAATAAATGAATGTCAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTG
GATAAAGTCAATCGTTTCCAGTGCCTGTGTCCTCCTGGTTTCACTGGGCCAGTTTGCCAGATTGATATTGATGACTGTTCCAGTACTCCG
TGTCTGAATGGGGCAAAGTGTATCGATCACCCGAATGGCTATGAATGCCAGTGTGCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAAC
ATTGACAACTGTGACCCCGATCCTTGCCACCATGGTCAGTGTCAGGATGGTATTGATTCCTACACCTGCATCTGCAATCCCGGGTACATG
GGCGCCATCTGCAGTGACCAGATTGATGAATGTTACAGCAGCCCTTGCCTGAACGATGGTCGCTGCATTGACCTGGTCAATGGCTACCAG
TGCAACTGCCAGCCAGGCACGTCAGGGGTTAATTGTGAAATTAATTTTGATGACTGTGCAAGTAACCCTTGTATCCATGGAATCTGTATG
GATGGCATTAATCGCTACAGTTGTGTCTGCTCACCAGGATTCACAGGGCAGAGATGTAACATTGACATTGATGAGTGTGCCTCCAATCCC
TGTCGCAAGGGTGCAACATGTATCAACGGTGTGAATGGTTTCCGCTGTATATGCCCCGAGGGACCCCATCACCCCAGCTGCTACTCACAG
GTGAACGAATGCCTGAGCAATCCCTGCATCCATGGAAACTGTACTGGAGGTCTCAGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTT
GGCATCAACTGTGAAGTGGACAAAAATGAATGCCTTTCGAATCCATGCCAGAATGGAGGAACTTGTGACAATCTGGTGAATGGATACAGG
TGTACTTGCAAGAAGGGCTTTAAAGATATCATCATGAGACCCAGCTGTGCTCCTGGATGGTTTTACCACAAGTCCAATTGCTATGGTTAC
TTCAGGAAGCTGAGGAACTGGTCTGATGCCGAGGTAAGAAACTTGCTGCCTGCTTGGCCTGGCCTTTCTAGAGCAAAGGACCAGCCAGAG
CCCCAGATCTCATTTGATTCAGGATCAAGTGTCCTTCCTGGGCACTATGAAGAGAAGCCCCTTTGGCTGGTGAAATGGAGAGAAGAGGGT
TGTGTGTTCAACTCATTCAATTCTGTAAGCATTGCTGAAGCAGGTGCTGTATGCCAGACCCTAGATGGGCTACAAGCACATACGGATACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000354219_chr1_120345788_-_3595nt
AAACTTCGGGCGGCGGCTGAGGCGGCGGCCGAGGAGCGGCGGACTCGGGGCGCGGGGAGTCGAGGCATTTGCGCCTGGGCTTCGGAGCGT
AGCGCCAGGGCCTGAGCCTTTGAAGCAGGAGGAGGGGAGGAGAGAGTGGGGCTCCTCTATCGGGACCCCCTCCCCATGTGGATCTGCCCA
GGCGGCGGCGGCGGCGGCGGAGGAGGAGGCGACCGAGAAGATGCCCGCCCTGCGCCCCGCTCTGCTGTGGGCGCTGCTGGCGCTCTGGCT
GTGCTGCGCGGCCCCCGCGCATGCATTGCAGTGTCGAGATGGCTATGAACCCTGTGTAAATGAAGGAATGTGTGTTACCTACCACAATGG
CACAGGATACTGCAAATGTCCAGAAGGCTTCTTGGGGGAATATTGTCAACATCGAGACCCCTGTGAGAAGAACCGCTGCCAGAATGGTGG
GACTTGTGTGGCCCAGGCCATGCTGGGGAAAGCCACGTGCCGATGTGCCTCAGGGTTTACAGGAGAGGACTGCCAGTACTCAACATCTCA
TCCATGCTTTGTGTCTCGACCCTGCCTGAATGGCGGCACATGCCATATGCTCAGCCGGGATACCTATGAGTGCACCTGTCAAGTCGGGTT
TACAGGTAAGGAGTGCCAATGGACGGATGCCTGCCTGTCTCATCCCTGTGCAAATGGAAGTACCTGTACCACTGTGGCCAACCAGTTCTC
CTGCAAATGCCTCACAGGCTTCACAGGGCAGAAATGTGAGACTGATGTCAATGAGTGTGACATTCCAGGACACTGCCAGCATGGTGGCAC
CTGCCTCAACCTGCCTGGTTCCTACCAGTGCCAGTGCCCTCAGGGCTTCACAGGCCAGTACTGTGACAGCCTGTATGTGCCCTGTGCACC
CTCACCTTGTGTCAATGGAGGCACCTGTCGGCAGACTGGTGACTTCACTTTTGAGTGCAACTGCCTTCCAGGTTTTGAAGGGAGCACCTG
TGAGAGGAATATTGATGACTGCCCTAACCACAGGTGTCAGAATGGAGGGGTTTGTGTGGATGGGGTCAACACTTACAACTGCCGCTGTCC
CCCACAATGGACAGGACAGTTCTGCACAGAGGATGTGGATGAATGCCTGCTGCAGCCCAATGCCTGTCAAAATGGGGGCACCTGTGCCAA
CCGCAATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGGAGTGGAGATGACTGCAGTGAGAACATTGATGATTGTGCCTTCGCCTCCTG
TACTCCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTCTCTTGCATGTGCCCAGAGGGGAAGGCAGGTCTCCTGTGTCATCTGGATGA
TGCATGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGTGACACCAACCCCCTAAATGGGCAATATATTTGCACCTGCCCACAAGGCTA
CAAAGGGGCTGACTGCACAGAAGATGTGGATGAATGTGCCATGGCCAATAGCAATCCTTGTGAGCATGCAGGAAAATGTGTGAACACGGA
TGGCGCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGACCTCGTTGTGAGATGGACATCAATGAGTGCCATTCAGACCCCTGCCAGAA
TGATGCTACCTGTCTGGATAAGATTGGAGGCTTCACATGTCTGTGCATGCCAGGTTTCAAAGGTGTGCATTGTGAATTAGAAATAAATGA
ATGTCAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTGGATAAAGTCAATCGTTTCCAGTGCCTGTGTCCTCCTGGTTTCACTGGGCC
AGTTTGCCAGATTGATATTGATGACTGTTCCAGTACTCCGTGTCTGAATGGGGCAAAGTGTATCGATCACCCGAATGGCTATGAATGCCA
GTGTGCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAACATTGACAACTGTGACCCCGATCCTTGCCACCATGGTCAGTGTCAGGATGG
TATTGATTCCTACACCTGCATCTGCAATCCCGGGTACATGGGCGCCATCTGCAGTGACCAGATTGATGAATGTTACAGCAGCCCTTGCCT
GAACGATGGTCGCTGCATTGACCTGGTCAATGGCTACCAGTGCAACTGCCAGCCAGGCACGTCAGGGGTTAATTGTGAAATTAATTTTGA
TGACTGTGCAAGTAACCCTTGTATCCATGGAATCTGTATGGATGGCATTAATCGCTACAGTTGTGTCTGCTCACCAGGATTCACAGGGCA
GAGATGTAACATTGACATTGATGAGTGTGCCTCCAATCCCTGTCGCAAGGGTGCAACATGTATCAACGGTGTGAATGGTTTCCGCTGTAT
ATGCCCCGAGGGACCCCATCACCCCAGCTGCTACTCACAGGTGAACGAATGCCTGAGCAATCCCTGCATCCATGGAAACTGTACTGGAGG
TCTCAGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTTGGCATCAACTGTGAAGTGGACAAAAATGAATGCCTTTCGAATCCATGCCA
GAATGGAGGAACTTGTGACAATCTGGTGAATGGATACAGGTGTACTTGCAAGAAGGGCTTTAAAGATATCATCATGAGACCCAGCTGTGC
TCCTGGATGGTTTTACCACAAGTCCAATTGCTATGGTTACTTCAGGAAGCTGAGGAACTGGTCTGATGCCGAGCTCGAGTGTCAGTCTTA
CGGAAACGGAGCCCACCTGGCATCTATCCTGAGTTTAAAGGAAGCCAGCACCATAGCAGAGTACATAAGTGGCTATCAGAGAAGCCAGCC
GATATGGATTGGCCTGCACGACCCACAGAAGAGGCAGCAGTGGCAGTGGATTGATGGGGCCATGTATCTGTACAGATCCTGGTCTGGCAA
GTCCATGGGTGGGAACAAGCACTGTGCTGAGATGAGCTCCAATAACAACTTTTTAACTTGGAGCAGCAACGAATGCAACAAGCGCCAACA
CTTCCTGTGCAAGTACCGACCATAGAGCAAGAATCAAGATTCTGCTAACTCCTGCACAGCCCCGTCCTCTTCCTTTCTGCTAGCCTGGCT
AAATCTGCTCATTATTTCAGAGGGGAAACCTAGCAAACTAAGAGTGATAAGGGCCCTACTACACTGGCTTTTTTAGGCTTAGAGACAGAA
ACTTTAGCATTGGCCCAGTAGTGGCTTCTAGCTCTAAATGTTTGCCCCGCCATCCCTTTCCACAGTATCCTTCTTCCCTCCTCCCCTGTC
TCTGGCTGTCTCGAGCAGTCTAGAAGAGTGCATCTCCAGCCTATGAAACAGCTGGGTCTTTGGCCATAAGAAGTAAAGATTTGAAGACAG
AAGGAAGAAACTCAGGAGTAAGCTTCTAGACCCCTTCAGCTTCTACACCCTTCTGCCCTCTCTCCATTGCCTGCACCCCACCCCAGCCAC
TCAACTCCTGCTTGTTTTTCCTTTGGCCATGGGAAGGTTTACCAGTAGAATCCTTGCTAGGTTGATGTGGGCCATACATTCCTTTAATAA

>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000256585_chr1_120345788_-_3529nt
AAACTTCGGGCGGCGGCTGAGGCGGCGGCCGAGGAGCGGCGGACTCGGGGCGCGGGGAGTCGAGGCATTTGCGCCTGGGCTTCGGAGCGT
AGCGCCAGGGCCTGAGCCTTTGAAGCAGGAGGAGGGGAGGAGAGAGTGGGGCTCCTCTATCGGGACCCCCTCCCCATGTGGATCTGCCCA
GGCGGCGGCGGCGGCGGCGGAGGAGGAGGCGACCGAGAAGATGCCCGCCCTGCGCCCCGCTCTGCTGTGGGCGCTGCTGGCGCTCTGGCT
GTGCTGCGCGGCCCCCGCGCATGCATTGCAGTGTCGAGATGGCTATGAACCCTGTGTAAATGAAGGAATGTGTGTTACCTACCACAATGG
CACAGGATACTGCAAATGTCCAGAAGGCTTCTTGGGGGAATATTGTCAACATCGAGACCCCTGTGAGAAGAACCGCTGCCAGAATGGTGG
GACTTGTGTGGCCCAGGCCATGCTGGGGAAAGCCACGTGCCGATGTGCCTCAGGGTTTACAGGAGAGGACTGCCAGTACTCAACATCTCA
TCCATGCTTTGTGTCTCGACCCTGCCTGAATGGCGGCACATGCCATATGCTCAGCCGGGATACCTATGAGTGCACCTGTCAAGTCGGGTT
TACAGGTAAGGAGTGCCAATGGACGGATGCCTGCCTGTCTCATCCCTGTGCAAATGGAAGTACCTGTACCACTGTGGCCAACCAGTTCTC
CTGCAAATGCCTCACAGGCTTCACAGGGCAGAAATGTGAGACTGATGTCAATGAGTGTGACATTCCAGGACACTGCCAGCATGGTGGCAC
CTGCCTCAACCTGCCTGGTTCCTACCAGTGCCAGTGCCCTCAGGGCTTCACAGGCCAGTACTGTGACAGCCTGTATGTGCCCTGTGCACC
CTCACCTTGTGTCAATGGAGGCACCTGTCGGCAGACTGGTGACTTCACTTTTGAGTGCAACTGCCTTCCAGGTTTTGAAGGGAGCACCTG
TGAGAGGAATATTGATGACTGCCCTAACCACAGGTGTCAGAATGGAGGGGTTTGTGTGGATGGGGTCAACACTTACAACTGCCGCTGTCC
CCCACAATGGACAGGACAGTTCTGCACAGAGGATGTGGATGAATGCCTGCTGCAGCCCAATGCCTGTCAAAATGGGGGCACCTGTGCCAA
CCGCAATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGGAGTGGAGATGACTGCAGTGAGAACATTGATGATTGTGCCTTCGCCTCCTG
TACTCCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTCTCTTGCATGTGCCCAGAGGGGAAGGCAGGTCTCCTGTGTCATCTGGATGA
TGCATGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGTGACACCAACCCCCTAAATGGGCAATATATTTGCACCTGCCCACAAGGCTA
CAAAGGGGCTGACTGCACAGAAGATGTGGATGAATGTGCCATGGCCAATAGCAATCCTTGTGAGCATGCAGGAAAATGTGTGAACACGGA
TGGCGCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGACCTCGTTGTGAGATGGACATCAATGAGTGCCATTCAGACCCCTGCCAGAA
TGATGCTACCTGTCTGGATAAGATTGGAGGCTTCACATGTCTGTGCATGCCAGGTTTCAAAGGTGTGCATTGTGAATTAGAAATAAATGA
ATGTCAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTGGATAAAGTCAATCGTTTCCAGTGCCTGTGTCCTCCTGGTTTCACTGGGCC
AGTTTGCCAGATTGATATTGATGACTGTTCCAGTACTCCGTGTCTGAATGGGGCAAAGTGTATCGATCACCCGAATGGCTATGAATGCCA
GTGTGCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAACATTGACAACTGTGACCCCGATCCTTGCCACCATGGTCAGTGTCAGGATGG
TATTGATTCCTACACCTGCATCTGCAATCCCGGGTACATGGGCGCCATCTGCAGTGACCAGATTGATGAATGTTACAGCAGCCCTTGCCT
GAACGATGGTCGCTGCATTGACCTGGTCAATGGCTACCAGTGCAACTGCCAGCCAGGCACGTCAGGGGTTAATTGTGAAATTAATTTTGA
TGACTGTGCAAGTAACCCTTGTATCCATGGAATCTGTATGGATGGCATTAATCGCTACAGTTGTGTCTGCTCACCAGGATTCACAGGGCA
GAGATGTAACATTGACATTGATGAGTGTGCCTCCAATCCCTGTCGCAAGGGTGCAACATGTATCAACGGTGTGAATGGTTTCCGCTGTAT
ATGCCCCGAGGGACCCCATCACCCCAGCTGCTACTCACAGGTGAACGAATGCCTGAGCAATCCCTGCATCCATGGAAACTGTACTGGAGG
TCTCAGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTTGGCATCAACTGTGAAGTGGACAAAAATGAATGCCTTTCGAATCCATGCCA
GAATGGAGGAACTTGTGACAATCTGGTGAATGGATACAGGTGTACTTGCAAGAAGGGCTTTAAAGATATCATCATGAGACCCAGCTGTGC
TCCTGGATGGTTTTACCACAAGTCCAATTGCTATGGTTACTTCAGGAAGCTGAGGAACTGGTCTGATGCCGAGCTCGAGTGTCAGTCTTA
CGGAAACGGAGCCCACCTGGCATCTATCCTGAGTTTAAAGGAAGCCAGCACCATAGCAGAGTACATAAGTGGCTATCAGAGAAGCCAGCC
GATATGGATTGGCCTGCACGACCCACAGAAGAGGCAGCAGTGGCAGTGGATTGATGGGGCCATGTATCTGTACAGATCCTGGTCTGGCAA
GTCCATGGGTGGGAACAAGCACTGTGCTGAGATGAGCTCCAATAACAACTTTTTAACTTGGAGCAGCAACGAATGCAACAAGCGCCAACA
CTTCCTGTGCAAGTACCGACCATAGAGCAAGAATCAAGATTCTGCTAACTCCTGCACAGCCCCGTCCTCTTCCTTTCTGCTAGCCTGGCT
AAATCTGCTCATTATTTCAGAGGGGAAACCTAGCAAACTAAGAGTGATAAGGGCCCTACTACACTGGCTTTTTTAGGCTTAGAGACAGAA
ACTTTAGCATTGGCCCAGTAGTGGCTTCTAGCTCTAAATGTTTGCCCCGCCATCCCTTTCCACAGTATCCTTCTTCCCTCCTCCCCTGTC
TCTGGCTGTCTCGAGCAGTCTAGAAGAGTGCATCTCCAGCCTATGAAACAGCTGGGTCTTTGGCCATAAGAAGTAAAGATTTGAAGACAG
AAGGAAGAAACTCAGGAGTAAGCTTCTAGACCCCTTCAGCTTCTACACCCTTCTGCCCTCTCTCCATTGCCTGCACCCCACCCCAGCCAC
TCAACTCCTGCTTGTTTTTCCTTTGGCCATGGGAAGGTTTACCAGTAGAATCCTTGCTAGGTTGATGTGGGCCATACATTCCTTTAATAA

>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000530654_chr1_120345788_-_3094nt
AAACTTCGGGCGGCGGCTGAGGCGGCGGCCGAGGAGCGGCGGACTCGGGGCGCGGGGAGTCGAGGCATTTGCGCCTGGGCTTCGGAGCGT
AGCGCCAGGGCCTGAGCCTTTGAAGCAGGAGGAGGGGAGGAGAGAGTGGGGCTCCTCTATCGGGACCCCCTCCCCATGTGGATCTGCCCA
GGCGGCGGCGGCGGCGGCGGAGGAGGAGGCGACCGAGAAGATGCCCGCCCTGCGCCCCGCTCTGCTGTGGGCGCTGCTGGCGCTCTGGCT
GTGCTGCGCGGCCCCCGCGCATGCATTGCAGTGTCGAGATGGCTATGAACCCTGTGTAAATGAAGGAATGTGTGTTACCTACCACAATGG
CACAGGATACTGCAAATGTCCAGAAGGCTTCTTGGGGGAATATTGTCAACATCGAGACCCCTGTGAGAAGAACCGCTGCCAGAATGGTGG
GACTTGTGTGGCCCAGGCCATGCTGGGGAAAGCCACGTGCCGATGTGCCTCAGGGTTTACAGGAGAGGACTGCCAGTACTCAACATCTCA
TCCATGCTTTGTGTCTCGACCCTGCCTGAATGGCGGCACATGCCATATGCTCAGCCGGGATACCTATGAGTGCACCTGTCAAGTCGGGTT
TACAGGTAAGGAGTGCCAATGGACGGATGCCTGCCTGTCTCATCCCTGTGCAAATGGAAGTACCTGTACCACTGTGGCCAACCAGTTCTC
CTGCAAATGCCTCACAGGCTTCACAGGGCAGAAATGTGAGACTGATGTCAATGAGTGTGACATTCCAGGACACTGCCAGCATGGTGGCAC
CTGCCTCAACCTGCCTGGTTCCTACCAGTGCCAGTGCCCTCAGGGCTTCACAGGCCAGTACTGTGACAGCCTGTATGTGCCCTGTGCACC
CTCACCTTGTGTCAATGGAGGCACCTGTCGGCAGACTGGTGACTTCACTTTTGAGTGCAACTGCCTTCCAGGTTTTGAAGGGAGCACCTG
TGAGAGGAATATTGATGACTGCCCTAACCACAGGTGTCAGAATGGAGGGGTTTGTGTGGATGGGGTCAACACTTACAACTGCCGCTGTCC
CCCACAATGGACAGGACAGTTCTGCACAGAGGATGTGGATGAATGCCTGCTGCAGCCCAATGCCTGTCAAAATGGGGGCACCTGTGCCAA
CCGCAATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGGAGTGGAGATGACTGCAGTGAGAACATTGATGATTGTGCCTTCGCCTCCTG
TACTCCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTCTCTTGCATGTGCCCAGAGGGGAAGGCAGGTCTCCTGTGTCATCTGGATGA
TGCATGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGTGACACCAACCCCCTAAATGGGCAATATATTTGCACCTGCCCACAAGGCTA
CAAAGGGGCTGACTGCACAGAAGATGTGGATGAATGTGCCATGGCCAATAGCAATCCTTGTGAGCATGCAGGAAAATGTGTGAACACGGA
TGGCGCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGACCTCGTTGTGAGATGGACATCAATGAGTGCCATTCAGACCCCTGCCAGAA
TGATGCTACCTGTCTGGATAAGATTGGAGGCTTCACATGTCTGTGCATGCCAGGTTTCAAAGGTGTGCATTGTGAATTAGAAATAAATGA
ATGTCAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTGGATAAAGTCAATCGTTTCCAGTGCCTGTGTCCTCCTGGTTTCACTGGGCC
AGTTTGCCAGATTGATATTGATGACTGTTCCAGTACTCCGTGTCTGAATGGGGCAAAGTGTATCGATCACCCGAATGGCTATGAATGCCA
GTGTGCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAACATTGACAACTGTGACCCCGATCCTTGCCACCATGGTCAGTGTCAGGATGG
TATTGATTCCTACACCTGCATCTGCAATCCCGGGTACATGGGCGCCATCTGCAGTGACCAGATTGATGAATGTTACAGCAGCCCTTGCCT
GAACGATGGTCGCTGCATTGACCTGGTCAATGGCTACCAGTGCAACTGCCAGCCAGGCACGTCAGGGGTTAATTGTGAAATTAATTTTGA
TGACTGTGCAAGTAACCCTTGTATCCATGGAATCTGTATGGATGGCATTAATCGCTACAGTTGTGTCTGCTCACCAGGATTCACAGGGCA
GAGATGTAACATTGACATTGATGAGTGTGCCTCCAATCCCTGTCGCAAGGGTGCAACATGTATCAACGGTGTGAATGGTTTCCGCTGTAT
ATGCCCCGAGGGACCCCATCACCCCAGCTGCTACTCACAGGTGAACGAATGCCTGAGCAATCCCTGCATCCATGGAAACTGTACTGGAGG
TCTCAGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTTGGCATCAACTGTGAAGTGGACAAAAATGAATGCCTTTCGAATCCATGCCA
GAATGGAGGAACTTGTGACAATCTGGTGAATGGATACAGGTGTACTTGCAAGAAGGGCTTTAAAGATATCATCATGAGACCCAGCTGTGC
TCCTGGATGGTTTTACCACAAGTCCAATTGCTATGGTTACTTCAGGAAGCTGAGGAACTGGTCTGATGCCGAGCTCGAGTGTCAGTCTTA
CGGAAACGGAGCCCACCTGGCATCTATCCTGAGTTTAAAGGAAGCCAGCACCATAGCAGAGTACATAAGTGGCTATCAGAGAAGCCAGCC
GATATGGATTGGCCTGCACGACCCACAGAAGACTTTTTAACTTGGAGCAGCAACGAATGCAACAAGCGCCAACACTTCCTGTGCAAGTAC
CGACCATAGAGCAAGAATCAAGATTCTGCTAACTCCTGCACAGCCCCGTCCTCTTCCTTTCTGCTAGCCTGGCTAAATCTGCTCATTATT
TCAGAGGGGAAACCTAGCAAACTAAGAGTGATAAGGGCCCTACTACACTGGCTTTTTTAGGCTTAGAGACAGAAACTTTAGCATTGGCCC

>In-frame_NOTCH2_ENST00000256646_chr1_120496166_-_REG4_ENST00000369401_chr1_120345788_-_4579nt
AAACTTCGGGCGGCGGCTGAGGCGGCGGCCGAGGAGCGGCGGACTCGGGGCGCGGGGAGTCGAGGCATTTGCGCCTGGGCTTCGGAGCGT
AGCGCCAGGGCCTGAGCCTTTGAAGCAGGAGGAGGGGAGGAGAGAGTGGGGCTCCTCTATCGGGACCCCCTCCCCATGTGGATCTGCCCA
GGCGGCGGCGGCGGCGGCGGAGGAGGAGGCGACCGAGAAGATGCCCGCCCTGCGCCCCGCTCTGCTGTGGGCGCTGCTGGCGCTCTGGCT
GTGCTGCGCGGCCCCCGCGCATGCATTGCAGTGTCGAGATGGCTATGAACCCTGTGTAAATGAAGGAATGTGTGTTACCTACCACAATGG
CACAGGATACTGCAAATGTCCAGAAGGCTTCTTGGGGGAATATTGTCAACATCGAGACCCCTGTGAGAAGAACCGCTGCCAGAATGGTGG
GACTTGTGTGGCCCAGGCCATGCTGGGGAAAGCCACGTGCCGATGTGCCTCAGGGTTTACAGGAGAGGACTGCCAGTACTCAACATCTCA
TCCATGCTTTGTGTCTCGACCCTGCCTGAATGGCGGCACATGCCATATGCTCAGCCGGGATACCTATGAGTGCACCTGTCAAGTCGGGTT
TACAGGTAAGGAGTGCCAATGGACGGATGCCTGCCTGTCTCATCCCTGTGCAAATGGAAGTACCTGTACCACTGTGGCCAACCAGTTCTC
CTGCAAATGCCTCACAGGCTTCACAGGGCAGAAATGTGAGACTGATGTCAATGAGTGTGACATTCCAGGACACTGCCAGCATGGTGGCAC
CTGCCTCAACCTGCCTGGTTCCTACCAGTGCCAGTGCCCTCAGGGCTTCACAGGCCAGTACTGTGACAGCCTGTATGTGCCCTGTGCACC
CTCACCTTGTGTCAATGGAGGCACCTGTCGGCAGACTGGTGACTTCACTTTTGAGTGCAACTGCCTTCCAGGTTTTGAAGGGAGCACCTG
TGAGAGGAATATTGATGACTGCCCTAACCACAGGTGTCAGAATGGAGGGGTTTGTGTGGATGGGGTCAACACTTACAACTGCCGCTGTCC
CCCACAATGGACAGGACAGTTCTGCACAGAGGATGTGGATGAATGCCTGCTGCAGCCCAATGCCTGTCAAAATGGGGGCACCTGTGCCAA
CCGCAATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGGAGTGGAGATGACTGCAGTGAGAACATTGATGATTGTGCCTTCGCCTCCTG
TACTCCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTCTCTTGCATGTGCCCAGAGGGGAAGGCAGGTCTCCTGTGTCATCTGGATGA
TGCATGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGTGACACCAACCCCCTAAATGGGCAATATATTTGCACCTGCCCACAAGGCTA
CAAAGGGGCTGACTGCACAGAAGATGTGGATGAATGTGCCATGGCCAATAGCAATCCTTGTGAGCATGCAGGAAAATGTGTGAACACGGA
TGGCGCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGACCTCGTTGTGAGATGGACATCAATGAGTGCCATTCAGACCCCTGCCAGAA
TGATGCTACCTGTCTGGATAAGATTGGAGGCTTCACATGTCTGTGCATGCCAGGTTTCAAAGGTGTGCATTGTGAATTAGAAATAAATGA
ATGTCAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTGGATAAAGTCAATCGTTTCCAGTGCCTGTGTCCTCCTGGTTTCACTGGGCC
AGTTTGCCAGATTGATATTGATGACTGTTCCAGTACTCCGTGTCTGAATGGGGCAAAGTGTATCGATCACCCGAATGGCTATGAATGCCA
GTGTGCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAACATTGACAACTGTGACCCCGATCCTTGCCACCATGGTCAGTGTCAGGATGG
TATTGATTCCTACACCTGCATCTGCAATCCCGGGTACATGGGCGCCATCTGCAGTGACCAGATTGATGAATGTTACAGCAGCCCTTGCCT
GAACGATGGTCGCTGCATTGACCTGGTCAATGGCTACCAGTGCAACTGCCAGCCAGGCACGTCAGGGGTTAATTGTGAAATTAATTTTGA
TGACTGTGCAAGTAACCCTTGTATCCATGGAATCTGTATGGATGGCATTAATCGCTACAGTTGTGTCTGCTCACCAGGATTCACAGGGCA
GAGATGTAACATTGACATTGATGAGTGTGCCTCCAATCCCTGTCGCAAGGGTGCAACATGTATCAACGGTGTGAATGGTTTCCGCTGTAT
ATGCCCCGAGGGACCCCATCACCCCAGCTGCTACTCACAGGTGAACGAATGCCTGAGCAATCCCTGCATCCATGGAAACTGTACTGGAGG
TCTCAGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTTGGCATCAACTGTGAAGTGGACAAAAATGAATGCCTTTCGAATCCATGCCA
GAATGGAGGAACTTGTGACAATCTGGTGAATGGATACAGGTGTACTTGCAAGAAGGGCTTTAAAGATATCATCATGAGACCCAGCTGTGC
TCCTGGATGGTTTTACCACAAGTCCAATTGCTATGGTTACTTCAGGAAGCTGAGGAACTGGTCTGATGCCGAGGTAAGAAACTTGCTGCC
TGCTTGGCCTGGCCTTTCTAGAGCAAAGGACCAGCCAGAGCCCCAGATCTCATTTGATTCAGGATCAAGTGTCCTTCCTGGGCACTATGA
AGAGAAGCCCCTTTGGCTGGTGAAATGGAGAGAAGAGGGTTGTGTGTTCAACTCATTCAATTCTGTAAGCATTGCTGAAGCAGGTGCTGT
ATGCCAGACCCTAGATGGGCTACAAGCACATACGGATACATAGGAAAGAGCCCCTACCCTCAGCAAGCTCACTGTCAGTAAAGGAGACAG
AAATACATCAATCAAAGGAGGAAGAGAAGATGAGGAATTCACAGAAAGGATAATGGAGTTTCTGTACAAGATTTACCAGAAAGAGAGTGG
TGTGTAGACATGCCTGGAGCAGACACCTTGGAGCCGCTGACAGAAGGTGAAGCAGTCCAAGAAAATGTGGAAACTTTTCCGCTGCTCTAC
ACAGTCCACAAACCTGTCCATTTTATTTCGTTGAAGCTTTGTCTGAGAGATAACCAAATAGACAGTCAAAGTAAGTTATCTCAGCCACAT
ATGGGGAGTGGATGCTGCTGAATTGTGATTAATTGGGGGAGCCATATAGGTACATTTGGCATGATCTGGGCCTATGCGGTCTTACAATCC
CTGTATAAAACTAGACAATGAAAAACAGAAAACAAAACAAACAAACAAAAAAACAAGAACGAAGCACCTACCACATGCCAGCTACTGAGG
CTATGAAGGTATTCTCCCGCCTTAGAAAGCCCAGGATTAATGCAGGATTGCGACATTTAAACAGAACATTTCCATACAGCATGAGTATAA
ATGACTTTCCCAAGTTTACACTGAGAGTAACTGACACAGCAACCCCAGCAAAGTCTGAGCTGAGTCCTGAATAATTGTATAAAAAGGGGA
GAGAAACAGAGTGAAGAAAGGGTTTCCCAGACTCTGTCCCAGGAAAGAAAATGAGCTCGTGGAGAGGAATAGACTTTCTCTATGAAAACA
GAGGGAACAAAGAGGAAGATGTCTGGGAACCGAGGAGTAATAGAGACCTGAGTTTACATCACTACTCTGCCACTCCCTAGGTACCTCCCT
TTACCTGTTTCCCTACTGGAAAGTGGGATAATACTTTTTACCTCATGGACTTGTCAGGAGGATTCATTAAAACGACTCGCATAAAGCCTA
TGCCACATGGTAGATGCCAATTCAGGGTCTCAAGAAAGAACAGCCCACAGGATTGACACTGAACCTTAACAAAGTTAACAGGACCAAGGT
GCAGAGAGGGTGCTAGGACAGCGAAGCCAAAGAGGACCCCTCAAACCCAACAAGAGCTGTGCGGCTCCCTGATTCCTCGCCAGTGTTGCT
ACCGCCCTTGGCTCTTCTTGCATGGCTGGCTCTTGAGACCCCTGGAAGCTGATGGAGGCAACGTGAGAAGCACATGGACATCCGACCTTG
AGCTTGAGAGGCAGAGGCCTGAGTTCTAGTTACAGCCCCAGCAGTACCAGTTGTGTGGACTGGGAGGGAGGCTATCACGTACATACTTCA
AGCCTCCAAACCTGTTTCCCCTTCTGACACAGGATCTTCTGTGGCTGGTATAGAGTGGGCACTCAATAAATGCTGTCTGGTCGTCTGGCT
GGCATGCCTCATGGGCCTGAGAATTGAATAGAATTACAGTGATAGAAGCATGCTGGTATTGTAAGTGGTTTGTAAGTGTGAGGACTAAAT
TATTATTAAATAGTAATCACATCTAATCTTGGATAAATTAGTAAAAGCAAGAATGGGAGCAGTAAAAACCTAAGCAACCCGAACTAAAAT


Top

FusionGenePPI for NOTCH2_REG4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NOTCH2CNTN1, GSK3B, JAG1, DLL1, RBPJ, MAML1, JAG2, CRKL, MYOC, SPEN, NDUFV2, NDUFV1, SEC24C, PCMT1, PSMB1, TJP1, SIN3A, PLAUR, NOTCH1, SMAD1, EGFL7, ANKRD28, LATS2, ASB14, ANKRD44, RABGGTB, ZFP41, EEF2, MLLT4, ATP2A2, CDC42, MSN, RDX, PDIA6, CST6, EPSTI1, FAM84B, IL13RA2, IL24, ITIH5, KLK5, MTA3, PSMC3IP, ST14, TMEM17, FBXL17, CDH1, VASN, LRRIQ1, AGRPREG4ATE1, HTRA1, UBAC1, KLHL26, SIRT3, RNF123


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NOTCH2_REG4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NOTCH2_REG4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNOTCH2C0917715Hajdu-Cheney Syndrome2CTD_human;ORPHANET
HgeneNOTCH2C0004114Astrocytoma1CTD_human
HgeneNOTCH2C0007873Uterine Cervical Neoplasm1CTD_human
HgeneNOTCH2C0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
HgeneNOTCH2C0017636Glioblastoma1CTD_human
HgeneNOTCH2C0024121Lung Neoplasms1CTD_human
HgeneNOTCH2C0206663Neuroectodermal Tumor, Primitive1CTD_human
HgeneNOTCH2C0279626Squamous cell carcinoma of esophagus1CTD_human
HgeneNOTCH2C1458155Mammary Neoplasms1CTD_human
HgeneNOTCH2C1857761Alagille Syndrome 21ORPHANET;UNIPROT
TgeneREG4C0038356Stomach Neoplasms1CTD_human