FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2460

FusionGeneSummary for ARHGAP42_PGR

check button Fusion gene summary
Fusion gene informationFusion gene name: ARHGAP42_PGR
Fusion gene ID: 2460
HgeneTgene
Gene symbol

ARHGAP42

PGR

Gene ID

143872

5241

Gene nameRho GTPase activating protein 42progesterone receptor
SynonymsAD031|GRAF3|TMEM133NR3C3|PR
Cytomap

11q22.1

11q22.1

Type of geneprotein-codingprotein-coding
Descriptionrho GTPase-activating protein 42rho-type GTPase-activating protein 42transmembrane protein 133progesterone receptornuclear receptor subfamily 3 group C member 3
Modification date2018052320180520
UniProtAcc

A6NI28

P06401

Ensembl transtripts involved in fusion geneENST00000524892, ENST00000298815, 
ENST00000534060, 
ENST00000325455, 
ENST00000534013, ENST00000263463, 
Fusion gene scores* DoF score7 X 4 X 6=1683 X 2 X 3=18
# samples 73
** MAII scorelog2(7/168*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ARHGAP42 [Title/Abstract] AND PGR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARHGAP42

GO:0090630

activation of GTPase activity

24335996

TgenePGR

GO:0045944

positive regulation of transcription by RNA polymerase II

17785366


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A1-A0SJ-01AARHGAP42chr11

100558563

+PGRchr11

100933483

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000524892ENST00000325455ARHGAP42chr11

100558563

+PGRchr11

100933483

-
In-frameENST00000524892ENST00000534013ARHGAP42chr11

100558563

+PGRchr11

100933483

-
5CDS-intronENST00000524892ENST00000263463ARHGAP42chr11

100558563

+PGRchr11

100933483

-
In-frameENST00000298815ENST00000325455ARHGAP42chr11

100558563

+PGRchr11

100933483

-
In-frameENST00000298815ENST00000534013ARHGAP42chr11

100558563

+PGRchr11

100933483

-
5CDS-intronENST00000298815ENST00000263463ARHGAP42chr11

100558563

+PGRchr11

100933483

-
intron-3CDSENST00000534060ENST00000325455ARHGAP42chr11

100558563

+PGRchr11

100933483

-
intron-3CDSENST00000534060ENST00000534013ARHGAP42chr11

100558563

+PGRchr11

100933483

-
intron-intronENST00000534060ENST00000263463ARHGAP42chr11

100558563

+PGRchr11

100933483

-

Top

FusionProtFeatures for ARHGAP42_PGR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARHGAP42

A6NI28

PGR

P06401

May influence blood pressure by functioning as a GTPase-activating protein for RHOA in vascular smooth muscle.{ECO:0000269|PubMed:24335996}. The steroid hormones and their receptors are involved inthe regulation of eukaryotic gene expression and affect cellularproliferation and differentiation in target tissues. Depending onthe isoform, progesterone receptor functions as transcriptionalactivator or repressor. {ECO:0000269|PubMed:10757795,ECO:0000269|PubMed:1587864, ECO:0000269|PubMed:9407067,ECO:0000305}. Isoform A: Ligand-dependent transdominant repressor ofsteroid hormone receptor transcriptional activity includingrepression of its isoform B, MR and ER. Transrepressional activitymay involve recruitment of corepressor NCOR2.{ECO:0000269|PubMed:7969170, ECO:0000269|PubMed:8180103,ECO:0000269|PubMed:8264658, ECO:0000305,ECO:0000305|PubMed:10757795}. Isoform B: Transcriptional activator of severalprogesteron-dependent promoters in a variety of cell types.Involved in activation of SRC-dependent MAPK signaling on hormonestimulation. {ECO:0000269|PubMed:7969170}. Isoform 4: Increases mitochondrial membrane potentialand cellular respiration upon stimulation by progesterone.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePGRchr11:100558563chr11:100933483ENST00000534013-28567_63941340DNA bindingNuclear receptor
TgenePGRchr11:100558563chr11:100933483ENST00000325455-28679_913635934DomainNR LBD
TgenePGRchr11:100558563chr11:100933483ENST00000534013-28679_91341340DomainNR LBD
TgenePGRchr11:100558563chr11:100933483ENST00000534013-28115_11941340MotifLXXL motif 2
TgenePGRchr11:100558563chr11:100933483ENST00000534013-28183_18741340MotifNuclear localization signal
TgenePGRchr11:100558563chr11:100933483ENST00000534013-2855_5941340MotifLXXL motif 1
TgenePGRchr11:100558563chr11:100933483ENST00000325455-28687_933635934RegionAF2%3B mediates transcriptional activation
TgenePGRchr11:100558563chr11:100933483ENST00000534013-28165_30541340RegionMediates transcriptional transrepression (in isoform A)
TgenePGRchr11:100558563chr11:100933483ENST00000534013-28456_54641340RegionAF1%3B mediates transcriptional activation
TgenePGRchr11:100558563chr11:100933483ENST00000534013-28687_93341340RegionAF2%3B mediates transcriptional activation
TgenePGRchr11:100558563chr11:100933483ENST00000534013-28567_58741340Zinc fingerNR C4-type
TgenePGRchr11:100558563chr11:100933483ENST00000534013-28603_62741340Zinc fingerNR C4-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARHGAP42chr11:100558563chr11:100933483ENST00000298815+124225_26151875Coiled coilOntology_term=ECO:0000255
HgeneARHGAP42chr11:100558563chr11:100933483ENST00000298815+124619_76251875Compositional biasNote=Ser-rich
HgeneARHGAP42chr11:100558563chr11:100933483ENST00000298815+124265_37451875DomainPH
HgeneARHGAP42chr11:100558563chr11:100933483ENST00000298815+124376_57251875DomainRho-GAP
HgeneARHGAP42chr11:100558563chr11:100933483ENST00000298815+1247_26251875DomainNote=BAR
HgeneARHGAP42chr11:100558563chr11:100933483ENST00000298815+124816_87451875DomainSH3
TgenePGRchr11:100558563chr11:100933483ENST00000325455-28567_639635934DNA bindingNuclear receptor
TgenePGRchr11:100558563chr11:100933483ENST00000325455-28115_119635934MotifLXXL motif 2
TgenePGRchr11:100558563chr11:100933483ENST00000325455-28183_187635934MotifNuclear localization signal
TgenePGRchr11:100558563chr11:100933483ENST00000325455-2855_59635934MotifLXXL motif 1
TgenePGRchr11:100558563chr11:100933483ENST00000325455-28165_305635934RegionMediates transcriptional transrepression (in isoform A)
TgenePGRchr11:100558563chr11:100933483ENST00000325455-281_566635934RegionNote=Modulating%2C Pro-Rich
TgenePGRchr11:100558563chr11:100933483ENST00000325455-28456_546635934RegionAF1%3B mediates transcriptional activation
TgenePGRchr11:100558563chr11:100933483ENST00000534013-281_56641340RegionNote=Modulating%2C Pro-Rich
TgenePGRchr11:100558563chr11:100933483ENST00000325455-28567_587635934Zinc fingerNR C4-type
TgenePGRchr11:100558563chr11:100933483ENST00000325455-28603_627635934Zinc fingerNR C4-type


Top

FusionGeneSequence for ARHGAP42_PGR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARHGAP42_ENST00000524892_chr11_100558563_+_PGR_ENST00000325455_chr11_100933483_-_350aa
MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRSRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFT
FSPGQDIQLIPPLINLLMSIEPDVITAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQTSWMSLMVFGLG
WRSYKHVSGQMLTFAPDLILNEQRMKESSFTSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIK

>In-frame_ARHGAP42_ENST00000524892_chr11_100558563_+_PGR_ENST00000534013_chr11_100933483_-_350aa
MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRSRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFT
FSPGQDIQLIPPLINLLMSIEPDVITAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQTSWMSLMVFGLG
WRSYKHVSGQMLTFAPDLILNEQRMKESSFTSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIK

>In-frame_ARHGAP42_ENST00000298815_chr11_100558563_+_PGR_ENST00000325455_chr11_100933483_-_350aa
MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRSRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFT
FSPGQDIQLIPPLINLLMSIEPDVITAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQTSWMSLMVFGLG
WRSYKHVSGQMLTFAPDLILNEQRMKESSFTSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIK

>In-frame_ARHGAP42_ENST00000298815_chr11_100558563_+_PGR_ENST00000534013_chr11_100933483_-_350aa
MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRSRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFT
FSPGQDIQLIPPLINLLMSIEPDVITAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQTSWMSLMVFGLG
WRSYKHVSGQMLTFAPDLILNEQRMKESSFTSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARHGAP42_ENST00000524892_chr11_100558563_+_PGR_ENST00000325455_chr11_100933483_-_1050nt
ATGGGGCTGCCCACTCTGGAGTTCAGCGATTCCTACTTGGACAGCCCAGATTTCAGGGAGCGCTTGCAGTGTCACGAGATTGAGCTGGAG
CGAACCAACAAGTTCATCAAGGAGCTCATTAAGGACGGCTCTCTGCTCATTGGGGCGTTGAGGAGTCGAAAATTTAAAAAGTTCAATAAA
GTCAGAGTTGTGAGAGCACTGGATGCTGTTGCTCTCCCACAGCCAGTGGGCGTTCCAAATGAAAGCCAAGCCCTAAGCCAGAGATTCACT
TTTTCACCAGGTCAAGACATACAGTTGATTCCACCACTGATCAACCTGTTAATGAGCATTGAACCAGATGTGATCTATGCAGGACATGAC
AACACAAAACCTGACACCTCCAGTTCTTTGCTGACAAGTCTTAATCAACTAGGCGAGAGGCAACTTCTTTCAGTAGTCAAGTGGTCTAAA
TCATTGCCAGGTTTTCGAAACTTACATATTGATGACCAGATAACTCTCATTCAGTATTCTTGGATGAGCTTAATGGTGTTTGGTCTAGGA
TGGAGATCCTACAAACACGTCAGTGGGCAGATGCTGTATTTTGCACCTGATCTAATACTAAATGAACAGCGGATGAAAGAATCATCATTC
TATTCATTATGCCTTACCATGTGGCAGATCCCACAGGAGTTTGTCAAGCTTCAAGTTAGCCAAGAAGAGTTCCTCTGTATGAAAGTATTG
TTACTTCTTAATACAATTCCTTTGGAAGGGCTACGAAGTCAAACCCAGTTTGAGGAGATGAGGTCAAGCTACATTAGAGAGCTCATCAAG
GCAATTGGTTTGAGGCAAAAAGGAGTTGTGTCGAGCTCACAGCGTTTCTATCAACTTACAAAACTTCTTGATAACTTGCATGATCTTGTC
AAACAACTTCATCTGTACTGCTTGAATACATTTATCCAGTCCCGGGCACTGAGTGTTGAATTTCCAGAAATGATGTCTGAAGTTATTGCT

>In-frame_ARHGAP42_ENST00000524892_chr11_100558563_+_PGR_ENST00000534013_chr11_100933483_-_1050nt
ATGGGGCTGCCCACTCTGGAGTTCAGCGATTCCTACTTGGACAGCCCAGATTTCAGGGAGCGCTTGCAGTGTCACGAGATTGAGCTGGAG
CGAACCAACAAGTTCATCAAGGAGCTCATTAAGGACGGCTCTCTGCTCATTGGGGCGTTGAGGAGTCGAAAATTTAAAAAGTTCAATAAA
GTCAGAGTTGTGAGAGCACTGGATGCTGTTGCTCTCCCACAGCCAGTGGGCGTTCCAAATGAAAGCCAAGCCCTAAGCCAGAGATTCACT
TTTTCACCAGGTCAAGACATACAGTTGATTCCACCACTGATCAACCTGTTAATGAGCATTGAACCAGATGTGATCTATGCAGGACATGAC
AACACAAAACCTGACACCTCCAGTTCTTTGCTGACAAGTCTTAATCAACTAGGCGAGAGGCAACTTCTTTCAGTAGTCAAGTGGTCTAAA
TCATTGCCAGGTTTTCGAAACTTACATATTGATGACCAGATAACTCTCATTCAGTATTCTTGGATGAGCTTAATGGTGTTTGGTCTAGGA
TGGAGATCCTACAAACACGTCAGTGGGCAGATGCTGTATTTTGCACCTGATCTAATACTAAATGAACAGCGGATGAAAGAATCATCATTC
TATTCATTATGCCTTACCATGTGGCAGATCCCACAGGAGTTTGTCAAGCTTCAAGTTAGCCAAGAAGAGTTCCTCTGTATGAAAGTATTG
TTACTTCTTAATACAATTCCTTTGGAAGGGCTACGAAGTCAAACCCAGTTTGAGGAGATGAGGTCAAGCTACATTAGAGAGCTCATCAAG
GCAATTGGTTTGAGGCAAAAAGGAGTTGTGTCGAGCTCACAGCGTTTCTATCAACTTACAAAACTTCTTGATAACTTGCATGATCTTGTC
AAACAACTTCATCTGTACTGCTTGAATACATTTATCCAGTCCCGGGCACTGAGTGTTGAATTTCCAGAAATGATGTCTGAAGTTATTGCT

>In-frame_ARHGAP42_ENST00000298815_chr11_100558563_+_PGR_ENST00000325455_chr11_100933483_-_1050nt
ATGGGGCTGCCCACTCTGGAGTTCAGCGATTCCTACTTGGACAGCCCAGATTTCAGGGAGCGCTTGCAGTGTCACGAGATTGAGCTGGAG
CGAACCAACAAGTTCATCAAGGAGCTCATTAAGGACGGCTCTCTGCTCATTGGGGCGTTGAGGAGTCGAAAATTTAAAAAGTTCAATAAA
GTCAGAGTTGTGAGAGCACTGGATGCTGTTGCTCTCCCACAGCCAGTGGGCGTTCCAAATGAAAGCCAAGCCCTAAGCCAGAGATTCACT
TTTTCACCAGGTCAAGACATACAGTTGATTCCACCACTGATCAACCTGTTAATGAGCATTGAACCAGATGTGATCTATGCAGGACATGAC
AACACAAAACCTGACACCTCCAGTTCTTTGCTGACAAGTCTTAATCAACTAGGCGAGAGGCAACTTCTTTCAGTAGTCAAGTGGTCTAAA
TCATTGCCAGGTTTTCGAAACTTACATATTGATGACCAGATAACTCTCATTCAGTATTCTTGGATGAGCTTAATGGTGTTTGGTCTAGGA
TGGAGATCCTACAAACACGTCAGTGGGCAGATGCTGTATTTTGCACCTGATCTAATACTAAATGAACAGCGGATGAAAGAATCATCATTC
TATTCATTATGCCTTACCATGTGGCAGATCCCACAGGAGTTTGTCAAGCTTCAAGTTAGCCAAGAAGAGTTCCTCTGTATGAAAGTATTG
TTACTTCTTAATACAATTCCTTTGGAAGGGCTACGAAGTCAAACCCAGTTTGAGGAGATGAGGTCAAGCTACATTAGAGAGCTCATCAAG
GCAATTGGTTTGAGGCAAAAAGGAGTTGTGTCGAGCTCACAGCGTTTCTATCAACTTACAAAACTTCTTGATAACTTGCATGATCTTGTC
AAACAACTTCATCTGTACTGCTTGAATACATTTATCCAGTCCCGGGCACTGAGTGTTGAATTTCCAGAAATGATGTCTGAAGTTATTGCT

>In-frame_ARHGAP42_ENST00000298815_chr11_100558563_+_PGR_ENST00000534013_chr11_100933483_-_1050nt
ATGGGGCTGCCCACTCTGGAGTTCAGCGATTCCTACTTGGACAGCCCAGATTTCAGGGAGCGCTTGCAGTGTCACGAGATTGAGCTGGAG
CGAACCAACAAGTTCATCAAGGAGCTCATTAAGGACGGCTCTCTGCTCATTGGGGCGTTGAGGAGTCGAAAATTTAAAAAGTTCAATAAA
GTCAGAGTTGTGAGAGCACTGGATGCTGTTGCTCTCCCACAGCCAGTGGGCGTTCCAAATGAAAGCCAAGCCCTAAGCCAGAGATTCACT
TTTTCACCAGGTCAAGACATACAGTTGATTCCACCACTGATCAACCTGTTAATGAGCATTGAACCAGATGTGATCTATGCAGGACATGAC
AACACAAAACCTGACACCTCCAGTTCTTTGCTGACAAGTCTTAATCAACTAGGCGAGAGGCAACTTCTTTCAGTAGTCAAGTGGTCTAAA
TCATTGCCAGGTTTTCGAAACTTACATATTGATGACCAGATAACTCTCATTCAGTATTCTTGGATGAGCTTAATGGTGTTTGGTCTAGGA
TGGAGATCCTACAAACACGTCAGTGGGCAGATGCTGTATTTTGCACCTGATCTAATACTAAATGAACAGCGGATGAAAGAATCATCATTC
TATTCATTATGCCTTACCATGTGGCAGATCCCACAGGAGTTTGTCAAGCTTCAAGTTAGCCAAGAAGAGTTCCTCTGTATGAAAGTATTG
TTACTTCTTAATACAATTCCTTTGGAAGGGCTACGAAGTCAAACCCAGTTTGAGGAGATGAGGTCAAGCTACATTAGAGAGCTCATCAAG
GCAATTGGTTTGAGGCAAAAAGGAGTTGTGTCGAGCTCACAGCGTTTCTATCAACTTACAAAACTTCTTGATAACTTGCATGATCTTGTC
AAACAACTTCATCTGTACTGCTTGAATACATTTATCCAGTCCCGGGCACTGAGTGTTGAATTTCCAGAAATGATGTCTGAAGTTATTGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARHGAP42_ENST00000524892_chr11_100558563_+_PGR_ENST00000325455_chr11_100933483_-_10568nt
CGGCCGCCGCTGGCAGCGCCTGTGCCATGGGGCTGCCCACTCTGGAGTTCAGCGATTCCTACTTGGACAGCCCAGATTTCAGGGAGCGCT
TGCAGTGTCACGAGATTGAGCTGGAGCGAACCAACAAGTTCATCAAGGAGCTCATTAAGGACGGCTCTCTGCTCATTGGGGCGTTGAGGA
GTCGAAAATTTAAAAAGTTCAATAAAGTCAGAGTTGTGAGAGCACTGGATGCTGTTGCTCTCCCACAGCCAGTGGGCGTTCCAAATGAAA
GCCAAGCCCTAAGCCAGAGATTCACTTTTTCACCAGGTCAAGACATACAGTTGATTCCACCACTGATCAACCTGTTAATGAGCATTGAAC
CAGATGTGATCTATGCAGGACATGACAACACAAAACCTGACACCTCCAGTTCTTTGCTGACAAGTCTTAATCAACTAGGCGAGAGGCAAC
TTCTTTCAGTAGTCAAGTGGTCTAAATCATTGCCAGGTTTTCGAAACTTACATATTGATGACCAGATAACTCTCATTCAGTATTCTTGGA
TGAGCTTAATGGTGTTTGGTCTAGGATGGAGATCCTACAAACACGTCAGTGGGCAGATGCTGTATTTTGCACCTGATCTAATACTAAATG
AACAGCGGATGAAAGAATCATCATTCTATTCATTATGCCTTACCATGTGGCAGATCCCACAGGAGTTTGTCAAGCTTCAAGTTAGCCAAG
AAGAGTTCCTCTGTATGAAAGTATTGTTACTTCTTAATACAATTCCTTTGGAAGGGCTACGAAGTCAAACCCAGTTTGAGGAGATGAGGT
CAAGCTACATTAGAGAGCTCATCAAGGCAATTGGTTTGAGGCAAAAAGGAGTTGTGTCGAGCTCACAGCGTTTCTATCAACTTACAAAAC
TTCTTGATAACTTGCATGATCTTGTCAAACAACTTCATCTGTACTGCTTGAATACATTTATCCAGTCCCGGGCACTGAGTGTTGAATTTC
CAGAAATGATGTCTGAAGTTATTGCTGCACAATTACCCAAGATATTGGCAGGGATGGTGAAACCCCTTCTCTTTCATAAAAAGTGAATGT
CATCTTTTTCTTTTAAAGAATTAAATTTTGTGGTATGTCTTTTTGTTTTGGTCAGGATTATGAGGTCTTGAGTTTTTATAATGTTCTTCT
GAAAGCCTTACATTTATAACATCATAGTGTGTAAATTTAAAAGAAAAATTGTGAGGTTCTAATTATTTTCTTTTATAAAGTATAATTAGA
ATGTTTAACTGTTTTGTTTACCCATATTTTCTTGAAGAATTTACAAGATTGAAAAAGTACTAAAATTGTTAAAGTAAACTATCTTATCCA
TATTATTTCATACCATGTAGGTGAGGATTTTTAACTTTTGCATCTAACAAATCATCGACTTAAGAGAAAAAATCTTACATGTAATAACAC
AAAGCTATTATATGTTATTTCTAGGTAACTCCCTTTGTGTCAATTATATTTCCAAAAATGAACCTTTAAAATGGTATGCAAAATTTTGTC
TATATATATTTGTGTGAGGAGGAAATTCATAACTTTCCTCAGATTTTCAAAAGTATTTTTAATGCAAAAAATGTAGAAAGAGTTTAAAAC
CACTAAAATAGATTGATGTTCTTCAAACTAGGCAAAACAACTCATATGTTAAGACCATTTTCCAGATTGGAAACACAAATCTCTTAGGAA
GTTAATAAGTAGATTCATATCATTATGCAAATAGTATTGTGGGTTTTGTAGGTTTTTAAAATAACCTTTTTTGGGGAGAGAATTGTCCTC
TAATGAGGTATTGCGAGTGGACATAAGAAATCAGAAGATTATGGCCTAACTGTACTCCTTACCAACTGTGGCATGCTGAAAGTTAGTCAC
TCTTACTGATTCTCAATTCTCTCACCTTTGAAAGTAGTAAAATATCTTTCCTGCCAATTGCTCCTTTGGGTCAGAGCTTATTAACATCTT
TTCAAATCAAAGGAAAGAAGAAAGGGAGAGGAGGAGGAGGGAGGTATCAATTCACATACCTTTCTCCTCTTTATCCTCCACTATCATGAA
TTCATATTATGTTTCAGCCATGCAAATCTTTTTACCATGAAATTTCTTCCAGAATTTTCCCCCTTTGACACAAATTCCATGCATGTTTCA
ACCTTCGAGACTCAGCCAAATGTCATTTCTGTAAAATCTTCCCTGAGTCTTCCAAGCAGTAATTTGCCTTCTCCTAGAGTTTACCTGCCA
TTTTGTGCACATTTGAGTTACAGTAGCATGTTATTTTACAATTGTGACTCTCCTGGGAGTCTGGGAGCCATATAAAGTGGTCAATAGTGT
TTGCTGACTGAGAGTTGAATGACATTTTCTCTCTGTCTTGGTATTACTGTAGATTTCGATCATTCTTTGGTTACATTTCTGCATATTTCT
GTACCCATGACTTTATCACTTTCTTCTCCCATGCTTTATCTCCATCAATTATCTTCATTACTTTTAAATTTTCCACCTTTGCTTCCTACT
TTGTGAGATCTCTCCCTTTACTGACTATAACATAGAAGAATAGAAGTGTATTTTATGTGTCTTAAGGACAATACTTTAGATTCCTTGTTC
TAAGTTTTTAAACTGAATGAATGGAATATTATTTCTCTCCCTAAGCAAAATTCCACAAAACAATTATTTCTTATGTTTATGTAGCCTTAA
ATTGTTTTGTACTGTAAACCTCAGCATAAAAACTTTCTTCATTTCTAATTTCATTCAACAAATATTGATTGAATACCTGGTATTAGCACA
AGAAAAATGTGCTAATAAGCCTTATGAGAATTTGGAGCTGAAGAAAGACATATAACTCAGGAAAGTTACAGTCCAGTAGTAGGTATAAAT
TACAGTGCCTGATAAATAGGCATTTTAATATTTGTACACTCAACGTATACTAGGTAGGTGCAAAACATTTACATATAATTTTACTGATAC
CCATGCAGCACAAAGGTACTAACTTTAAATATTAAATAACACCTTTATGTGTCAGTAATTCATTTGCATTAAATCTTATTGAAAAGGCTT
TCAATATATTTTCCCCACAAATGTCATCCCAAGAAAAAAGTATTTTTAACATCTCCCAAATATAATAGTTACAGGAAATCTACCTCTGTG
AGAGTGACACCTCTCAGAATGAACTGTGTGACACAAGAAAATGAATGTAGGTCTATCCAAAAAAAACCCCAAGAAACAAAAACAATATTA
TTAGCCCTTTATGCTTAAGTGATGGACTCAGGGAACAGTTGATGTTGTGATCATTTTATTATCTGATTCTTGTTACTTTGAATTAAACCA
ATATTTTGATGATATAAATCATTTCCACCAGCATATATTTAATTTCCATAATAACTTTAAAATTTTCTAATTTCACTCAACTATGAGGGA
ATAGAATGTGGTGGCCACAGGTTTGGCTTTTGTTAAAATGTTTGATATCTTCGATGTTGATCTCTGTCTGCAATGTAGATGTCTAAACAC
TAGGATTTAATATTTAAGGCTAAGCTTTAAAAATAAAGTACCTTTTTAAAAAGAATATGGCTTCACCAAATGGAAAATACCTAATTTCTA
AATCTTTTTCTCTACAAAGTCCTATCTACTAATGTCTCCATTACTATTTAGTCATCATAACCATTATCTTCATTTTACATGTCGTGTTCT
TTCTGGTAGCTCTAAAATGACACTAAATCATAAGAAGACAGGTTACATATCAGGAAATACTTGAAGGTTACTGAAATAGATTCTTGAGTT
AATGAAAATATTTTCTGTAAAAAGGTTTGAAAAGCCATTTGAGTCTAAAGCATTATACCTCCATTATCAGTAGTTATGTGACAATTGTGT
GTGTGTTTAATGTTTAAAGATGTGGCACTTTTTAATAAGGCAATGCTATGCTATTTTTTCCCATTTAACATTAAGATAATTTATTGCTAT
ACAGATGATATGGAAATATGATGAACAATATTTTTTTTGCCAAAACTATGCCTTGTAAGTAGCCATGGAATGTCAACCTGTAACTTAAAT
TATCCACAGATAGTCATGTGTTTGATGATGGGCACTGTGGAGATAACTGACATAGGACTGTGCCCCCCTTCTCTGCCACTTACTAGCTGG
ATGAGATTAAGCAAGTCATTTAACTGCTCTGATTAAACCTGCCTTTCCCAAGTGCTTTGTAATGAATAGAAATGGAAACCAAAAAAAACG
TATACAGGCCTTCAGAAATAGTAATTGCTACTATTTTGTTTTCATTAAGCCATAGTTCTGGCTATAATTTTATCAAACTCACCAGCTATA
TTCTACAGTGAAAGCAGGATTCTAGAAAGTCTCACTGTTTTATTTATGTCACCATGTGCTATGATATATTTGGTTGAATTCATTTGAAAT
TAGGGCTGGAAGTATTCAAGTAATTTCTTCTGCTGAAAAAATACAGTGTTTTGAGTTTAGGGCCTGTTTTATCAAAGTTCTAAAGAGCCT
ATCACTCTTCCATTGTAGACATTTTAAAATAATGACACTGATTTTAACATTTTTAAGTGTCTTTTTAGAACAGAGAGCCTGACTAGAACA
CAGCCCCTCCAAAAACCCATGCTCAAATTATTTTTACTATGGCAGCAATTCCACAAAAGGGAACAATGGGTTTAGAAATTACAATGAAGT
CATCAACCCAAAAAACATCCCTATCCCTAAGAAGGTTATGATATAAAATGCCCACAAGAAATCTATGTCTGCTTTAATCTGTCTTTTATT
GCTTTGGAAGGATGGCTATTACATTTTTAGTTTTTGCTGTGAATACCTGAGCAGTTTCTCTCATCCATACTTATCCTTCACACATCAGAA
GTCAGGATAGAATATGAATCATTTTAAAAACTTTTACAACTCCAGAGCCATGTGCATAAGAAGCATTCAAAACTTGCCAAAACATACATT
TTTTTTCAAATTTAAAGATACTCTATTTTTGTATTCAATAGCTCAACAACTGTGGTCCCCACTGATAAAGTGAAGTGGACAAGGAGACAA
GTAATGGCATAAGTTTGTTTTTCCCAAAGTATGCCTGTTCAATAGCCATTGGATGTGGGAAATTTCTACATCTCTTAAAATTTTACAGAA
AATACATAGCCAGATAGTCTAGCAAAAGTTCACCAAGTCCTAAATTGCTTATCCTTACTTCACTAAGTCATGAAATCATTTTAATGAAAA
GAACATCACCTAGGTTTTGTGGTTTCTTTTTTTCTTATTCATGGCTGAGTGAAAACAACAATCTCTGTTTCTCCCTAGCATCTGTGGACT
ATTTAATGTACCATTATTCCACACTCTATGGTCCTTACTAAATACAAAATTGAACAAAAAGCAGTAAAACAACTGACTCTTCACCCATAT
TATAAAATATAATCCAAGCCAGATTAGTCAACATCCATAAGATGAATCCAAGCTGAACTGGGCCTAGATTATTGAGTTCAGGTTGGATCA
CATCCCTATTTATTAATAAACTTAGGAAAGAAGGCCTTACAGACCATCAGTTAGCTGGAGCTAATAGAACCTACACTTCTAAAGTTCGGC
CTAGAATCAATGTGGCCTTAAAAGCTGAAAAGAAGCAGGAAAGAACAGTTTTCTTCAATAATTTGTCCACCCTGTCACTGGAGAAAATTT
AAGAATTTGGGGGTGTTGGTAGTAAGTTAAACACAGCAGCTGTTCATGGCAGAAATTATTCAATACATACCTTCTCTGAATATCCTATAA
CCAAAGCAAAGAAAAACACCAAGGGGTTTGTTCTCCTCCTTGGAGTTGACCTCATTCCAAGGCAGAGCTCAGGTCACAGGCACAGGGGCT
GCGCCCAAGCTTGTCCGCAGCCTTATGCAGCTGTGGAGTCTGGAAGACTGTTGCAGGACTGCTGGCCTAGTCCCAGAATGTCAGCCTCAT
TTTCGATTTACTGGCTCTTGTTGCTGTATGTCATGCTGACCTTATTGTTAAACACAGGTTTGTTTGCTTTTTTTCCACTCATGGAGACAT
GGGAGAGGCATTATTTTTAAGCTGGTTGAAAGCTTTAACCGATAAAGCATTTTTAGAGAAATGTGAATCAGGCAGCTAAGAAAGCATACT
CTGTCCATTACGGTAAAGAAAATGCACAGATTATTAACTCTGCAGTGTGGCATTAGTGTCCTGGTCAATATTCGGATAGATATGAATAAA
ATATTTAAATGGTATTGTAAATAGTTTTCAGGACATATGCTATAGCTTATTTTTATTATCTTTTGAAATTGCTCTTAATACATCAAATCC
TGATGTATTCAATTTATCAGATATAAATTATTCTAAATGAAGCCCAGTTAAATGTTTTTGTCTTGTCAGTTATATGTTAAGTTTCTGATC
TCTTTGTCTATGACGTTTACTAATCTGCATTTTTACTGTTATGAATTATTTTAGACAGCAGTGGTTTCAAGCTTTTTGCCACTAAAAATA
CCTTTTATTTTCTCCTCCCCCAGAAAAGTCTATACCTTGAAGTATCTATCCACCAAACTGTACTTCTATTAAGAAATAGTTATTGTGTTT
TCTTAATGTTTTGTTATTCAAAGACATATCAATGAAAGCTGCTGAGCAGCATGAATAACAATTATATCCACACAGATTTGATATATTTTG
TGCAGCCTTAACTTGATAGTATAAAATGTCATTGCTTTTTAAATAATAGTTAGTCAATGGACTTCTATCATAGCTTTCCTAAACTAGGTT
AAGATCCAGAGCTTTGGGGTCATAATATATTACATACAATTAAGTTATCTTTTTCTAAGGGCTTTAAAATTCATGAGAATAACCAAAAAA
GGTATGTGGAGAGTTAATACAAACATACCATATTCTTGTTGAAACAGAGATGTGGCTCTGCTTGTTCTCCATAAGGTAGAAATACTTTCC
AGAATTTGCCTAAACTAGTAAGCCCTGAATTTGCTATGATTAGGGATAGGAAGAGATTTTCACATGGCAGACTTTAGAATTCTTCACTTT
AGCCAGTAAAGTATCTCCTTTTGATCTTAGTATTCTGTGTATTTTAACTTTTCTGAGTTGTGCATGTTTATAAGAAAAATCAGCACAAAG
GGTTTAAGTTAAAGCCTTTTTACTGAAATTTGAAAGAAACAGAAGAAAATATCAAAGTTCTTTGTATTTTGAGAGGATTAAATATGATTT
ACAAAAGTTACATGGAGGGCTCTCTAAAACATTAAATTAATTATTTTTTGTTGAAAAGTCTTACTTTAGGCATCATTTTATTCCTCAGCA
ACTAGCTGTGAAGCCTTTACTGTGCTGTATGCCAGTCACTCTGCTAGATTGTGGAGATTACCAGTGTTCCCGTCTTCTCCGAGCTTAGAG
TTGGATGGGGAATAAAGACAGGTAAACAGATAGCTACAATATTGTACTGTGAATGCTTATGCTGGAGGAAGTACAGGGAACTATTGGAGC
ACCTAAGAGGAGCACCTACCTTGAATTTAGGGGTTAGCAGAGGCATCCTGAAAAAAGTCAAAGCTAAGCCACAATCTATAAGCAGTTTAG
GAATTAGCAGAACGTGCGTGGTGAGGAGATGCCAAAGGCAAGAAGAGAAGAGTATTCCAAACAGGAGGGATTCCAAAGAGAGAAGAGTAT
CCCAAACAACATTTGCACAAACCTGATGGGGAGAGAGAATGTGGGGTGGGGATGGATGATGAGACTGAAGAAGAAAGCCAGGTCTAGATA
ATCAGTGGCCTTGTACACCATGTTAAAGAGTGTAGACTTGATTCTGTTGTAAACAGGAAAGCAGCACAATTCATATGAATATTTTAGAAG
ACTCCCACTGGAATATGGAGAATAAAGTTGGAGATGACTAATCCTGGAAGCAGGGAGAACATTTTTGAGGAAGTTGCACTATTTTGGTGA
AAATGATGATCATAAACATGAAGAATTGTAGGTGATCATGACCTCCTCTCTAATTTTCCAGAAGGGTTTTGGAAGATATAACATAGGAAC
ATTGACAGGACTGACGAAAGGAGATGAAATACACCATATAAATTGTCAAACACAAGGCCAGATGTCTAATTATTTTGCTTATGTGTTGAA
ATTACAAATTTTTCATCAGGAAACCAAAAACTACAAAACTTAGTTTTCCCAAGTCCCAGAATTCTATCTGTCCAAACAATCTGTACCACT
CCACCTATATCCCTACCTTTGCATGTCTGTCCAACCTCAAAGTCCAGGTCTATACACACGGGTAAGACTAGAGCAGTTCAAGTTTCAGAA
AATGAGAAAGAGGAACTGAGTTGTGCTGAACCCATACAAAATAAACACATTCTTTGTATAGATTCTTGGAACCTCGAGAGGAATTCACCT
AACTCATAGGTATTTGATGGTATGAATCCATGGCTGGGCTCGGCTTTTAAAAAGCCTTATCTGGGATTCCTTCTATGGAACCAAGTTCCA
TCAAAGCCCATTTAAAAGCCTACATTAAAAACAAAATTCTTGCTGCATTGTATACAAATAATGATGTCATGATCAAATAATCAGATGCCA
TTATCAAGTGGAATTACAAAATGGTATACCCACTCCAAAAAAAAAAAAAAAGCTAAATTCTCAGTAGAACATTGTGACTTCATGAGCCCT
CCACAGCCTTGGAGCTGAGGAGGGAGCACTGGTGAGCAGTAGGTTGAAGAGAAAACTTGGCGCTTAATAATCTATCCATGTTTTTTCATC
TAAAAGAGCCTTCTTTTTGGATTACCTTATTCAATTTCCATCAAGGAAATTGTTAGTTCCACTAACCAGACAGCAGCTGGGAAGGCAGAA
GCTTACTGTATGTACATGGTAGCTGTGGGAAGGAGGTTTCTTTCTCCAGGTCCTCACTGGCCATACACCAGTCCCTTGTTAGTTATGCCT
GGTCATAGACCCCCGTTGCTATCATCTCATATTTAAGTCTTTGGCTTGTGAATTTATCTATTCTTTCAGCTTCAGCACTGCAGAGTGCTG
GGACTTTGCTAACTTCCATTTCTTGCTGGCTTAGCACATTCCTCATAGGCCCAGCTCTTTTCTCATCTGGCCCTGCTGTGGAGTCACCTT
GCCCCTTCAGGAGAGCCATGGCTTACCACTGCCTGCTAAGCCTCCACTCAGCTGCCACCACACTAAATCCAAGCTTCTCTAAGATGTTGC
AGACTTTACAGGCAAGCATAAAAGGCTTGATCTTCCTGGACTTCCCTTTACTTGTCTGAATCTCACCTCCTTCAACTTTCAGTCTCAGAA
TGTAGGCATTTGTCCTCTTTGCCCTACATCTTCCTTCTTCTGAATCATGAAAGCCTCTCACTTCCTCTTGCTATGTGCTGGAGGCTTCTG
TCAGGTTTTAGAATGAGTTCTCATCTAGTCCTAGTAGCTTTTGATGCTTAAGTCCACCTTTTAAGGATACCTTTGAGATTTAGACCATGT
TTTTCGCTTGAGAAAGCCCTAATCTCCAGACTTGCCTTTCTGTGGATTTCAAAGACCAACTGAGGAAGTCAAAAGCTGAATGTTGACTTT
CTTTGAACATTTCCGCTATAACAATTCCAATTCTCCTCAGAGCAATATGCCTGCCTCCAACTGACCAGGAGAAAGGTCCAGTGCCAAAGA
GAAAAACACAAAGATTAATTATTTCAGTTGAGCACATACTTTCAAAGTGGTTTGGGTATTCATATGAGGTTTTCTGTCAAGAGGGTGAGA
CTCTTCATCTATCCATGTGTGCCTGACAGTTCTCCTGGCACTGGCTGGTAACAGATGCAAAACTGTAAAAATTAAGTGATCATGTATTTT
AACGATATCATCACATACTTATTTTCTATGTAATGTTTTAAATTTCCCCTAACATACTTTGACTGTTTTGCACATGGTAGATATTCACAT
TTTTTTGTGTTGAAGTTGATGCAATCTTCAAAGTTATCTACCCCGTTGCTTATTAGTAAAACTAGTGTTAATACTTGGCAAGAGATGCAG
GGAATCTTTCTCATGACTCACGCCCTATTTAGTTATTAATGCTACTACCCTATTTTGAGTAAGTAGTAGGTCCCTAAGTACATTGTCCAG
AGTTATACTTTTAAAGATATTTAGCCCCATATACTTCTTGAATCTAAAGTCATACACCTTGCTCCTCATTTCTGAGTGGGAAAGACATTT
GAGAGTATGTTGACAATTGTTCTGAAGGTTTTTGCCAAGAAGGTGAAACTGTCCTTTCATCTGTGTATGCCTGGGGCTGGGTCCCTGGCA
GTGATGGGGTGACAATGCAAAGCTGTAAAAACTAGGTGCTAGTGGGCACCTAATATCATCATCATATACTTATTTTCAAGCTAATATGCA
AAATCCCATCTCTGTTTTTAAACTAAGTGTAGATTTCAGAGAAAATATTTTGTGGTTCACATAAGAAAACAGTCTACTCAGCTTGACAAG
TGTTTTATGTTAAATTGGCTGGTGGTTTGAAATGAATCATCTTCACATAATGTTTTCTTTAAAAATATTGTGAATTTAACTCTAATTCTT

>In-frame_ARHGAP42_ENST00000524892_chr11_100558563_+_PGR_ENST00000534013_chr11_100933483_-_1512nt
CGGCCGCCGCTGGCAGCGCCTGTGCCATGGGGCTGCCCACTCTGGAGTTCAGCGATTCCTACTTGGACAGCCCAGATTTCAGGGAGCGCT
TGCAGTGTCACGAGATTGAGCTGGAGCGAACCAACAAGTTCATCAAGGAGCTCATTAAGGACGGCTCTCTGCTCATTGGGGCGTTGAGGA
GTCGAAAATTTAAAAAGTTCAATAAAGTCAGAGTTGTGAGAGCACTGGATGCTGTTGCTCTCCCACAGCCAGTGGGCGTTCCAAATGAAA
GCCAAGCCCTAAGCCAGAGATTCACTTTTTCACCAGGTCAAGACATACAGTTGATTCCACCACTGATCAACCTGTTAATGAGCATTGAAC
CAGATGTGATCTATGCAGGACATGACAACACAAAACCTGACACCTCCAGTTCTTTGCTGACAAGTCTTAATCAACTAGGCGAGAGGCAAC
TTCTTTCAGTAGTCAAGTGGTCTAAATCATTGCCAGGTTTTCGAAACTTACATATTGATGACCAGATAACTCTCATTCAGTATTCTTGGA
TGAGCTTAATGGTGTTTGGTCTAGGATGGAGATCCTACAAACACGTCAGTGGGCAGATGCTGTATTTTGCACCTGATCTAATACTAAATG
AACAGCGGATGAAAGAATCATCATTCTATTCATTATGCCTTACCATGTGGCAGATCCCACAGGAGTTTGTCAAGCTTCAAGTTAGCCAAG
AAGAGTTCCTCTGTATGAAAGTATTGTTACTTCTTAATACAATTCCTTTGGAAGGGCTACGAAGTCAAACCCAGTTTGAGGAGATGAGGT
CAAGCTACATTAGAGAGCTCATCAAGGCAATTGGTTTGAGGCAAAAAGGAGTTGTGTCGAGCTCACAGCGTTTCTATCAACTTACAAAAC
TTCTTGATAACTTGCATGATCTTGTCAAACAACTTCATCTGTACTGCTTGAATACATTTATCCAGTCCCGGGCACTGAGTGTTGAATTTC
CAGAAATGATGTCTGAAGTTATTGCTGCACAATTACCCAAGATATTGGCAGGGATGGTGAAACCCCTTCTCTTTCATAAAAAGTGAATGT
CATCTTTTTCTTTTAAAGAATTAAATTTTGTGGTATGTCTTTTTGTTTTGGTCAGGATTATGAGGTCTTGAGTTTTTATAATGTTCTTCT
GAAAGCCTTACATTTATAACATCATAGTGTGTAAATTTAAAAGAAAAATTGTGAGGTTCTAATTATTTTCTTTTATAAAGTATAATTAGA
ATGTTTAACTGTTTTGTTTACCCATATTTTCTTGAAGAATTTACAAGATTGAAAAAGTACTAAAATTGTTAAAGTAAACTATCTTATCCA
TATTATTTCATACCATGTAGGTGAGGATTTTTAACTTTTGCATCTAACAAATCATCGACTTAAGAGAAAAAATCTTACATGTAATAACAC

>In-frame_ARHGAP42_ENST00000298815_chr11_100558563_+_PGR_ENST00000325455_chr11_100933483_-_10545nt
GCCATGGGGCTGCCCACTCTGGAGTTCAGCGATTCCTACTTGGACAGCCCAGATTTCAGGGAGCGCTTGCAGTGTCACGAGATTGAGCTG
GAGCGAACCAACAAGTTCATCAAGGAGCTCATTAAGGACGGCTCTCTGCTCATTGGGGCGTTGAGGAGTCGAAAATTTAAAAAGTTCAAT
AAAGTCAGAGTTGTGAGAGCACTGGATGCTGTTGCTCTCCCACAGCCAGTGGGCGTTCCAAATGAAAGCCAAGCCCTAAGCCAGAGATTC
ACTTTTTCACCAGGTCAAGACATACAGTTGATTCCACCACTGATCAACCTGTTAATGAGCATTGAACCAGATGTGATCTATGCAGGACAT
GACAACACAAAACCTGACACCTCCAGTTCTTTGCTGACAAGTCTTAATCAACTAGGCGAGAGGCAACTTCTTTCAGTAGTCAAGTGGTCT
AAATCATTGCCAGGTTTTCGAAACTTACATATTGATGACCAGATAACTCTCATTCAGTATTCTTGGATGAGCTTAATGGTGTTTGGTCTA
GGATGGAGATCCTACAAACACGTCAGTGGGCAGATGCTGTATTTTGCACCTGATCTAATACTAAATGAACAGCGGATGAAAGAATCATCA
TTCTATTCATTATGCCTTACCATGTGGCAGATCCCACAGGAGTTTGTCAAGCTTCAAGTTAGCCAAGAAGAGTTCCTCTGTATGAAAGTA
TTGTTACTTCTTAATACAATTCCTTTGGAAGGGCTACGAAGTCAAACCCAGTTTGAGGAGATGAGGTCAAGCTACATTAGAGAGCTCATC
AAGGCAATTGGTTTGAGGCAAAAAGGAGTTGTGTCGAGCTCACAGCGTTTCTATCAACTTACAAAACTTCTTGATAACTTGCATGATCTT
GTCAAACAACTTCATCTGTACTGCTTGAATACATTTATCCAGTCCCGGGCACTGAGTGTTGAATTTCCAGAAATGATGTCTGAAGTTATT
GCTGCACAATTACCCAAGATATTGGCAGGGATGGTGAAACCCCTTCTCTTTCATAAAAAGTGAATGTCATCTTTTTCTTTTAAAGAATTA
AATTTTGTGGTATGTCTTTTTGTTTTGGTCAGGATTATGAGGTCTTGAGTTTTTATAATGTTCTTCTGAAAGCCTTACATTTATAACATC
ATAGTGTGTAAATTTAAAAGAAAAATTGTGAGGTTCTAATTATTTTCTTTTATAAAGTATAATTAGAATGTTTAACTGTTTTGTTTACCC
ATATTTTCTTGAAGAATTTACAAGATTGAAAAAGTACTAAAATTGTTAAAGTAAACTATCTTATCCATATTATTTCATACCATGTAGGTG
AGGATTTTTAACTTTTGCATCTAACAAATCATCGACTTAAGAGAAAAAATCTTACATGTAATAACACAAAGCTATTATATGTTATTTCTA
GGTAACTCCCTTTGTGTCAATTATATTTCCAAAAATGAACCTTTAAAATGGTATGCAAAATTTTGTCTATATATATTTGTGTGAGGAGGA
AATTCATAACTTTCCTCAGATTTTCAAAAGTATTTTTAATGCAAAAAATGTAGAAAGAGTTTAAAACCACTAAAATAGATTGATGTTCTT
CAAACTAGGCAAAACAACTCATATGTTAAGACCATTTTCCAGATTGGAAACACAAATCTCTTAGGAAGTTAATAAGTAGATTCATATCAT
TATGCAAATAGTATTGTGGGTTTTGTAGGTTTTTAAAATAACCTTTTTTGGGGAGAGAATTGTCCTCTAATGAGGTATTGCGAGTGGACA
TAAGAAATCAGAAGATTATGGCCTAACTGTACTCCTTACCAACTGTGGCATGCTGAAAGTTAGTCACTCTTACTGATTCTCAATTCTCTC
ACCTTTGAAAGTAGTAAAATATCTTTCCTGCCAATTGCTCCTTTGGGTCAGAGCTTATTAACATCTTTTCAAATCAAAGGAAAGAAGAAA
GGGAGAGGAGGAGGAGGGAGGTATCAATTCACATACCTTTCTCCTCTTTATCCTCCACTATCATGAATTCATATTATGTTTCAGCCATGC
AAATCTTTTTACCATGAAATTTCTTCCAGAATTTTCCCCCTTTGACACAAATTCCATGCATGTTTCAACCTTCGAGACTCAGCCAAATGT
CATTTCTGTAAAATCTTCCCTGAGTCTTCCAAGCAGTAATTTGCCTTCTCCTAGAGTTTACCTGCCATTTTGTGCACATTTGAGTTACAG
TAGCATGTTATTTTACAATTGTGACTCTCCTGGGAGTCTGGGAGCCATATAAAGTGGTCAATAGTGTTTGCTGACTGAGAGTTGAATGAC
ATTTTCTCTCTGTCTTGGTATTACTGTAGATTTCGATCATTCTTTGGTTACATTTCTGCATATTTCTGTACCCATGACTTTATCACTTTC
TTCTCCCATGCTTTATCTCCATCAATTATCTTCATTACTTTTAAATTTTCCACCTTTGCTTCCTACTTTGTGAGATCTCTCCCTTTACTG
ACTATAACATAGAAGAATAGAAGTGTATTTTATGTGTCTTAAGGACAATACTTTAGATTCCTTGTTCTAAGTTTTTAAACTGAATGAATG
GAATATTATTTCTCTCCCTAAGCAAAATTCCACAAAACAATTATTTCTTATGTTTATGTAGCCTTAAATTGTTTTGTACTGTAAACCTCA
GCATAAAAACTTTCTTCATTTCTAATTTCATTCAACAAATATTGATTGAATACCTGGTATTAGCACAAGAAAAATGTGCTAATAAGCCTT
ATGAGAATTTGGAGCTGAAGAAAGACATATAACTCAGGAAAGTTACAGTCCAGTAGTAGGTATAAATTACAGTGCCTGATAAATAGGCAT
TTTAATATTTGTACACTCAACGTATACTAGGTAGGTGCAAAACATTTACATATAATTTTACTGATACCCATGCAGCACAAAGGTACTAAC
TTTAAATATTAAATAACACCTTTATGTGTCAGTAATTCATTTGCATTAAATCTTATTGAAAAGGCTTTCAATATATTTTCCCCACAAATG
TCATCCCAAGAAAAAAGTATTTTTAACATCTCCCAAATATAATAGTTACAGGAAATCTACCTCTGTGAGAGTGACACCTCTCAGAATGAA
CTGTGTGACACAAGAAAATGAATGTAGGTCTATCCAAAAAAAACCCCAAGAAACAAAAACAATATTATTAGCCCTTTATGCTTAAGTGAT
GGACTCAGGGAACAGTTGATGTTGTGATCATTTTATTATCTGATTCTTGTTACTTTGAATTAAACCAATATTTTGATGATATAAATCATT
TCCACCAGCATATATTTAATTTCCATAATAACTTTAAAATTTTCTAATTTCACTCAACTATGAGGGAATAGAATGTGGTGGCCACAGGTT
TGGCTTTTGTTAAAATGTTTGATATCTTCGATGTTGATCTCTGTCTGCAATGTAGATGTCTAAACACTAGGATTTAATATTTAAGGCTAA
GCTTTAAAAATAAAGTACCTTTTTAAAAAGAATATGGCTTCACCAAATGGAAAATACCTAATTTCTAAATCTTTTTCTCTACAAAGTCCT
ATCTACTAATGTCTCCATTACTATTTAGTCATCATAACCATTATCTTCATTTTACATGTCGTGTTCTTTCTGGTAGCTCTAAAATGACAC
TAAATCATAAGAAGACAGGTTACATATCAGGAAATACTTGAAGGTTACTGAAATAGATTCTTGAGTTAATGAAAATATTTTCTGTAAAAA
GGTTTGAAAAGCCATTTGAGTCTAAAGCATTATACCTCCATTATCAGTAGTTATGTGACAATTGTGTGTGTGTTTAATGTTTAAAGATGT
GGCACTTTTTAATAAGGCAATGCTATGCTATTTTTTCCCATTTAACATTAAGATAATTTATTGCTATACAGATGATATGGAAATATGATG
AACAATATTTTTTTTGCCAAAACTATGCCTTGTAAGTAGCCATGGAATGTCAACCTGTAACTTAAATTATCCACAGATAGTCATGTGTTT
GATGATGGGCACTGTGGAGATAACTGACATAGGACTGTGCCCCCCTTCTCTGCCACTTACTAGCTGGATGAGATTAAGCAAGTCATTTAA
CTGCTCTGATTAAACCTGCCTTTCCCAAGTGCTTTGTAATGAATAGAAATGGAAACCAAAAAAAACGTATACAGGCCTTCAGAAATAGTA
ATTGCTACTATTTTGTTTTCATTAAGCCATAGTTCTGGCTATAATTTTATCAAACTCACCAGCTATATTCTACAGTGAAAGCAGGATTCT
AGAAAGTCTCACTGTTTTATTTATGTCACCATGTGCTATGATATATTTGGTTGAATTCATTTGAAATTAGGGCTGGAAGTATTCAAGTAA
TTTCTTCTGCTGAAAAAATACAGTGTTTTGAGTTTAGGGCCTGTTTTATCAAAGTTCTAAAGAGCCTATCACTCTTCCATTGTAGACATT
TTAAAATAATGACACTGATTTTAACATTTTTAAGTGTCTTTTTAGAACAGAGAGCCTGACTAGAACACAGCCCCTCCAAAAACCCATGCT
CAAATTATTTTTACTATGGCAGCAATTCCACAAAAGGGAACAATGGGTTTAGAAATTACAATGAAGTCATCAACCCAAAAAACATCCCTA
TCCCTAAGAAGGTTATGATATAAAATGCCCACAAGAAATCTATGTCTGCTTTAATCTGTCTTTTATTGCTTTGGAAGGATGGCTATTACA
TTTTTAGTTTTTGCTGTGAATACCTGAGCAGTTTCTCTCATCCATACTTATCCTTCACACATCAGAAGTCAGGATAGAATATGAATCATT
TTAAAAACTTTTACAACTCCAGAGCCATGTGCATAAGAAGCATTCAAAACTTGCCAAAACATACATTTTTTTTCAAATTTAAAGATACTC
TATTTTTGTATTCAATAGCTCAACAACTGTGGTCCCCACTGATAAAGTGAAGTGGACAAGGAGACAAGTAATGGCATAAGTTTGTTTTTC
CCAAAGTATGCCTGTTCAATAGCCATTGGATGTGGGAAATTTCTACATCTCTTAAAATTTTACAGAAAATACATAGCCAGATAGTCTAGC
AAAAGTTCACCAAGTCCTAAATTGCTTATCCTTACTTCACTAAGTCATGAAATCATTTTAATGAAAAGAACATCACCTAGGTTTTGTGGT
TTCTTTTTTTCTTATTCATGGCTGAGTGAAAACAACAATCTCTGTTTCTCCCTAGCATCTGTGGACTATTTAATGTACCATTATTCCACA
CTCTATGGTCCTTACTAAATACAAAATTGAACAAAAAGCAGTAAAACAACTGACTCTTCACCCATATTATAAAATATAATCCAAGCCAGA
TTAGTCAACATCCATAAGATGAATCCAAGCTGAACTGGGCCTAGATTATTGAGTTCAGGTTGGATCACATCCCTATTTATTAATAAACTT
AGGAAAGAAGGCCTTACAGACCATCAGTTAGCTGGAGCTAATAGAACCTACACTTCTAAAGTTCGGCCTAGAATCAATGTGGCCTTAAAA
GCTGAAAAGAAGCAGGAAAGAACAGTTTTCTTCAATAATTTGTCCACCCTGTCACTGGAGAAAATTTAAGAATTTGGGGGTGTTGGTAGT
AAGTTAAACACAGCAGCTGTTCATGGCAGAAATTATTCAATACATACCTTCTCTGAATATCCTATAACCAAAGCAAAGAAAAACACCAAG
GGGTTTGTTCTCCTCCTTGGAGTTGACCTCATTCCAAGGCAGAGCTCAGGTCACAGGCACAGGGGCTGCGCCCAAGCTTGTCCGCAGCCT
TATGCAGCTGTGGAGTCTGGAAGACTGTTGCAGGACTGCTGGCCTAGTCCCAGAATGTCAGCCTCATTTTCGATTTACTGGCTCTTGTTG
CTGTATGTCATGCTGACCTTATTGTTAAACACAGGTTTGTTTGCTTTTTTTCCACTCATGGAGACATGGGAGAGGCATTATTTTTAAGCT
GGTTGAAAGCTTTAACCGATAAAGCATTTTTAGAGAAATGTGAATCAGGCAGCTAAGAAAGCATACTCTGTCCATTACGGTAAAGAAAAT
GCACAGATTATTAACTCTGCAGTGTGGCATTAGTGTCCTGGTCAATATTCGGATAGATATGAATAAAATATTTAAATGGTATTGTAAATA
GTTTTCAGGACATATGCTATAGCTTATTTTTATTATCTTTTGAAATTGCTCTTAATACATCAAATCCTGATGTATTCAATTTATCAGATA
TAAATTATTCTAAATGAAGCCCAGTTAAATGTTTTTGTCTTGTCAGTTATATGTTAAGTTTCTGATCTCTTTGTCTATGACGTTTACTAA
TCTGCATTTTTACTGTTATGAATTATTTTAGACAGCAGTGGTTTCAAGCTTTTTGCCACTAAAAATACCTTTTATTTTCTCCTCCCCCAG
AAAAGTCTATACCTTGAAGTATCTATCCACCAAACTGTACTTCTATTAAGAAATAGTTATTGTGTTTTCTTAATGTTTTGTTATTCAAAG
ACATATCAATGAAAGCTGCTGAGCAGCATGAATAACAATTATATCCACACAGATTTGATATATTTTGTGCAGCCTTAACTTGATAGTATA
AAATGTCATTGCTTTTTAAATAATAGTTAGTCAATGGACTTCTATCATAGCTTTCCTAAACTAGGTTAAGATCCAGAGCTTTGGGGTCAT
AATATATTACATACAATTAAGTTATCTTTTTCTAAGGGCTTTAAAATTCATGAGAATAACCAAAAAAGGTATGTGGAGAGTTAATACAAA
CATACCATATTCTTGTTGAAACAGAGATGTGGCTCTGCTTGTTCTCCATAAGGTAGAAATACTTTCCAGAATTTGCCTAAACTAGTAAGC
CCTGAATTTGCTATGATTAGGGATAGGAAGAGATTTTCACATGGCAGACTTTAGAATTCTTCACTTTAGCCAGTAAAGTATCTCCTTTTG
ATCTTAGTATTCTGTGTATTTTAACTTTTCTGAGTTGTGCATGTTTATAAGAAAAATCAGCACAAAGGGTTTAAGTTAAAGCCTTTTTAC
TGAAATTTGAAAGAAACAGAAGAAAATATCAAAGTTCTTTGTATTTTGAGAGGATTAAATATGATTTACAAAAGTTACATGGAGGGCTCT
CTAAAACATTAAATTAATTATTTTTTGTTGAAAAGTCTTACTTTAGGCATCATTTTATTCCTCAGCAACTAGCTGTGAAGCCTTTACTGT
GCTGTATGCCAGTCACTCTGCTAGATTGTGGAGATTACCAGTGTTCCCGTCTTCTCCGAGCTTAGAGTTGGATGGGGAATAAAGACAGGT
AAACAGATAGCTACAATATTGTACTGTGAATGCTTATGCTGGAGGAAGTACAGGGAACTATTGGAGCACCTAAGAGGAGCACCTACCTTG
AATTTAGGGGTTAGCAGAGGCATCCTGAAAAAAGTCAAAGCTAAGCCACAATCTATAAGCAGTTTAGGAATTAGCAGAACGTGCGTGGTG
AGGAGATGCCAAAGGCAAGAAGAGAAGAGTATTCCAAACAGGAGGGATTCCAAAGAGAGAAGAGTATCCCAAACAACATTTGCACAAACC
TGATGGGGAGAGAGAATGTGGGGTGGGGATGGATGATGAGACTGAAGAAGAAAGCCAGGTCTAGATAATCAGTGGCCTTGTACACCATGT
TAAAGAGTGTAGACTTGATTCTGTTGTAAACAGGAAAGCAGCACAATTCATATGAATATTTTAGAAGACTCCCACTGGAATATGGAGAAT
AAAGTTGGAGATGACTAATCCTGGAAGCAGGGAGAACATTTTTGAGGAAGTTGCACTATTTTGGTGAAAATGATGATCATAAACATGAAG
AATTGTAGGTGATCATGACCTCCTCTCTAATTTTCCAGAAGGGTTTTGGAAGATATAACATAGGAACATTGACAGGACTGACGAAAGGAG
ATGAAATACACCATATAAATTGTCAAACACAAGGCCAGATGTCTAATTATTTTGCTTATGTGTTGAAATTACAAATTTTTCATCAGGAAA
CCAAAAACTACAAAACTTAGTTTTCCCAAGTCCCAGAATTCTATCTGTCCAAACAATCTGTACCACTCCACCTATATCCCTACCTTTGCA
TGTCTGTCCAACCTCAAAGTCCAGGTCTATACACACGGGTAAGACTAGAGCAGTTCAAGTTTCAGAAAATGAGAAAGAGGAACTGAGTTG
TGCTGAACCCATACAAAATAAACACATTCTTTGTATAGATTCTTGGAACCTCGAGAGGAATTCACCTAACTCATAGGTATTTGATGGTAT
GAATCCATGGCTGGGCTCGGCTTTTAAAAAGCCTTATCTGGGATTCCTTCTATGGAACCAAGTTCCATCAAAGCCCATTTAAAAGCCTAC
ATTAAAAACAAAATTCTTGCTGCATTGTATACAAATAATGATGTCATGATCAAATAATCAGATGCCATTATCAAGTGGAATTACAAAATG
GTATACCCACTCCAAAAAAAAAAAAAAAGCTAAATTCTCAGTAGAACATTGTGACTTCATGAGCCCTCCACAGCCTTGGAGCTGAGGAGG
GAGCACTGGTGAGCAGTAGGTTGAAGAGAAAACTTGGCGCTTAATAATCTATCCATGTTTTTTCATCTAAAAGAGCCTTCTTTTTGGATT
ACCTTATTCAATTTCCATCAAGGAAATTGTTAGTTCCACTAACCAGACAGCAGCTGGGAAGGCAGAAGCTTACTGTATGTACATGGTAGC
TGTGGGAAGGAGGTTTCTTTCTCCAGGTCCTCACTGGCCATACACCAGTCCCTTGTTAGTTATGCCTGGTCATAGACCCCCGTTGCTATC
ATCTCATATTTAAGTCTTTGGCTTGTGAATTTATCTATTCTTTCAGCTTCAGCACTGCAGAGTGCTGGGACTTTGCTAACTTCCATTTCT
TGCTGGCTTAGCACATTCCTCATAGGCCCAGCTCTTTTCTCATCTGGCCCTGCTGTGGAGTCACCTTGCCCCTTCAGGAGAGCCATGGCT
TACCACTGCCTGCTAAGCCTCCACTCAGCTGCCACCACACTAAATCCAAGCTTCTCTAAGATGTTGCAGACTTTACAGGCAAGCATAAAA
GGCTTGATCTTCCTGGACTTCCCTTTACTTGTCTGAATCTCACCTCCTTCAACTTTCAGTCTCAGAATGTAGGCATTTGTCCTCTTTGCC
CTACATCTTCCTTCTTCTGAATCATGAAAGCCTCTCACTTCCTCTTGCTATGTGCTGGAGGCTTCTGTCAGGTTTTAGAATGAGTTCTCA
TCTAGTCCTAGTAGCTTTTGATGCTTAAGTCCACCTTTTAAGGATACCTTTGAGATTTAGACCATGTTTTTCGCTTGAGAAAGCCCTAAT
CTCCAGACTTGCCTTTCTGTGGATTTCAAAGACCAACTGAGGAAGTCAAAAGCTGAATGTTGACTTTCTTTGAACATTTCCGCTATAACA
ATTCCAATTCTCCTCAGAGCAATATGCCTGCCTCCAACTGACCAGGAGAAAGGTCCAGTGCCAAAGAGAAAAACACAAAGATTAATTATT
TCAGTTGAGCACATACTTTCAAAGTGGTTTGGGTATTCATATGAGGTTTTCTGTCAAGAGGGTGAGACTCTTCATCTATCCATGTGTGCC
TGACAGTTCTCCTGGCACTGGCTGGTAACAGATGCAAAACTGTAAAAATTAAGTGATCATGTATTTTAACGATATCATCACATACTTATT
TTCTATGTAATGTTTTAAATTTCCCCTAACATACTTTGACTGTTTTGCACATGGTAGATATTCACATTTTTTTGTGTTGAAGTTGATGCA
ATCTTCAAAGTTATCTACCCCGTTGCTTATTAGTAAAACTAGTGTTAATACTTGGCAAGAGATGCAGGGAATCTTTCTCATGACTCACGC
CCTATTTAGTTATTAATGCTACTACCCTATTTTGAGTAAGTAGTAGGTCCCTAAGTACATTGTCCAGAGTTATACTTTTAAAGATATTTA
GCCCCATATACTTCTTGAATCTAAAGTCATACACCTTGCTCCTCATTTCTGAGTGGGAAAGACATTTGAGAGTATGTTGACAATTGTTCT
GAAGGTTTTTGCCAAGAAGGTGAAACTGTCCTTTCATCTGTGTATGCCTGGGGCTGGGTCCCTGGCAGTGATGGGGTGACAATGCAAAGC
TGTAAAAACTAGGTGCTAGTGGGCACCTAATATCATCATCATATACTTATTTTCAAGCTAATATGCAAAATCCCATCTCTGTTTTTAAAC
TAAGTGTAGATTTCAGAGAAAATATTTTGTGGTTCACATAAGAAAACAGTCTACTCAGCTTGACAAGTGTTTTATGTTAAATTGGCTGGT
GGTTTGAAATGAATCATCTTCACATAATGTTTTCTTTAAAAATATTGTGAATTTAACTCTAATTCTTGTTATTCTGTGTGATAATAAAGA

>In-frame_ARHGAP42_ENST00000298815_chr11_100558563_+_PGR_ENST00000534013_chr11_100933483_-_1489nt
GCCATGGGGCTGCCCACTCTGGAGTTCAGCGATTCCTACTTGGACAGCCCAGATTTCAGGGAGCGCTTGCAGTGTCACGAGATTGAGCTG
GAGCGAACCAACAAGTTCATCAAGGAGCTCATTAAGGACGGCTCTCTGCTCATTGGGGCGTTGAGGAGTCGAAAATTTAAAAAGTTCAAT
AAAGTCAGAGTTGTGAGAGCACTGGATGCTGTTGCTCTCCCACAGCCAGTGGGCGTTCCAAATGAAAGCCAAGCCCTAAGCCAGAGATTC
ACTTTTTCACCAGGTCAAGACATACAGTTGATTCCACCACTGATCAACCTGTTAATGAGCATTGAACCAGATGTGATCTATGCAGGACAT
GACAACACAAAACCTGACACCTCCAGTTCTTTGCTGACAAGTCTTAATCAACTAGGCGAGAGGCAACTTCTTTCAGTAGTCAAGTGGTCT
AAATCATTGCCAGGTTTTCGAAACTTACATATTGATGACCAGATAACTCTCATTCAGTATTCTTGGATGAGCTTAATGGTGTTTGGTCTA
GGATGGAGATCCTACAAACACGTCAGTGGGCAGATGCTGTATTTTGCACCTGATCTAATACTAAATGAACAGCGGATGAAAGAATCATCA
TTCTATTCATTATGCCTTACCATGTGGCAGATCCCACAGGAGTTTGTCAAGCTTCAAGTTAGCCAAGAAGAGTTCCTCTGTATGAAAGTA
TTGTTACTTCTTAATACAATTCCTTTGGAAGGGCTACGAAGTCAAACCCAGTTTGAGGAGATGAGGTCAAGCTACATTAGAGAGCTCATC
AAGGCAATTGGTTTGAGGCAAAAAGGAGTTGTGTCGAGCTCACAGCGTTTCTATCAACTTACAAAACTTCTTGATAACTTGCATGATCTT
GTCAAACAACTTCATCTGTACTGCTTGAATACATTTATCCAGTCCCGGGCACTGAGTGTTGAATTTCCAGAAATGATGTCTGAAGTTATT
GCTGCACAATTACCCAAGATATTGGCAGGGATGGTGAAACCCCTTCTCTTTCATAAAAAGTGAATGTCATCTTTTTCTTTTAAAGAATTA
AATTTTGTGGTATGTCTTTTTGTTTTGGTCAGGATTATGAGGTCTTGAGTTTTTATAATGTTCTTCTGAAAGCCTTACATTTATAACATC
ATAGTGTGTAAATTTAAAAGAAAAATTGTGAGGTTCTAATTATTTTCTTTTATAAAGTATAATTAGAATGTTTAACTGTTTTGTTTACCC
ATATTTTCTTGAAGAATTTACAAGATTGAAAAAGTACTAAAATTGTTAAAGTAAACTATCTTATCCATATTATTTCATACCATGTAGGTG
AGGATTTTTAACTTTTGCATCTAACAAATCATCGACTTAAGAGAAAAAATCTTACATGTAATAACACAAAGCTATTATATGTTATTTCTA


Top

FusionGenePPI for ARHGAP42_PGR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARHGAP42DEF6, CAPZA2, MYO19, ARHGAP26, DENND2CPGRUBE3A, SMARCD1, TDG, KLF9, CDC25B, POU2F1, POU2F2, DAP3, UBR5, RELA, FKBP5, NCOA1, DDX54, RNF4, PIAS2, HMGB1, HMGB2, NCOR2, NCOA3, CUEDC2, NCOR1, MAPK1, SMARCE1, ARID1A, SMARCA1, GNAI1, NR0B1, EP300, TAF1B, SP1, PRDM2, FGFR2, STAT5A, STAT5B, BRCA1, BATF3, JDP2, STAT3, NCOA2, KAT2B, CCNA1, CDK2, SRC, ESR1, COPS5, BPTF, STUB1, FKBP4, PPP5C, DNAJC7, MAGEA11, RBM23, RBM39, ANP32A, XRCC6, XRCC5, PRKDC, PARP1, PGR, BCAS2, SGTA, SPOP, DNAJA1, HSPA1A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARHGAP42_PGR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgenePGRP06401DB00304DesogestrelProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB00421SpironolactoneProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB00648MitotaneProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB00717NorethisteroneProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB01395DrospirenoneProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB01406DanazolProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB01431AllylestrenolProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB08867UlipristalProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB09123DienogestProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB09124MedrogestoneProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB09389NorgestrelProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB11619GestrinoneProgesterone receptorsmall moleculeapproved
TgenePGRP06401DB00294EtonogestrelProgesterone receptorsmall moleculeapproved|investigational
TgenePGRP06401DB00367LevonorgestrelProgesterone receptorsmall moleculeapproved|investigational
TgenePGRP06401DB00603Medroxyprogesterone acetateProgesterone receptorsmall moleculeapproved|investigational
TgenePGRP06401DB00834MifepristoneProgesterone receptorsmall moleculeapproved|investigational
TgenePGRP06401DB00957NorgestimateProgesterone receptorsmall moleculeapproved|investigational
TgenePGRP06401DB06713NorelgestrominProgesterone receptorsmall moleculeapproved|investigational
TgenePGRP06401DB06789Hydroxyprogesterone caproateProgesterone receptorsmall moleculeapproved|investigational
TgenePGRP06401DB00351Megestrol acetateProgesterone receptorsmall moleculeapproved|investigational|vet_approved
TgenePGRP06401DB00378DydrogesteroneProgesterone receptorsmall moleculeapproved|investigational|withdrawn
TgenePGRP06401DB00396ProgesteroneProgesterone receptorsmall moleculeapproved|vet_approved
TgenePGRP06401DB00764MometasoneProgesterone receptorsmall moleculeapproved|vet_approved
TgenePGRP06401DB00431LindaneProgesterone receptorsmall moleculeapproved|withdrawn

Top

RelatedDiseases for ARHGAP42_PGR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePGRC0025286Meningioma3CTD_human
TgenePGRC0014175Endometriosis2CTD_human
TgenePGRC1458155Mammary Neoplasms2CTD_human
TgenePGRC0001418Adenocarcinoma1CTD_human
TgenePGRC0014170Endometrial Neoplasms1CTD_human
TgenePGRC0024667Animal Mammary Neoplasms1CTD_human
TgenePGRC0024668Mammary Neoplasms, Experimental1CTD_human
TgenePGRC0025500Mesothelioma1CTD_human