FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24201

FusionGeneSummary for NFE2L3_NPY

check button Fusion gene summary
Fusion gene informationFusion gene name: NFE2L3_NPY
Fusion gene ID: 24201
HgeneTgene
Gene symbol

NFE2L3

NPY

Gene ID

9603

4852

Gene namenuclear factor, erythroid 2 like 3neuropeptide Y
SynonymsNRF3PYY4
Cytomap

7p15.2

7p15.3

Type of geneprotein-codingprotein-coding
Descriptionnuclear factor erythroid 2-related factor 3NF-E2-related factor 3NFE2-related factor 3nuclear factor, erythroid derived 2, like 3nuclear factor-erythroid 2 p45-related factor 3pro-neuropeptide Yprepro-neuropeptide Y
Modification date2018052320180527
UniProtAcc

Q9Y4A8

P01303

Ensembl transtripts involved in fusion geneENST00000056233, ENST00000242152, 
ENST00000407573, ENST00000405982, 
Fusion gene scores* DoF score3 X 3 X 3=275 X 5 X 4=100
# samples 35
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NFE2L3 [Title/Abstract] AND NPY [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVESCATCGA-V5-A7RB-01ANFE2L3chr7

26192688

+NPYchr7

24324860

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000056233ENST00000242152NFE2L3chr7

26192688

+NPYchr7

24324860

+
In-frameENST00000056233ENST00000407573NFE2L3chr7

26192688

+NPYchr7

24324860

+
Frame-shitENST00000056233ENST00000405982NFE2L3chr7

26192688

+NPYchr7

24324860

+

Top

FusionProtFeatures for NFE2L3_NPY


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NFE2L3

Q9Y4A8

NPY

P01303

Activates erythroid-specific, globin gene expression. NPY is implicated in the control of feeding and insecretion of gonadotrophin-release hormone.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNFE2L3chr7:26192688chr7:24324860ENST00000056233+1414_49190695Compositional biasNote=Leu-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNFE2L3chr7:26192688chr7:24324860ENST00000056233+14578_641190695DomainbZIP
HgeneNFE2L3chr7:26192688chr7:24324860ENST00000056233+14580_599190695RegionBasic motif
HgeneNFE2L3chr7:26192688chr7:24324860ENST00000056233+14606_620190695RegionLeucine-zipper


Top

FusionGeneSequence for NFE2L3_NPY


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NFE2L3_ENST00000056233_chr7_26192688_+_NPY_ENST00000242152_chr7_24324860_+_288aa
MKHLKRWWSAGGGLLHLTLLLSLAGLRVDLDLYLLLPPPTLLQDELLFLGGPASSAYALSPFSASGGWGRAGHLHPKGRELDPAAPPEGQ
LLREVRALGVPFVPRTSVDAWLVHSVAAGSADEAHGLLGAAAASSTGGAGASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQ
VPDAGGCASEMLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRTGKRSSPETLISDLLMR

>In-frame_NFE2L3_ENST00000056233_chr7_26192688_+_NPY_ENST00000407573_chr7_24324860_+_288aa
MKHLKRWWSAGGGLLHLTLLLSLAGLRVDLDLYLLLPPPTLLQDELLFLGGPASSAYALSPFSASGGWGRAGHLHPKGRELDPAAPPEGQ
LLREVRALGVPFVPRTSVDAWLVHSVAAGSADEAHGLLGAAAASSTGGAGASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQ
VPDAGGCASEMLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRTGKRSSPETLISDLLMR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NFE2L3_ENST00000056233_chr7_26192688_+_NPY_ENST00000242152_chr7_24324860_+_864nt
ATGAAGCACCTGAAGCGGTGGTGGTCGGCCGGCGGCGGCCTCCTGCACCTCACCCTCCTGCTGAGCTTGGCGGGGCTCCGCGTAGACCTA
GATCTTTACCTGCTGCTGCCGCCGCCCACCCTGCTGCAGGACGAGCTGCTGTTCCTGGGCGGCCCGGCCAGCTCCGCCTACGCGCTCAGC
CCCTTCTCGGCCTCGGGAGGGTGGGGGCGCGCGGGCCACTTGCACCCCAAGGGCCGGGAGCTGGACCCTGCCGCGCCGCCCGAGGGCCAG
CTGCTCCGGGAGGTGCGCGCGCTCGGGGTCCCCTTCGTCCCTCGCACCAGCGTGGATGCATGGCTGGTGCACAGCGTGGCTGCCGGGAGC
GCGGACGAGGCCCACGGGCTGCTCGGCGCCGCCGCCGCCTCGTCCACCGGAGGAGCCGGCGCCAGCGTGGACGGCGGCAGCCAGGCTGTG
CAGGGGGGCGGCGGGGACCCCCGAGCGGCTCGGAGTGGCCCCTTGGACGCCGGGGAAGAGGAGAAGGCACCCGCGGAACCGACGGCTCAG
GTGCCGGACGCTGGCGGATGTGCGAGCGAGATGCTAGGTAACAAGCGACTGGGGCTGTCCGGACTGACCCTCGCCCTGTCCCTGCTCGTG
TGCCTGGGTGCGCTGGCCGAGGCGTACCCCTCCAAGCCGGACAACCCGGGCGAGGACGCACCAGCGGAGGACATGGCCAGATACTACTCG
GCGCTGCGACACTACATCAACCTCATCACCAGGCAGAGATATGGAAAACGATCCAGCCCAGAGACACTGATTTCAGACCTCTTGATGAGA

>In-frame_NFE2L3_ENST00000056233_chr7_26192688_+_NPY_ENST00000407573_chr7_24324860_+_864nt
ATGAAGCACCTGAAGCGGTGGTGGTCGGCCGGCGGCGGCCTCCTGCACCTCACCCTCCTGCTGAGCTTGGCGGGGCTCCGCGTAGACCTA
GATCTTTACCTGCTGCTGCCGCCGCCCACCCTGCTGCAGGACGAGCTGCTGTTCCTGGGCGGCCCGGCCAGCTCCGCCTACGCGCTCAGC
CCCTTCTCGGCCTCGGGAGGGTGGGGGCGCGCGGGCCACTTGCACCCCAAGGGCCGGGAGCTGGACCCTGCCGCGCCGCCCGAGGGCCAG
CTGCTCCGGGAGGTGCGCGCGCTCGGGGTCCCCTTCGTCCCTCGCACCAGCGTGGATGCATGGCTGGTGCACAGCGTGGCTGCCGGGAGC
GCGGACGAGGCCCACGGGCTGCTCGGCGCCGCCGCCGCCTCGTCCACCGGAGGAGCCGGCGCCAGCGTGGACGGCGGCAGCCAGGCTGTG
CAGGGGGGCGGCGGGGACCCCCGAGCGGCTCGGAGTGGCCCCTTGGACGCCGGGGAAGAGGAGAAGGCACCCGCGGAACCGACGGCTCAG
GTGCCGGACGCTGGCGGATGTGCGAGCGAGATGCTAGGTAACAAGCGACTGGGGCTGTCCGGACTGACCCTCGCCCTGTCCCTGCTCGTG
TGCCTGGGTGCGCTGGCCGAGGCGTACCCCTCCAAGCCGGACAACCCGGGCGAGGACGCACCAGCGGAGGACATGGCCAGATACTACTCG
GCGCTGCGACACTACATCAACCTCATCACCAGGCAGAGATATGGAAAACGATCCAGCCCAGAGACACTGATTTCAGACCTCTTGATGAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NFE2L3_ENST00000056233_chr7_26192688_+_NPY_ENST00000242152_chr7_24324860_+_1301nt
GGGCTCGGCGCTCAGGTGGCTCCTTCTTCGCTTCTCCCGATCCCCGGCGGTGCCAGGCACGGTGCCGGCTGCCGAGGGAACGCCTTTGTG
CCCGGTGCTGGGAACCCGCGACGGCCGCCACGCGCCCCGGTCCATTGTTTCGCTTATCTGGGTTCCAGGCAGGTGCGGGCGGCGCGCGGG
GTCCGCACGTGTCACCCCGGCGGCTGGGGCGCCGGGACCCGCGGGCGCCGGCAGGGGCGTTCCCGGGCGCGCGGCGGCGATGAAGCACCT
GAAGCGGTGGTGGTCGGCCGGCGGCGGCCTCCTGCACCTCACCCTCCTGCTGAGCTTGGCGGGGCTCCGCGTAGACCTAGATCTTTACCT
GCTGCTGCCGCCGCCCACCCTGCTGCAGGACGAGCTGCTGTTCCTGGGCGGCCCGGCCAGCTCCGCCTACGCGCTCAGCCCCTTCTCGGC
CTCGGGAGGGTGGGGGCGCGCGGGCCACTTGCACCCCAAGGGCCGGGAGCTGGACCCTGCCGCGCCGCCCGAGGGCCAGCTGCTCCGGGA
GGTGCGCGCGCTCGGGGTCCCCTTCGTCCCTCGCACCAGCGTGGATGCATGGCTGGTGCACAGCGTGGCTGCCGGGAGCGCGGACGAGGC
CCACGGGCTGCTCGGCGCCGCCGCCGCCTCGTCCACCGGAGGAGCCGGCGCCAGCGTGGACGGCGGCAGCCAGGCTGTGCAGGGGGGCGG
CGGGGACCCCCGAGCGGCTCGGAGTGGCCCCTTGGACGCCGGGGAAGAGGAGAAGGCACCCGCGGAACCGACGGCTCAGGTGCCGGACGC
TGGCGGATGTGCGAGCGAGATGCTAGGTAACAAGCGACTGGGGCTGTCCGGACTGACCCTCGCCCTGTCCCTGCTCGTGTGCCTGGGTGC
GCTGGCCGAGGCGTACCCCTCCAAGCCGGACAACCCGGGCGAGGACGCACCAGCGGAGGACATGGCCAGATACTACTCGGCGCTGCGACA
CTACATCAACCTCATCACCAGGCAGAGATATGGAAAACGATCCAGCCCAGAGACACTGATTTCAGACCTCTTGATGAGAGAAAGCACAGA
AAATGTTCCCAGAACTCGGCTTGAAGACCCTGCAATGTGGTGATGGGAAATGAGACTTGCTCTCTGGCCTTTTCCTATTTTCAGCCCATA
TTTCATCGTGTAAAACGAGAATCCACCCATCCTACCAATGCATGCAGCCACTGTGCTGAATTCTGCAATGTTTTCCTTTGTCATCATTGT

>In-frame_NFE2L3_ENST00000056233_chr7_26192688_+_NPY_ENST00000407573_chr7_24324860_+_1244nt
GGGCTCGGCGCTCAGGTGGCTCCTTCTTCGCTTCTCCCGATCCCCGGCGGTGCCAGGCACGGTGCCGGCTGCCGAGGGAACGCCTTTGTG
CCCGGTGCTGGGAACCCGCGACGGCCGCCACGCGCCCCGGTCCATTGTTTCGCTTATCTGGGTTCCAGGCAGGTGCGGGCGGCGCGCGGG
GTCCGCACGTGTCACCCCGGCGGCTGGGGCGCCGGGACCCGCGGGCGCCGGCAGGGGCGTTCCCGGGCGCGCGGCGGCGATGAAGCACCT
GAAGCGGTGGTGGTCGGCCGGCGGCGGCCTCCTGCACCTCACCCTCCTGCTGAGCTTGGCGGGGCTCCGCGTAGACCTAGATCTTTACCT
GCTGCTGCCGCCGCCCACCCTGCTGCAGGACGAGCTGCTGTTCCTGGGCGGCCCGGCCAGCTCCGCCTACGCGCTCAGCCCCTTCTCGGC
CTCGGGAGGGTGGGGGCGCGCGGGCCACTTGCACCCCAAGGGCCGGGAGCTGGACCCTGCCGCGCCGCCCGAGGGCCAGCTGCTCCGGGA
GGTGCGCGCGCTCGGGGTCCCCTTCGTCCCTCGCACCAGCGTGGATGCATGGCTGGTGCACAGCGTGGCTGCCGGGAGCGCGGACGAGGC
CCACGGGCTGCTCGGCGCCGCCGCCGCCTCGTCCACCGGAGGAGCCGGCGCCAGCGTGGACGGCGGCAGCCAGGCTGTGCAGGGGGGCGG
CGGGGACCCCCGAGCGGCTCGGAGTGGCCCCTTGGACGCCGGGGAAGAGGAGAAGGCACCCGCGGAACCGACGGCTCAGGTGCCGGACGC
TGGCGGATGTGCGAGCGAGATGCTAGGTAACAAGCGACTGGGGCTGTCCGGACTGACCCTCGCCCTGTCCCTGCTCGTGTGCCTGGGTGC
GCTGGCCGAGGCGTACCCCTCCAAGCCGGACAACCCGGGCGAGGACGCACCAGCGGAGGACATGGCCAGATACTACTCGGCGCTGCGACA
CTACATCAACCTCATCACCAGGCAGAGATATGGAAAACGATCCAGCCCAGAGACACTGATTTCAGACCTCTTGATGAGAGAAAGCACAGA
AAATGTTCCCAGAACTCGGCTTGAAGACCCTGCAATGTGGTGATGGGAAATGAGACTTGCTCTCTGGCCTTTTCCTATTTTCAGCCCATA


Top

FusionGenePPI for NFE2L3_NPY


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NFE2L3MAFK, BACH2, NFE2L3, NFE2L2, NFE2L1, NFE2, MAFG, MAFF, CREB3, PPARG, FBXW7, GSK3B, HCFC2, HCFC1NPYPMCH, NPY1R, MEP1A, NR1H2, BAG6, ATP12A, UBQLN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NFE2L3_NPY


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NFE2L3_NPY


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneNPYC0011581Depressive disorder7CTD_human;PSYGENET
TgeneNPYC0001973Alcoholic Intoxication, Chronic6CTD_human;PSYGENET
TgeneNPYC0011570Mental Depression5PSYGENET
TgeneNPYC0041696Unipolar Depression5PSYGENET
TgeneNPYC0525045Mood Disorders5PSYGENET
TgeneNPYC1269683Major Depressive Disorder5PSYGENET
TgeneNPYC0003123Anorexia3CTD_human
TgeneNPYC0036572Seizures3CTD_human
TgeneNPYC0014544Epilepsy2CTD_human
TgeneNPYC0036341Schizophrenia2PSYGENET
TgeneNPYC0085762Alcohol abuse2PSYGENET
TgeneNPYC0002395Alzheimer's Disease1CTD_human
TgeneNPYC0003469Anxiety Disorders1CTD_human
TgeneNPYC0004096Asthma1CTD_human
TgeneNPYC0007222Cardiovascular Diseases1CTD_human
TgeneNPYC0007785Cerebral Infarction1CTD_human
TgeneNPYC0008677Bronchitis, Chronic1CTD_human
TgeneNPYC0014556Epilepsy, Temporal Lobe1CTD_human
TgeneNPYC0020564Hypertrophy1CTD_human
TgeneNPYC0025261Memory Disorders1CTD_human
TgeneNPYC0026837Muscle Rigidity1CTD_human
TgeneNPYC0027429Nasal obstruction present finding1CTD_human
TgeneNPYC0031117Peripheral Neuropathy1CTD_human
TgeneNPYC0035455Rhinitis1CTD_human
TgeneNPYC0036337Schizoaffective Disorder1PSYGENET
TgeneNPYC0038587Substance Withdrawal Syndrome1CTD_human
TgeneNPYC0085159Seasonal Affective Disorder1PSYGENET
TgeneNPYC0236664Alcohol-Related Disorders1PSYGENET
TgeneNPYC0236736Cocaine-Related Disorders1CTD_human
TgeneNPYC0236969Substance-Related Disorders1CTD_human
TgeneNPYC0424295Hyperactive behavior1CTD_human
TgeneNPYC0600427Cocaine Dependence1PSYGENET
TgeneNPYC1262477Weight decreased1CTD_human
TgeneNPYC2362914clinical depression1PSYGENET