FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24134

FusionGeneSummary for NFASC_NTRK1

check button Fusion gene summary
Fusion gene informationFusion gene name: NFASC_NTRK1
Fusion gene ID: 24134
HgeneTgene
Gene symbol

NFASC

NTRK1

Gene ID

23114

4914

Gene nameneurofascinneurotrophic receptor tyrosine kinase 1
SynonymsNF|NRCAMLMTC|TRK|TRK1|TRKA|Trk-A|p140-TrkA
Cytomap

1q32.1

1q23.1

Type of geneprotein-codingprotein-coding
Descriptionneurofascinneurofascin homologhigh affinity nerve growth factor receptorOncogene TRKTRK1-transforming tyrosine kinase proteingp140trkneurotrophic tyrosine kinase, receptor, type 1tropomyosin-related kinase Atyrosine kinase receptor A
Modification date2018052220180523
UniProtAcc

O94856

P04629

Ensembl transtripts involved in fusion geneENST00000338586, ENST00000338515, 
ENST00000367171, ENST00000367169, 
ENST00000539706, ENST00000339876, 
ENST00000367170, ENST00000360049, 
ENST00000367172, ENST00000403080, 
ENST00000404076, ENST00000401399, 
ENST00000404907, ENST00000513543, 
ENST00000495396, 
ENST00000392302, 
ENST00000368196, ENST00000524377, 
ENST00000358660, ENST00000531606, 
Fusion gene scores* DoF score11 X 6 X 4=26415 X 12 X 8=1440
# samples 1323
** MAII scorelog2(13/264*10)=-1.02202630633
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(23/1440*10)=-2.6463630453853
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NFASC [Title/Abstract] AND NTRK1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneNTRK1

GO:0006468

protein phosphorylation

15488758

TgeneNTRK1

GO:0008285

negative regulation of cell proliferation

15488758

TgeneNTRK1

GO:0010976

positive regulation of neuron projection development

15488758

TgeneNTRK1

GO:0018108

peptidyl-tyrosine phosphorylation

2927393

TgeneNTRK1

GO:0043547

positive regulation of GTPase activity

15488758

TgeneNTRK1

GO:0046579

positive regulation of Ras protein signal transduction

15488758

TgeneNTRK1

GO:0046777

protein autophosphorylation

15488758

TgeneNTRK1

GO:0048011

neurotrophin TRK receptor signaling pathway

15488758

TgeneNTRK1

GO:0051092

positive regulation of NF-kappaB transcription factor activity

15488758

TgeneNTRK1

GO:0070374

positive regulation of ERK1 and ERK2 cascade

15488758

TgeneNTRK1

GO:1904646

cellular response to amyloid-beta

11927634


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-06-5411-01ANFASCchr1

204951148

+NTRK1chr1

156844363

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000338586ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000338586ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000338586ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000338586ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000338586ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000338515ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000338515ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000338515ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000338515ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000338515ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367171ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367171ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367171ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367171ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000367171ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367169ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367169ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367169ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367169ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000367169ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000539706ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000539706ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000539706ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000539706ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000539706ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000339876ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000339876ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000339876ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000339876ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000339876ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367170ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367170ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367170ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367170ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000367170ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000360049ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000360049ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000360049ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000360049ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000360049ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367172ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367172ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367172ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000367172ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000367172ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-3CDSENST00000403080ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-3CDSENST00000403080ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-3CDSENST00000403080ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-3CDSENST00000403080ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-intronENST00000403080ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000404076ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000404076ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000404076ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000404076ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000404076ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000401399ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000401399ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000401399ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000401399ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000401399ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000404907ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000404907ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000404907ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000404907ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000404907ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000513543ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000513543ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000513543ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
In-frameENST00000513543ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
5CDS-intronENST00000513543ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-3CDSENST00000495396ENST00000392302NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-3CDSENST00000495396ENST00000368196NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-3CDSENST00000495396ENST00000524377NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-3CDSENST00000495396ENST00000358660NFASCchr1

204951148

+NTRK1chr1

156844363

+
intron-intronENST00000495396ENST00000531606NFASCchr1

204951148

+NTRK1chr1

156844363

+

Top

FusionProtFeatures for NFASC_NTRK1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NFASC

O94856

NTRK1

P04629


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+2130143_2308231241DomainNote=Ig-like C2-type 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+2130244_3328231241DomainNote=Ig-like C2-type 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+2130337_4248231241DomainNote=Ig-like C2-type 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+213041_1378231241DomainNote=Ig-like C2-type 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+2130429_5178231241DomainNote=Ig-like C2-type 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+2130521_6038231241DomainNote=Ig-like C2-type 6
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+2130630_7258231241DomainFibronectin type-III 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+2130730_8238231241DomainFibronectin type-III 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+2027143_2308191170DomainNote=Ig-like C2-type 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+2027244_3328191170DomainNote=Ig-like C2-type 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+2027337_4248191170DomainNote=Ig-like C2-type 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+202741_1378191170DomainNote=Ig-like C2-type 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+2027429_5178191170DomainNote=Ig-like C2-type 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+2027521_6038191170DomainNote=Ig-like C2-type 6
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+2027630_7258191170DomainFibronectin type-III 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+2029143_2308231241DomainNote=Ig-like C2-type 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+2029244_3328231241DomainNote=Ig-like C2-type 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+2029337_4248231241DomainNote=Ig-like C2-type 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+202941_1378231241DomainNote=Ig-like C2-type 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+2029429_5178231241DomainNote=Ig-like C2-type 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+2029521_6038231241DomainNote=Ig-like C2-type 6
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+2029630_7258231241DomainFibronectin type-III 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+2029730_8238231241DomainFibronectin type-III 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+1927143_2308021158DomainNote=Ig-like C2-type 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+1927244_3328021158DomainNote=Ig-like C2-type 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+1927337_4248021158DomainNote=Ig-like C2-type 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+192741_1378021158DomainNote=Ig-like C2-type 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+1927429_5178021158DomainNote=Ig-like C2-type 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+1927521_6038021158DomainNote=Ig-like C2-type 6
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+1927630_7258021158DomainFibronectin type-III 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+1826143_2308191175DomainNote=Ig-like C2-type 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+1826244_3328191175DomainNote=Ig-like C2-type 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+1826337_4248191175DomainNote=Ig-like C2-type 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+182641_1378191175DomainNote=Ig-like C2-type 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+1826429_5178191175DomainNote=Ig-like C2-type 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+1826521_6038191175DomainNote=Ig-like C2-type 6
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+1826630_7258191175DomainFibronectin type-III 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+1825143_2308191170DomainNote=Ig-like C2-type 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+1825244_3328191170DomainNote=Ig-like C2-type 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+1825337_4248191170DomainNote=Ig-like C2-type 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+182541_1378191170DomainNote=Ig-like C2-type 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+1825429_5178191170DomainNote=Ig-like C2-type 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+1825521_6038191170DomainNote=Ig-like C2-type 6
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+1825630_7258191170DomainFibronectin type-III 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+2028143_2308191175DomainNote=Ig-like C2-type 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+2028244_3328191175DomainNote=Ig-like C2-type 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+2028337_4248191175DomainNote=Ig-like C2-type 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+202841_1378191175DomainNote=Ig-like C2-type 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+2028429_5178191175DomainNote=Ig-like C2-type 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+2028521_6038191175DomainNote=Ig-like C2-type 6
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+2028630_7258191175DomainFibronectin type-III 1
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+716510_781392791DomainProtein kinase
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+817510_781362761DomainProtein kinase
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+817510_781398797DomainProtein kinase
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+716516_524392791Nucleotide bindingATP
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+817516_524362761Nucleotide bindingATP
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+817516_524398797Nucleotide bindingATP
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+716440_796392791Topological domainCytoplasmic
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+817440_796362761Topological domainCytoplasmic
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+817440_796398797Topological domainCytoplasmic
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+716424_439392791TransmembraneHelical
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+817424_439362761TransmembraneHelical
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+817424_439398797TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+21301031_11088231241Compositional biasNote=Thr-rich
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+20271031_11088191170Compositional biasNote=Thr-rich
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+20291031_11088231241Compositional biasNote=Thr-rich
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+1161031_1108-96620Compositional biasNote=Thr-rich
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+19271031_11088021158Compositional biasNote=Thr-rich
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+18261031_11088191175Compositional biasNote=Thr-rich
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+18251031_11088191170Compositional biasNote=Thr-rich
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+20281031_11088191175Compositional biasNote=Thr-rich
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+21301114_12068231241DomainFibronectin type-III 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+2130828_9308231241DomainFibronectin type-III 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+2130934_10308231241DomainFibronectin type-III 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+20271114_12068191170DomainFibronectin type-III 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+2027730_8238191170DomainFibronectin type-III 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+2027828_9308191170DomainFibronectin type-III 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+2027934_10308191170DomainFibronectin type-III 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+20291114_12068231241DomainFibronectin type-III 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+2029828_9308231241DomainFibronectin type-III 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+2029934_10308231241DomainFibronectin type-III 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+1161114_1206-96620DomainFibronectin type-III 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+116143_230-96620DomainNote=Ig-like C2-type 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+116244_332-96620DomainNote=Ig-like C2-type 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+116337_424-96620DomainNote=Ig-like C2-type 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+11641_137-96620DomainNote=Ig-like C2-type 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+116429_517-96620DomainNote=Ig-like C2-type 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+116521_603-96620DomainNote=Ig-like C2-type 6
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+116630_725-96620DomainFibronectin type-III 1
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+116730_823-96620DomainFibronectin type-III 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+116828_930-96620DomainFibronectin type-III 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+116934_1030-96620DomainFibronectin type-III 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+19271114_12068021158DomainFibronectin type-III 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+1927730_8238021158DomainFibronectin type-III 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+1927828_9308021158DomainFibronectin type-III 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+1927934_10308021158DomainFibronectin type-III 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+18261114_12068191175DomainFibronectin type-III 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+1826730_8238191175DomainFibronectin type-III 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+1826828_9308191175DomainFibronectin type-III 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+1826934_10308191175DomainFibronectin type-III 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+18251114_12068191170DomainFibronectin type-III 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+1825730_8238191170DomainFibronectin type-III 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+1825828_9308191170DomainFibronectin type-III 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+1825934_10308191170DomainFibronectin type-III 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+20281114_12068191175DomainFibronectin type-III 5
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+2028730_8238191175DomainFibronectin type-III 2
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+2028828_9308191175DomainFibronectin type-III 3
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+2028934_10308191175DomainFibronectin type-III 4
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+21301239_13478231241Topological domainCytoplasmic
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+213025_12178231241Topological domainExtracellular
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+20271239_13478191170Topological domainCytoplasmic
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+202725_12178191170Topological domainExtracellular
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+20291239_13478231241Topological domainCytoplasmic
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+202925_12178231241Topological domainExtracellular
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+1161239_1347-96620Topological domainCytoplasmic
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+11625_1217-96620Topological domainExtracellular
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+19271239_13478021158Topological domainCytoplasmic
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+192725_12178021158Topological domainExtracellular
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+18261239_13478191175Topological domainCytoplasmic
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+182625_12178191175Topological domainExtracellular
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+18251239_13478191170Topological domainCytoplasmic
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+182525_12178191170Topological domainExtracellular
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+20281239_13478191175Topological domainCytoplasmic
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+202825_12178191175Topological domainExtracellular
HgeneNFASCchr1:204951148chr1:156844363ENST00000339876+21301218_12388231241TransmembraneHelical
HgeneNFASCchr1:204951148chr1:156844363ENST00000360049+20271218_12388191170TransmembraneHelical
HgeneNFASCchr1:204951148chr1:156844363ENST00000401399+20291218_12388231241TransmembraneHelical
HgeneNFASCchr1:204951148chr1:156844363ENST00000403080+1161218_1238-96620TransmembraneHelical
HgeneNFASCchr1:204951148chr1:156844363ENST00000404076+19271218_12388021158TransmembraneHelical
HgeneNFASCchr1:204951148chr1:156844363ENST00000404907+18261218_12388191175TransmembraneHelical
HgeneNFASCchr1:204951148chr1:156844363ENST00000513543+18251218_12388191170TransmembraneHelical
HgeneNFASCchr1:204951148chr1:156844363ENST00000539706+20281218_12388191175TransmembraneHelical
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+716148_193392791DomainNote=LRRCT
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+716194_283392791DomainIg-like C2-type 1
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+716299_365392791DomainIg-like C2-type 2
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+817148_193362761DomainNote=LRRCT
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+817194_283362761DomainIg-like C2-type 1
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+817299_365362761DomainIg-like C2-type 2
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+817148_193398797DomainNote=LRRCT
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+817194_283398797DomainIg-like C2-type 1
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+817299_365398797DomainIg-like C2-type 2
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+716116_137392791RepeatNote=LRR 2
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+71690_113392791RepeatNote=LRR 1
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+817116_137362761RepeatNote=LRR 2
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+81790_113362761RepeatNote=LRR 1
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+817116_137398797RepeatNote=LRR 2
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+81790_113398797RepeatNote=LRR 1
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+71633_423392791Topological domainExtracellular
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+81733_423362761Topological domainExtracellular
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+81733_423398797Topological domainExtracellular


Top

FusionGeneSequence for NFASC_NTRK1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1225aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAE
LLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLA
TRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQ

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1225aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAE
LLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLA
TRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQ

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1207aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLSIETTVTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLAERSVR
LTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVK
GEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYT
NSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHI
IENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCT
EGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFG
MSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIM

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1207aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLSIETTVTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLAERSVR
LTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVK
GEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYT
NSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHI
IENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCT
EGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFG
MSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIM

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1207aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLSIETTVTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLAERSVR
LTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVK
GEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYT
NSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHI
IENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCT
EGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFG
MSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIM

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1210aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLSIETTVTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLAERSVR
LTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVK
GEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYT
NSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHI
IENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFG
VCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIG
DFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVY

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1225aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAE
LLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLA
TRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQ

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1221aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTM
LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNC
LVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGREL

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1225aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAE
LLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLA
TRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQ

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1225aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAE
LLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLA
TRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQ

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1221aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTM
LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNC
LVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGREL

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1225aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPNPQHRLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAE
LLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLA
TRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQ

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1201aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTP
DIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKP
TVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFG
SPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVK
HDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLAERSVRLTWIPG
DANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVKGEGTRK
NNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYTNSTSGD
PVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQY
FSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLL
MVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIY
STDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQR

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1201aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTP
DIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKP
TVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFG
SPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVK
HDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLAERSVRLTWIPG
DANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVKGEGTRK
NNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYTNSTSGD
PVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQY
FSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLL
MVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIY
STDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQR

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1201aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTP
DIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKP
TVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFG
SPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVK
HDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLAERSVRLTWIPG
DANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVKGEGTRK
NNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYTNSTSGD
PVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQY
FSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLL
MVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIY
STDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQR

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1204aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTP
DIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKP
TVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFG
SPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVK
HDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLAERSVRLTWIPG
DANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVKGEGTRK
NNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYTNSTSGD
PVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQY
FSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGR
PLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSR
DIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGC

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1222aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLT
MLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRN
CLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRE

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1225aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRV
SMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIA
SGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRL
DCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG
PEPESVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSS
LSPTEGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAE
LLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLA
TRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQ

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1221aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTM
LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNC
LVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGREL

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_1218aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQH
QHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERP

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_1221aa
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRS
GTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQD
KRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVL
RGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILA
PGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQL
IRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPE
DQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDL
ELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERYRTSG
APPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPE
SVIGYSGEDYTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDASPSGVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTM
LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNC
LVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGREL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3675nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTT
CACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTC
CTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAG
CTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATG
CGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTG
GGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCC
ACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGT
GTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGC
TTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAG
GGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCAC

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3675nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTT
CACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTC
CTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAG
CTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATG
CGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTG
GGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCC
ACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGT
GTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGC
TTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAG
GGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCAC

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3621nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTTTCTATAGAAACAACAGTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGG
CTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGG
CATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATC
AACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAG
GGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTC
AAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTG
CCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACT
AACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTC
TTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGAT
GGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATC
ATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCC
TTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCC
GAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACC
GAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTG
CTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTAC
CTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGC
ATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTG
TACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAG
CTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATG
CGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTC

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3621nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTTTCTATAGAAACAACAGTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGG
CTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGG
CATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATC
AACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAG
GGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTC
AAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTG
CCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACT
AACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTC
TTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGAT
GGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATC
ATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCC
TTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCC
GAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACC
GAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTG
CTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTAC
CTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGC
ATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTG
TACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAG
CTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATG
CGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTC

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3621nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTTTCTATAGAAACAACAGTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGG
CTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGG
CATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATC
AACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAG
GGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTC
AAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTG
CCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACT
AACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTC
TTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGAT
GGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATC
ATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCC
TTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCC
GAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACC
GAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTG
CTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTAC
CTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGC
ATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTG
TACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAG
CTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATG
CGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTC

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3630nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTTTCTATAGAAACAACAGTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGG
CTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGG
CATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATC
AACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAG
GGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTC
AAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTG
CCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACT
AACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTC
TTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGAT
GGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATC
ATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGG
GAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAG
GAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGC
GTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGAT
GCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGG
ATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGT
GATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAG
AGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCC
TGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTAC
GCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCA

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3675nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTT
CACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTC
CTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAG
CTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATG
CGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTG
GGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCC
ACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGT
GTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGC
TTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAG
GGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCAC

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3663nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAG
CGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAG
GACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATG
CTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGAC
CTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAG
CTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGT
CTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGC
ACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTG
CTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTG
GAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGAT

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3675nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTT
CACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTC
CTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAG
CTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATG
CGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTG
GGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCC
ACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGT
GTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGC
TTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAG
GGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCAC

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3675nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTT
CACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTC
CTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAG
CTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATG
CGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTG
GGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCC
ACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGT
GTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGC
TTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAG
GGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCAC

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3663nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAG
CGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAG
GACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATG
CTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGAC
CTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAG
CTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGT
CTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGC
ACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTG
CTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTG
GAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGAT

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3675nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCTAACCCTCAACATAGGTTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTT
CACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTC
CTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAG
CTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATG
CGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTG
GGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCC
ACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGT
GTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGC
TTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAG
GGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCAC

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3603nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTC
ATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCA
GACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTC
TCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCT
CCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCC
ACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGG
GACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTG
GATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGG
TCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTG
GAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTG
GAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAG
CACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCC
CTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTAC
CTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGG
GATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTAC
CCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGC
CACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAG
AACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAG
ACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTC
CAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGAC
CCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTC
CTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTG
CATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATAC
TTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTT
GCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGAC
TTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTC
ATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGAT
GTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTT
GTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTAC
AGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACC
GAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCA
ATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGG
GAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGC

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3603nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTC
ATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCA
GACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTC
TCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCT
CCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCC
ACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGG
GACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTG
GATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGG
TCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTG
GAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTG
GAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAG
CACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCC
CTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTAC
CTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGG
GATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTAC
CCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGC
CACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAG
AACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAG
ACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTC
CAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGAC
CCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTC
CTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTG
CATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATAC
TTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTT
GCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGAC
TTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTC
ATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGAT
GTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTT
GTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTAC
AGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACC
GAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCA
ATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGG
GAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGC

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3603nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTC
ATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCA
GACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTC
TCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCT
CCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCC
ACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGG
GACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTG
GATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGG
TCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTG
GAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTG
GAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAG
CACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCC
CTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTAC
CTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGG
GATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTAC
CCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGC
CACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAG
AACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAG
ACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTC
CAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGAC
CCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTC
CTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTG
CATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATAC
TTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTT
GCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGAC
TTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTC
ATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGAT
GTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTT
GTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTAC
AGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACC
GAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCA
ATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGG
GAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGC

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3612nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTC
ATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCA
GACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTC
TCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCT
CCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCC
ACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGG
GACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTG
GATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGG
TCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTG
GAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTG
GAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAG
CACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCC
CTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTAC
CTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGG
GATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTAC
CCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGC
CACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAG
AACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAG
ACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTC
CAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGAC
CCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTC
CTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTG
CATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATAC
TTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAG
GTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCT
CGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGC
CCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGT
GGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGT
CTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGG
GATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAG
TTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAAC
ACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGC
TGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGAT

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3666nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATC
AAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAG
CAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACC
ATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGG
GACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGG
CAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAAC
TGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGC
CGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTG
GTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAG
TTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAG

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3675nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTG
TCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTC
GTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCC
TCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCG
GTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGA
GACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTG
GACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCT
GAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATG
AAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTC
CGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCC
ATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGC
CCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCT
TTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGA
AACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCC
CTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTT
CACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTC
CTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAG
CTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATG
CGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTG
GGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCC
ACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGT
GTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGC
TTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAG
GGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCAC

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3663nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAG
CGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAG
GACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATG
CTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGAC
CTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAG
CTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGT
CTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGC
ACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTG
CTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTG
GAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGAT

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3654nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3663nt
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAG
CGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAG
GACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATG
CTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGAC
CTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAG
CTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGT
CTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGC
ACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTG
CTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTG
GAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4146nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4202nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3994nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA

>In-frame_NFASC_ENST00000338586_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4072nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAA
GTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGT
CAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGT
GCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATC
CCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCA
GGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGT
GGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTG
GATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTA
CGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCC
ACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGC
CCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCT

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4146nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4202nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3994nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA

>In-frame_NFASC_ENST00000338515_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4072nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAA
GTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGT
CAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGT
GCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATC
CCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCA
GGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGT
GGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTG
GATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTA
CGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCC
ACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGC
CCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCT

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4101nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTTTCTATAGAAACAACAGTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGG
ACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAG
CCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAA
CTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCC
ATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGAT
CACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTG
GAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGA
CTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAA
GGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAA
ATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATT
GGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTG
TGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAA
CCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGC
TGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTA
TATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCC
CCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCT
GGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTA
CCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTG
GAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCAC
GCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACG
CCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCC
AGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCT

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4157nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTTTCTATAGAAACAACAGTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGG
ACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAG
CCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAA
CTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCC
ATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGAT
CACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTG
GAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGA
CTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAA
GGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAA
ATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATT
GGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTG
TGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAA
CCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGC
TGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTA
TATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCC
CCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCT
GGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTA
CCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTG
GAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCAC
GCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACG
CCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCC
AGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCT
AATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGTAGAGGATGTTCCTGCTTCTCTAGGCAAGGTCCCGTCATAGCAATT

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3949nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTTTCTATAGAAACAACAGTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGG
ACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAG
CCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAA
CTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCC
ATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGAT
CACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTG
GAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGA
CTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAA
GGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAA
ATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATT
GGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTG
TGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAA
CCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGC
TGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTA
TATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCC
CCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCT
GGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTA
CCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTG
GAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCAC
GCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACG

>In-frame_NFASC_ENST00000367171_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4027nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTTTCTATAGAAACAACAGTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGG
ACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAG
CCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAA
CTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCC
ATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGAT
CACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTG
GAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGA
CTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAA
GGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAA
ATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATT
GGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTC
CCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGA
GTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCA
GCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGT
CTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGC
TCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCA
CCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCAC
CGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAG
CGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGA
CTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCC
CCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGG

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4146nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4202nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3994nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA

>In-frame_NFASC_ENST00000367169_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4072nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAA
GTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGT
CAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGT
GCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATC
CCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCA
GGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGT
GGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTG
GATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTA
CGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCC
ACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGC
CCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCT

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4134nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGCAGTC
AGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACG
AAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGG
GCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTC
TAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGG
ACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCT
ATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAA
CCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAGGAGTTGC
AGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGC
CTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGC
CCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTC
GGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGC
CAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGG
AGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAA
CGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCT
GGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGT
TTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGC
TGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCA
GCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGAT
GAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCA
AGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCG
GCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTG
GCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCAT
CAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAA
GGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGT
CAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGT
GCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACAC
TAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCT
CTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGA
TGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACAT
CATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGC
CTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTC
CGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCAC
CGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCT
GCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTA
CCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGG
CATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCT
GTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCA
GCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCAT
GCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGT
CTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGC

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4190nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGCAGTC
AGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACG
AAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGG
GCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTC
TAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGG
ACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCT
ATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAA
CCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAGGAGTTGC
AGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGC
CTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGC
CCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTC
GGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGC
CAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGG
AGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAA
CGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCT
GGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGT
TTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGC
TGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCA
GCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGAT
GAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCA
AGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCG
GCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTG
GCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCAT
CAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAA
GGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGT
CAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGT
GCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACAC
TAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCT
CTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGA
TGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACAT
CATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGC
CTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTC
CGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCAC
CGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCT
GCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTA
CCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGG
CATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCT
GTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCA
GCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCAT
GCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGT
CTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGC
TCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGTAGAGGATGTTCC

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3982nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGCAGTC
AGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACG
AAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGG
GCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTC
TAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGG
ACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCT
ATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAA
CCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAGGAGTTGC
AGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGC
CTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGC
CCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTC
GGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGC
CAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGG
AGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAA
CGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCT
GGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGT
TTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGC
TGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCA
GCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGAT
GAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCA
AGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCG
GCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTG
GCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCAT
CAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAA
GGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGT
CAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGT
GCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACAC
TAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCT
CTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGA
TGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACAT
CATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGC
CTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTC
CGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCAC
CGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCT
GCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTA
CCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGG
CATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCT
GTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCA
GCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCAT
GCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGT

>In-frame_NFASC_ENST00000539706_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4060nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGCAGTC
AGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACG
AAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGG
GCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTC
TAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGG
ACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCT
ATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAA
CCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAGGAGTTGC
AGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGC
CTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGC
CCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTC
GGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGC
CAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGG
AGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAA
CGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCT
GGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGT
TTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGC
TGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCA
GCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGAT
GAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCA
AGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCG
GCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTG
GCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCAT
CAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAA
GGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGT
CAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGT
GCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACAC
TAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCT
CTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGA
TGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACAT
CATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGG
GGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAA
GGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGG
CGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGA
TGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGG
GATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGG
TGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGA
GAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCC
CTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTA
CGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGC
ACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATC

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4146nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4202nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3994nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA

>In-frame_NFASC_ENST00000339876_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4072nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAA
GTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGT
CAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGT
GCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATC
CCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCA
GGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGT
GGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTG
GATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTA
CGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCC
ACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGC
CCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCT

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4146nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4202nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3994nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA

>In-frame_NFASC_ENST00000367170_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4072nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAA
GTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGT
CAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGT
GCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATC
CCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCA
GGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGT
GGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTG
GATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTA
CGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCC
ACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGC
CCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCT

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4134nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGCAGTC
AGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACG
AAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGG
GCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTC
TAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGG
ACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCT
ATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAA
CCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAGGAGTTGC
AGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGC
CTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGC
CCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTC
GGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGC
CAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGG
AGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAA
CGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCT
GGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGT
TTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGC
TGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCA
GCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGAT
GAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCA
AGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCG
GCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTG
GCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCAT
CAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAA
GGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGT
CAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGT
GCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACAC
TAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCT
CTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGA
TGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACAT
CATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGC
CTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTC
CGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCAC
CGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCT
GCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTA
CCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGG
CATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCT
GTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCA
GCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCAT
GCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGT
CTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGC

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4190nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGCAGTC
AGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACG
AAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGG
GCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTC
TAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGG
ACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCT
ATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAA
CCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAGGAGTTGC
AGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGC
CTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGC
CCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTC
GGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGC
CAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGG
AGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAA
CGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCT
GGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGT
TTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGC
TGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCA
GCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGAT
GAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCA
AGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCG
GCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTG
GCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCAT
CAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAA
GGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGT
CAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGT
GCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACAC
TAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCT
CTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGA
TGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACAT
CATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGC
CTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTC
CGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCAC
CGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCT
GCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTA
CCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGG
CATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCT
GTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCA
GCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCAT
GCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGT
CTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGC
TCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGTAGAGGATGTTCC

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3982nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGCAGTC
AGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACG
AAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGG
GCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTC
TAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGG
ACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCT
ATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAA
CCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAGGAGTTGC
AGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGC
CTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGC
CCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTC
GGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGC
CAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGG
AGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAA
CGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCT
GGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGT
TTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGC
TGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCA
GCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGAT
GAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCA
AGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCG
GCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTG
GCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCAT
CAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAA
GGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGT
CAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGT
GCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACAC
TAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCT
CTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGA
TGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACAT
CATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGC
CTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTC
CGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCAC
CGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCT
GCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTA
CCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGG
CATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCT
GTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCA
GCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCAT
GCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGT

>In-frame_NFASC_ENST00000360049_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4060nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGCAGTC
AGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACG
AAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGG
GCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTC
TAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGG
ACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCT
ATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAA
CCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAGGAGTTGC
AGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGC
CTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGC
CCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTC
GGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGC
CAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGG
AGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAA
CGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCT
GGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGT
TTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGC
TGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCA
GCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGAT
GAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCA
AGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCG
GCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTG
GCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCAT
CAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAA
GGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGT
CAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGT
GCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACAC
TAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCT
CTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGA
TGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACAT
CATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGG
GGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAA
GGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGG
CGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGA
TGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGG
GATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGG
TGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGA
GAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCC
CTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTA
CGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGC
ACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATC

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4146nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4202nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA
GGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGC
ATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGT

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3994nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCT
GGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACT
GAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTT
CGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACC
TGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGC
GGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGAT
TGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCC
CGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCA
GCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGT
CTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCA

>In-frame_NFASC_ENST00000367172_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4072nt
GCACGGGCTGGTCTCTGCCCTAATGCGGCGGCTGGCGGCGAGAGGCGCTGCAGGGGACGCGGGGGAAGTGGCGGCGCCGGCAGCGGACAG
CTCGGACAGCGCCCAGGGCCGGAGCCCGAGCCCTTGGAGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGC
AGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCG
GCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCA
TGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCCTAACCCTCAACATAGGTTGACGCAGCCGCC
AACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCC
CAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGAT
TGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAG
GATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCA
GTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCA
GGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCA
CACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGG
CACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTA
CAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTC
CGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGA
CGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGAT
GGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAG
CAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCG
GATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCAC
ACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGAT
CCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCC
CACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCT
GAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGG
GGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGC
TGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGA
GAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCA
ACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCG
TGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCC
TGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCT
GCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGAC
CCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGG
AGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGT
CTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCT
GGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCT
CCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAA
GTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGT
CAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGT
GCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATC
CCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCA
GGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGT
GGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTG
GATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTA
CGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCC
ACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGC
CCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCT

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4177nt
GACAAGGAGCAGGGAAGCCAGGAATTATTTTGATTCCACCCAGGGCAGGGCTGCTGTGTTTTCTCTGAGGCCAACTTTCAGGGAAAAGAA
GGATCTTGCTGGGATTTTGCTCAGGCCTAAGTCTGCCAGCTGGGATGGCCTGGGGCCTAAGAAATGCCTAGCTTCCCTCCCCACCTGTCC
CCATGGAGGGAGACTGAGAAGACGCTGGATGAACCAGACCATGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCT
CCGCAGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAA
AGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGG
TCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGC
AGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGA
CACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTG
GCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGG
TGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGC
CTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAG
ACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGA
AGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCC
AGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGG
ACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCT
GCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACC
TTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAAC
CTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGT
ACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCC
GGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTA
AGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACC
AGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACC
GGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCT
CCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGG
ACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGC
CCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACT
ACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCC
GGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACC
GAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCA
TGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAG
TGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCC
CTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTT
TTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAA
ACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCC
TGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCA
AGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGC
AGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCA
TGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGG
ACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGC
AGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACT
GTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCC
GCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGG
TGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGT
TGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGG
ATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTG
GTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGC

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4233nt
GACAAGGAGCAGGGAAGCCAGGAATTATTTTGATTCCACCCAGGGCAGGGCTGCTGTGTTTTCTCTGAGGCCAACTTTCAGGGAAAAGAA
GGATCTTGCTGGGATTTTGCTCAGGCCTAAGTCTGCCAGCTGGGATGGCCTGGGGCCTAAGAAATGCCTAGCTTCCCTCCCCACCTGTCC
CCATGGAGGGAGACTGAGAAGACGCTGGATGAACCAGACCATGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCT
CCGCAGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAA
AGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGG
TCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGC
AGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGA
CACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTG
GCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGG
TGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGC
CTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAG
ACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGA
AGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCC
AGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGG
ACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCT
GCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACC
TTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAAC
CTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGT
ACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCC
GGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTA
AGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACC
AGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACC
GGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCT
CCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGG
ACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGC
CCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACT
ACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCC
GGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACC
GAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCA
TGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAG
TGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCC
CTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTT
TTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAA
ACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCC
TGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCA
AGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGC
AGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCA
TGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGG
ACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGC
AGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACT
GTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCC
GCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGG
TGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGT
TGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGG
ATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTG
GTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGC
ATGTGGGAAGGGACAGGTGGGGGCTGGGAGTAGAGGATGTTCCTGCTTCTCTAGGCAAGGTCCCGTCATAGCAATTATATTTATTATCCC

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_4025nt
GACAAGGAGCAGGGAAGCCAGGAATTATTTTGATTCCACCCAGGGCAGGGCTGCTGTGTTTTCTCTGAGGCCAACTTTCAGGGAAAAGAA
GGATCTTGCTGGGATTTTGCTCAGGCCTAAGTCTGCCAGCTGGGATGGCCTGGGGCCTAAGAAATGCCTAGCTTCCCTCCCCACCTGTCC
CCATGGAGGGAGACTGAGAAGACGCTGGATGAACCAGACCATGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCT
CCGCAGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAA
AGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGG
TCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGC
AGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGA
CACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTG
GCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGG
TGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGC
CTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAG
ACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGA
AGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCC
AGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGG
ACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCT
GCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACC
TTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAAC
CTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGT
ACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCC
GGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTA
AGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACC
AGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACC
GGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCT
CCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGG
ACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGC
CCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACT
ACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCC
GGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACC
GAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCA
TGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAG
TGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCC
CTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTT
TTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAA
ACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCC
TGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCA
AGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGC
AGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCA
TGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGG
ACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGC
AGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACT
GTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCC
GCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGG
TGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGT
TGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGG

>In-frame_NFASC_ENST00000404076_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_4103nt
GACAAGGAGCAGGGAAGCCAGGAATTATTTTGATTCCACCCAGGGCAGGGCTGCTGTGTTTTCTCTGAGGCCAACTTTCAGGGAAAAGAA
GGATCTTGCTGGGATTTTGCTCAGGCCTAAGTCTGCCAGCTGGGATGGCCTGGGGCCTAAGAAATGCCTAGCTTCCCTCCCCACCTGTCC
CCATGGAGGGAGACTGAGAAGACGCTGGATGAACCAGACCATGGTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCT
CCGCAGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAGGCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAA
AGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGG
TCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCAAGC
AGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGA
CACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTG
GCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGG
TGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGC
CTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAG
ACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGA
AGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCC
AGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGG
ACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCT
GCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACC
TTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAAC
CTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGT
ACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCC
GGAACCAGCTCATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTA
AGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACC
AGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACC
GGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCT
CCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGG
ACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGC
CCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACT
ACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCC
GGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACC
GAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCA
TGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAG
TGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCC
CTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTT
TTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAA
ACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCC
TGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTC
ACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCC
TGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGC
TGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGC
GGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGG
GTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCA
CACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTG
TGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCT
TCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGG
GACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACA
GCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGG

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_4017nt
GTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGCAGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAG
GCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGA
GCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGC
CATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGA
CCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACAT
CGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGG
GGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAA
GGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTT
CTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCT
GCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCT
CACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCT
CCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTT
TGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAG
CATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGG
GAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCC
AAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCA
TGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCT
TTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGA
TGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCAC
CAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAG
AAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCT
CTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGC
CAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCC
CAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAA
CAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAG
CGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAG
CCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACAT
GGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGA
GGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGA
AAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGA
GAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCT
CAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCAT
GACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGA
TGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTG
CCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCG
TGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTT
TGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCC
AGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCG
GGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGA
CTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGA
CGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTG
CATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCA
GCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGC
CGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAA

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_4073nt
GTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGCAGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAG
GCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGA
GCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGC
CATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGA
CCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACAT
CGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGG
GGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAA
GGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTT
CTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCT
GCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCT
CACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCT
CCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTT
TGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAG
CATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGG
GAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCC
AAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCA
TGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCT
TTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGA
TGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCAC
CAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAG
AAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCT
CTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGC
CAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCC
CAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAA
CAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAG
CGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAG
CCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACAT
GGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGA
GGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGA
AAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGA
GAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCT
CAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCAT
GACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGA
TGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTG
CCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCG
TGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTT
TGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCC
AGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCG
GGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGA
CTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGA
CGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTG
CATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCA
GCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGC
CGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAA
GTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGTAGAGGATGTTCCTGCTTCTCTAGGCAAGGTCCCGTCATA

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3865nt
GTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGCAGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAG
GCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGA
GCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGC
CATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGA
CCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACAT
CGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGG
GGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAA
GGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTT
CTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCT
GCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCT
CACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCT
CCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTT
TGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAG
CATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGG
GAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCC
AAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCA
TGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCT
TTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGA
TGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCAC
CAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAG
AAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCT
CTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGC
CAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCC
CAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAA
CAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAG
CGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAG
CCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACAT
GGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGA
GGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGA
AAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGA
GAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCT
CAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCAT
GACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGA
TGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTG
CCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCG
TGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTT
TGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCC
AGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCG
GGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGA
CTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGA
CGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTG
CATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCA

>In-frame_NFASC_ENST00000401399_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3943nt
GTTGATTGACTTATGTGCAATTTGGGACGCTGGAGTTTACCTTCCCTCCGCAGCCTGGAACAGAGCCTCCTCTGGTGTTGCAAGGAAGAG
GCTGAATGAGGCAGAGAAGCTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGA
GCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGC
CATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGA
CCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACAT
CGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGG
GGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAA
GGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTT
CTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCT
GCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCT
CACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCT
CCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTT
TGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAG
CATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGG
GAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCC
AAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCA
TGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCT
TTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGA
TGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCAC
CAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAG
AAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCT
CTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGC
CAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCC
CAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAA
CAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAG
CGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAG
CCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACAT
GGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGA
GGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGA
AAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGA
GAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCT
CAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCAT
GACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGA
TGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCT
TGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGA
CTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCT
CATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGA
TGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTT
TGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTA
CAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCAC
CGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGC
AATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCG
GGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGG

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3896nt
CTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGG
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC
CGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAA
TACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGG

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3952nt
CTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGG
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC
CGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAA
TACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGG

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3744nt
CTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGG
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGAC
ATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATG
CTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCAC
CAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGC
TTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCC
GTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGC
CAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTG
CCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAG
ATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCA
CGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCC

>In-frame_NFASC_ENST00000404907_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3822nt
CTGAGTGCTGTCCAGGAGGCCCAGTTAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGG
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGAT
CTGACGCAGCCGCCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAA
GGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCT
GGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACG
GCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCT
CCTTTGACGCTCCAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGAC
AAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGC
TTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAAC
CACCCTGACATGTACAGTGCCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTT
CGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCT
GATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCC
AACAAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCT
CCTGGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCG
GCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAAC
ACCTCCAACGAGCATGGCTACCTGCTGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTC
ATTCGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAA
GGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTAC
ACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAG
GACCAGGTGGCCAGAAGGGGCACCACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAG
GATGACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGT
TACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTG
GAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAG
TTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCG
TATGTCAACTACCAGTTCCGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGA
GCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACC
TCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCT
CGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAG
TCCGTCATCGGTTACTCCGGAGAAGATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCG
GTGGCTGTGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGG
ATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACC
GAGGGCAAAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAG
CGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAG
GACAAGATGCTGGTGGCTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATG
CTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGAC
CTCAACCGCTTCCTCCGATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAG
CTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGT
CTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGC
ACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTG
CTCTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTG
GAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGAT
GTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGT

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000392302_chr1_156844363_+_3871nt
TAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCT
GGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCA
AGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACT
GGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCA
GTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGC
AGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCC
CGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACG
GAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGC
AGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAG
GAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAAT
GCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTA
ATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACA
CGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGT
GTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGG
TGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGC
TGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGA
CGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACT
ACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGG
GCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCA
CGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAA
ACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGC
TAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGA
GCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTG
GGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCA
TTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTG
ACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCT
ACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAG
TCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAG
ATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTG
CCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTC
CAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAG
GCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGG
AGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGG
AGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCG
TCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATG
CCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGA
TGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTG
ATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGA
GCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCT
GGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACG
CCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCAC
CTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCC
CCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGTAGAGG

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000368196_chr1_156844363_+_3927nt
TAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCT
GGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCA
AGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACT
GGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCA
GTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGC
AGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCC
CGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACG
GAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGC
AGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAG
GAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAAT
GCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTA
ATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACA
CGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGT
GTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGG
TGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGC
TGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGA
CGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACT
ACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGG
GCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCA
CGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAA
ACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGC
TAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGA
GCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTG
GGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCA
TTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTG
ACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCT
ACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAG
TCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAG
ATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTG
CCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTC
CAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAG
GCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGG
AGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGG
AGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCG
TCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATG
CCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGA
TGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTG
ATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGA
GCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCT
GGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACG
CCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCAC
CTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCC
CCATAGCTCCCAGCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGTGGGGGCTGGGAGTAGAGG

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000524377_chr1_156844363_+_3719nt
TAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCT
GGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCA
AGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACT
GGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCA
GTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGC
AGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCC
CGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACG
GAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGC
AGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAG
GAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAAT
GCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTA
ATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACA
CGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGT
GTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGG
TGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGC
TGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGA
CGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACT
ACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGG
GCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCA
CGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAA
ACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGC
TAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGA
GCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTG
GGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCA
TTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTG
ACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCT
ACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAG
TCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAG
ATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTG
CCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTC
CAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAG
GCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGG
AGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGGCACTGAAGG
AGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCG
TCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATGGACCTGATG
CCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGA
TGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCAAGATTGGTG
ATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGA
GCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCAAGCAGCCCT
GGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACG
CCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGGCCCAGGCAC

>In-frame_NFASC_ENST00000513543_chr1_204951148_+_NTRK1_ENST00000358660_chr1_156844363_+_3797nt
TAAAGCGGCTCGAGGTGACAAGACCCCGAGTGCTGGGGAGCAGGGAGCAGGGCCAGGTGCCGAGGATGGCCAGGCAGCCACCGCCGCCCT
GGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAGCCATCGAAATTCCTATGGATCTGACGCAGCCGCCAACCATCACCA
AGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACT
GGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTGATTGACTTCCGCA
GTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGC
AGGTGTCTAAATCTCCTCTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACCCCC
CGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACG
GAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGC
AGAAGAACCCTTTCACCCTCAAGGTCCTCACCAACCACCCTTATAATGACTCGTCCTTAAGAAACCACCCTGACATGTACAGTGCCCGAG
GAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGTGGCATGGACCTCCTGCTGGAAT
GCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGGTACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTA
ATAAGGCCCTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCACA
CGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGT
GTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGG
TGGCCGGAGACACCATCATCTTCCGGGACACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGC
TGGCCAACGCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTCTTTACAACCGGA
CGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACT
ACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGG
GCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCA
CGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGATGACGAGCCGCTCTATATTGGAA
ACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGC
TAGACCAAGACCTGGCCAAGGCCTACCTCACCGTGCTAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGA
GCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTG
GGGTCTGGCATGACCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTCCGTGTCA
TTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTG
ACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCT
ACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAG
TCTACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCCGGAGAAG
ATTACACTAACAGCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGCCTGGCCGTCTTTG
CCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAATGTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTC
CAGAGGATGGGCTGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCAAAGGCTCTGGGCTCCAAG
GCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTCCCCCTCAGGTGTTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGG
AGCTGGGGGAGGGCGCCTTTGGGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGGCTGTCAAGG
CACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTGAGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCT
TCTTCGGCGTCTGCACCGAGGGCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCCGATCCCATG
GACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCCTGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCG
CTGCGGGGATGGTGTACCTGGCGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGACTGGTGGTCA
AGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACCGTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGC
CGCCCGAGAGCATCCTGTACCGTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCACCTACGGCA
AGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGCAGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAG
AGGTCTACGCCATCATGCGGGGCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGCAAGCCCTGG
CCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAGGGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCT


Top

FusionGenePPI for NFASC_NTRK1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NFASCNTRK1ABL1, NGF, MATK, PLCG1, GRB2, CAV1, NTF3, SQSTM1, SH2B1, SHC1, SH2B2, ARHGAP32, FRS2, NTRK1, RAP1A, SHC3, GIPC1, RGS19, PTPN1, TRAF6, NEDD4, CBL, HSP90AA1, HSPA4, CDC37, NEDD4L, MYC, SGSM3, SORBS1, TNK2, SNX17, SNX27, GAREML, SOS2, PIK3CA, GAREM, PIK3C2B, ARHGEF40, PIK3R1, PIK3R2, SOS1, PIK3CB, PML, UBC, AMFR, CBLB, GAB1, EPN1, PIK3C2A, ANKRD13A, DOCK4, TRIO, LGR5, WRNIP1, RABEP1, PDGFRA, KANK2, RABGEF1, VAV2, TBC1D15, PTPN11, GAK, IRS2, PCDHGC3, EPS15, LRRN3, HUWE1, ACVR1B, MIB1, OFD1, PIBF1, ZNF497, TXN, CAT, FABP3, JUP, DSG1, TGM1, CFL1, LCN1, HIST2H4A, DSP, PFN1, LGALS3BP, HIST1H2BL, LTF, S100A9, IGLL5, TGM3, DSC1, LYZ, DCD, LEKR1, ENO2, PPIA, BTN1A1, XRCC5, XRCC6, HLA-A, GSTP1, ABCB7, PA2G4, PRDX1, HDGF, HSPA4L, TBC1D10B, HP1BP3, KIF26B, SYT4, RHOBTB3, NOTCH3, GAB2, ATAD3A, RBM15B, KCNH2, USP15, PDCD11, RBFOX2, RBM14, RNF31, ADNP, ZC3HAV1, MAP7D1, USP4, JAK1, PTPRS, PDGFRB, HIST1H1C, USP11, PPFIBP1, INTS6, VGF, ARHGEF11, SMPD4, SYNPO2, HNRNPM, SLC27A4, DDX41, EGFR, H1FX, ASAP1, HIST1H1B, RRBP1, EPHA2, KIDINS220, CPT1A, UNC5B, IGF1R, DDR2, AUP1, XPR1, RP9, MARK2, REPS1, EMD, SMARCA4, DDX21, DAB2IP, C7, MSTO1, CDC27, ZNF629, ASAP2, NCAPH2, SRBD1, ATAD3B, TCF12, PLEKHA6, INPPL1, PRPF4B, DPM1, SMARCA1, FIP1L1, DLGAP5, PLEKHH3, TRA2A, ACIN1, DDX10, TAX1BP1, SMARCA5, RABEP2, DDX5, MYO1C, SRSF10, DNAJA2, RET, TRA2B, MYEF2, PNPLA6, SLC12A2, TAF6L, RSL1D1, ARAP3, DDX18, ABL2, KHDRBS1, CERK, SRSF7, SPTLC2, PBXIP1, DNAJA1, IQGAP3, DDX31, ZC3H11A, PLRG1, CNP, FMR1, HIP1R, KIAA1429, CDC5L, ARAP1, ZNF316, SMARCC2, EML5, VANGL2, SLC25A1, UNC5C, SLC16A1, RFC1, ZKSCAN1, CHD1, PTK7, SMARCD2, AP3B1, YTHDC2, AKAP8L, RPL15, CTNND1, PHLDB1, ZNF574, DDX27, TOM1, RASA1, MORC2, MTCH2, IMMT, SMARCC1, ROR2, CAPN2, DNAJC11, SYT11, AP2A1, LBR, MEPCE, NCAPD3, CEP97, QKI, LRRC41, LPCAT2, EPS15L1, LAS1L, TMEM131, CWF19L2, NCAPG2, MAP4K5, CCP110, ARHGEF2, ITGAV, ZC3H18, CWC22, VIM, FAM171A1, TMEM132A, SRSF9, SOGA1, NKRF, RBL1, FMNL3, TOP1, PIGT, RBM15, GBAS, EDC3, WDR5, NOP2, GNL2, SLC25A11, RRP1B, FAM115A, INTS5, SLC25A5, AAK1, HERC5, CCNT1, FERMT2, CDC42BPA, MRPL28, UBAP2, WWP2, SEC24B, HNRNPU, GPD2, FXR2, DHX15, SLC25A22, SSR1, PLXNB2, PROX1, TEX10, USP19, FTSJ3, TMEM59, GTF3C2, PGAM5, CPSF1, KLHL22, TMX3, SIN3A, NOP58, PTCD3, RPRD2, DHX9, PICALM, FARP1, SLC25A6, ERLIN2, SMARCD1, RHOT1, ALDH1B1, SGPL1, USP9X, HNRNPF, KIAA1211, MAPK7, DDX17, GSE1, DVL3, MRPL44, DNAJB6, GTPBP4, HNRNPA0, PLXNA4, SFXN3, NAT10, DDX28, SNW1, MYO6, MRPL24, PRRT4, FAM98A, PURA, DHX29, C1QBP, TRIP4, TBK1, RBM28, ZNF609, POLRMT, PCDHB3, XRN1, HSD17B11, DKC1, DHX30, CDK13, SENP3, LPHN2, GPATCH4, NDUFA9, RASA4, MCCC1, DDX24, RPL14, RPS8, ATG2B, MYO1B, PTPN12, CEBPZ, ILVBL, RALY, KIF14, ZC3H7A, MOV10, MAP4K4, DHX57, RBMX, FXR1, MRPS35, SART1, MARK3, DECR1, CCDC88A, ANKLE2, PRPF31, LARP7, RPL10, PACS1, RPL13, FAM120A, SLC25A13, ADAR, CDK1, HNRNPR, CSNK1E, DLG1, LEMD3, NOL9, IFT122, NCLN, STK11IP, GATAD2B, CHERP, LARP4, MAP3K1, HNRNPUL2, PPIL2, ESYT2, MYH10, RPL8, UQCRC2, NDUFA10, HAX1, HELLS, MED14, RBM42, CHCHD3, RPL7, ABCD3, TUBGCP6, MRPS9, SNRNP200, IGF2BP3, LRCH3, MRPL3, RSBN1L, SAFB, TUBG1, ALDH16A1, ARHGEF12, EPB41L5, AP2A2, SRSF6, HLTF, PTPLAD1, TMPO, AGO2, POP1, RPS9, HDAC6, ILF3, VWA8, ABCB1, SCRIB, GTF3C5, YBX1, RBM4, PTPN9, PRPF8, BRD3, TRIM24, CLASP2, MADD, TCF4, MAP4K3, TSC2, DDX23, RPL7A, RRP12, PRKD2, TRMT1L, EDC4, CSTF3, RPS2, NDUFS2, RPL13A, PTPRR, ATP7A, EXD2, IK, HIP1, MATR3, IGSF3, PTPRF, SPATA5L1, EFTUD2, RPS3A, TUBGCP5, TTN, GIT1, PATL1, NUP160, PDE4B, SUN2, PTPN23, RPS6, DCP1A, CDC73, MEX3A, EIF2AK2, RPL3, PPP1R10, SRP72, ELAVL3, NOM1, RPL18, CEP170, THRAP3, MED17, MRPS7, DDX20, PDPR, SH3PXD2A, DBN1, DAP3, OAS3, STT3B, COPE, MED12, AP3D1, CAPRIN1, PHB2, U2SURP, BSG, TECR, FARSA, HSD17B12, RPL4, HNRNPUL1, PPFIA1, MRPS22, TBL3, GNL3, MTA2, CPSF2, ATP2B1, AP3B2, PPIP5K2, DDX56, ASCC3, FMNL2, SMCHD1, MYBBP1A, SRPK2, RHOT2, SRP68, PUM1, SLC25A3, SRPK1, RPL19, BEND3, SEC61A1, LSG1, NOC3L, TNKS1BP1, GTF3C3, TUBGCP3, PRPF40A, TRMT10C, URGCP, XRN2, MSH3, XRCC1, GEMIN4, DIS3L2, BCLAF1, SBF2, DHTKD1, ATXN2, ARID4B, TOR1AIP1, RPL29, NAA16, PRPF6, KIFAP3, TMEM33, WASF2, NACAD, LIG3, POLE, CKAP4, TCEB3, MTA1, GNA13, DHX38, PHF6, ELAVL4, DDX3X, CTR9, PRPF19, CAMSAP2, PRMT3, SH3PXD2B, SCAF8, MAGED1, ILF2, TONSL, PPP1R12A, SRSF5, KIAA0020, PTBP1, CAD, ACSL3, CHD1L, STAU1, MRPL38, DVL2, GNAI3, RPL10A, RPL6, MRPS5, CDK11B, MRPS34, PES1, ATP5C1, STXBP3, HNRNPLL, CHTF18, VPS39, SART3, COPA, PRPF3, UBE2O, ABCF2, HNRNPH3, EARS2, DHX40, ARHGEF7, EMC1, CASK, PTK2, SORT1, OGT, ATP12A, LMNB1, SLC4A7, PFKP, VDAC2, RBM25, ATL3, DHX36, TFIP11, EXOSC10, GTF3C1, SRSF1, PPP6C, TRAPPC9, RAD21, DNAJC13, ACOT1, ZC3H4, SRRM1, NDUFS3, DYRK1A, INTS1, SF3B2, EHHADH, MYO9B, ASCC2, WDR11, RPN1, EHD4, WDR91, SMARCAL1, NBAS, PI4KA, PAF1, EIF2B4, NUP107, EMC2, SYNE1, KLHL13, TBL1XR1, DNAJC10, SEC16A, METTL13, C7orf50, CDC42BPB, CLCN5, PGM3, DOCK7, ALYREF, POLR3A, TOP3A, WDR48, WDR81, DOCK1, CSNK2A2, CYC1, TLE3, THOC2, EIF2S3, MYO5A, SNX9, TARDBP, NAP1L4, CRKL, YTHDF2, PYGB, PABPC1, LTV1, PSMD4, KTN1, UBTF, WDR6, FUBP3, UBXN7, PHB, PDXP, CNOT3, TBL2, LLGL1, PLOD1, AHSA1, AAAS, ERGIC1, LARP4B, CYFIP1, DNM1, TARS2, ACSL1, ATXN1L, WDR59, SUCLA2, MLH1, CSNK2B, SYNCRIP, WDR36, FAM91A1, MTDH, UBE3C, CAPN1, BRIX1, DNAJB11, EDEM3, PLOD3, CLASP1, DPYSL3, MED16, NONO, EPM2AIP1, NT5DC2, ADRBK2, RPTOR, TELO2, MRPL37, PRKACB, ELMO1, TRAPPC8, ANAPC1, NIPSNAP1, EWSR1, PIK3R4, POLD1, IQGAP1, PRRC2A, COG1, ANKRD44, TFRC, DIEXF, FHOD1, SERPINH1, SPATA5, MED1, ABCF3, ZSWIM8, LMNA, HAT1, PABPC4, SMC4, HADH, RNGTT, TUBGCP2, ZNF598, SKIV2L2, GNB2L1, LARP1, DIP2B, BCR, IDH3B, LSM14A, FBL, NDUFS1, APPL2, USP39, SMC2, HCFC1, LANCL1, POLR2B, UPF2, CCBL2, MRPL15, MAGED2, AGK, GNPAT, AIMP1, GTF3C4, KDM1A, SCAMP3, RDH11, SRGAP2, CRNKL1, RFC5, PFKL, SPTBN1, PHOX2A, VDAC3, HNRNPA1, WDR26, DNM2, HAUS5, LCMT2, MCM7, CLINT1, UGDH, ACO1, TRIM46, PHKB, USP10, PCF11, YTHDF3, AARS2, FIGNL1, SFPQ, ATP5A1, NUP133, CPSF3, ANKRD28, PNN, C9orf64, ABCF1, ATL1, NAP1L1, HSPA9, MCCC2, FKBP5, CNOT1, TAF6, NEMF, UHRF1, SDHA, PELP1, HADHB, OAT, NEK9, AP3M1, PRKCA, LPCAT1, MRPL39, AFG3L2, WASF1, HNRNPL, RALGAPB, HK1, GBA, PLD3, CPSF7, HADHA, PDE12, DCX, LIMA1, HNRNPA2B1, POLR2A, MYH9, ZNF207, DDX55, ELP3, EIF2B5, MICAL1, TTI1, NES, HSDL1, GPSM1, PPM1F, C4orf27, SRRM2, OSBPL9, STAT3, IRF2BPL, KLC2, P3H1, STAT5B, UQCRC1, PCK2, CCAR2, TBC1D5, SACM1L, QARS, XPO4, CHD4, KIF2A, TACC3, NCL, BTAF1, RARS2, NCKAP1, EIF3D, RPS3, YME1L1, EIF4A3, HAUS6, HNRNPDL, MON2, G3BP2, WDHD1, CSNK1A1, SDAD1, RPS25, LSM14B, AP1M1, CCDC47, HNRNPK, DNMT1, NUP85, CUL5, TANC1, STAT1, COG5, STOML2, CDC45, OSBPL11, CIC, ABCD2, ARFGEF1, TROVE2, GBF1, SRPRB, UBE3A, GTPBP1, SCCPDH, RPS4X, PRPF4, ACTL6A, CCAR1, KIAA1033, TRAPPC12, HNRNPA3, FASTKD5, LYN, VPS18, PGRMC2, NUP214, AIFM1, TSG101, PPP6R3, OCRL, GANAB, IARS, SARS2, ATP2A2, EXOC1, NCAPH, TTC27, GNE, SRC, MIOS, ZCCHC8, GOLGA2, CARM1, ABCC1, PRMT5, LEO1, LMNB2, USP8, DARS, GYS1, APEH, ZYG11B, AKAP1, ELAVL1, MCM5, LRWD1, PSMC1, MOGS, TRIM28, EXOC6, LUC7L3, ANKFY1, NSUN2, HDAC2, G3BP1, QRICH1, INTS3, UBR1, XAB2, DYNC1LI1, TUFM, GAA, EXOC8, DHX8, LIMCH1, CLTC, SRPR, RNH1, ABI2, AQR, PREP, PPM1E, COG2, SEPT9, IDH2, MFN2, EXOC4, VPS33B, INTS4, GNB1, MSH6, HNRNPC, ERLIN1, EPRS, LRRC49, RPAP1, MCM3, PSMC4, PSMD3, GNL1, TRIP13, CUX1, PFAS, MAP1S, LRCH1, MRPL19, ABCD1, EIF3F, PDS5B, SMC3, KIF4A, FANCD2, IRF2BP1, SMC1A, RNF20, CLPX, NOC2L, DLAT, CTBP1, APPL1, NAA35, VPS45, PUM2, RELA, NUP210, RANBP9, DNAJC9, WRN, PRKAA1, AIMP2, VPS8, MAD1L1, MRE11A, ATP13A1, ATG7, CEP131, TRIM33, SLC25A10, HERC4, LRRFIP1, POLR1C, IPO9, GEMIN5, METAP2, SMG8, WASL, PPP1CB, SCFD1, RANBP3, RB1, CLTA, RNF40, SNRNP70, NCSTN, MGEA5, NARS, EIF4E, INPP4A, TFB2M, SEL1L, ARGLU1, PPP4R1, ANKRD17, TTK, RAD50, KIF2C, GOLGA3, TRAPPC11, GIGYF2, MSI2, CYFIP2, CDK5, HBS1L, IFT81, UFL1, PFKM, SMARCAD1, WDR35, PRIM2, NAMPT, PSMD2, MSH2, SOGA3, HEATR6, SFXN1, ARCN1, OGDH, FDPS, PSMC5, INSR, IRF2BP2, DDOST, ATXN2L, CSNK2A1, EIF2S2, MAP4, LTN1, COPB1, BRAT1, SMC6, SNRPN, RIC8A, SKIV2L, EIF4A1, KIF15, CLPTM1L, KPNA1, VPS16, VPS26B, RNPEP, RBM39, PMS1, FAM129B, RFC3, NUP155, RBM26, KIF21A, GAPVD1, C2CD5, WAPAL, RPS13, ARHGEF1, ACTR1A, KLC4, ISLR2, DCK, LRRC8A, STT3A, BOP1, RPN2, AFTPH, ORC3, FOXK1, CD2BP2, PDHA1, PPP6R1, PANK4, KIAA0196, WDR77, CHUK, DDX1, COLGALT1, VAPA, PPME1, CAMSAP1, RABL6, RTCB, SRRT, PIK3C3, NUMA1, STXBP1, OTUB1, UBAP2L, EXOC5, LRRC59, EXOC3, RQCD1, FLII, COPG2, USP5, XPOT, TIMM44, ATP1A1, SBF1, ARPC1B, PLK1, OSBPL8, BAG6, PPP6R2, FAM98B, VPS52, FADS2, EIF4G2, EIF4G3, HSPA8, POLR1B, PSMC6, SFSWAP, VPS33A, MCM10, AVL9, RINT1, PPIB, FBXL18, MFAP1, KIF13B, ATP2C1, ERCC2, CTTNBP2NL, WDR82, VARS, KPNA6, MIA3, HEATR1, SEC23B, AASDHPPT, POLR3B, ALDH18A1, PIKFYVE, MPP6, MRI1, CAPN7, RAB3GAP2, NCAPD2, UGGT1, IKBKAP, KDM3B, CLNS1A, FEN1, ECH1, AP2B1, HNRNPH1, RARS, AGPS, FANCI, PYCR2, EHD1, BUB3, KIF5B, SYMPK, PC, ACAA2, NDC80, PRRC2C, MTHFD1L, FASN, RANBP6, VPS11, NUP93, STRN, SCYL1, DDX19A, GTF2I, SEC23A, CTNNB1, STAM, VPRBP, VCL, PDHB, SEC24D, ERCC4, GRN, ACADM, HSPA6, ERCC6L, RPL5, ARHGAP17, DDX6, MAPK8IP3, TJP1, RIOK1, ERP29, PARG, NUP205, PALLD, COG4, TPP2, EPB41, VAC14, FUS, ZW10, KIF11, GET4, MCM6, EIF2S1, CSDE1, DHX16, GFM1, RABGAP1, TTC28, XPO1, EXOC2, DCTN1, ACBD3, RFC4, PARP1, COPG1, GPRIN1, EIF3C, CUL1, C14orf166, RTL1, STRIP1, MRPS2, PPP2R5D, EIF4G1, EXOSC4, MCM4, SEC63, WDR1, CUL4B, CRMP1, NSF, RNMT, BLVRA, UBE4A, PCBP1, MLLT4, RNF214, ARVCF, CKAP5, NUP188, SMCR8, CTNNA1, SYT1, PCM1, KNTC1, GFPT1, THYN1, SARM1, LPIN1, TIA1, NUP54, PKN1, SUMO4, DICER1, KIF3A, IPO8, CLIC4, PSMD14, GLG1, ABCE1, SMEK1, NCAPG, PPP5C, RTF1, IARS2, PDS5A, PHGDH, RPS6KA3, LONP1, ROCK1, CDK6, LARS, KPNA3, HNRNPAB, MCM2, PPP2R2A, HSP90AB2P, VCPIP1, PCBP2, RPA1, SEC24A, HECTD3, RCC2, DIS3, SMS, KHSRP, CLGN, GNAS, FOCAD, SEC23IP, ACOT7, HK2, CCDC6, MFN1, WDR7, CNN3, KIAA1524, RAB3GAP1, OXCT1, SBNO1, PRPSAP2, ACTR3, CTPS2, TMEM43, FAM21A, LRRC47, VAPB, SCYL2, STRN4, NAE1, SREK1, TFG, SF3A1, CDK2, GPKOW, GPHN, PDCD4, U2AF2, UNC45A, VPS35, NAA15, ASNS, TOP2B, ACO2, AGAP3, ROCK2, NUDT21, NPEPPS, ADD1, AP1G1, CPSF6, DNAJC2, RPS5, CTPS1, IDH1, SEC24C, KIF3B, ACTR2, CPD, EEF1D, SAMHD1, ETFB, DNM1L, LRPPRC, MCMBP, RBM12, OPA1, FARSB, UPF1, PCMT1, USO1, COG3, CLPTM1, TLK2, PRUNE, ASPSCR1, MARS, PYCR1, TCERG1, MED23, PITPNB, ARPC2, UBE4B, DBR1, ETFA, BICD1, KLC1, WDR70, PXDN, DPYSL4, USP7, CLUH, TBRG4, OGFR, SV2A, PDCD6IP, PDLIM5, PSMC2, TRAP1, DRG1, SMEK2, TCP1, TNPO2, CALD1, ARIH2, POR, FKBP3, DCTN2, NPM1, USP48, IPO13, NUP88, NNT, TAOK1, PPWD1, PSPC1, PABPN1, POLA1, MTR, BCCIP, RUVBL2, C16orf62, SORD, PPP2CA, STRN3, RUVBL1, PPP1CA, CACTIN, RPAP3, VPS51, TUBB3, PRKDC, HSPA5, CCDC132, MRPS27, RBBP4, CAPZA1, SLC4A1AP, THUMPD3, FAF1, CDK4, GSTO1, NCBP1, CAPZB, SNRPA, TXLNG, NELFE, MUT, DYNC1LI2, CTTN, DYNC1I2, TIMELESS, CBS, TTLL12, ESYT1, LAMB1, KARS, PPIL4, LRRC40, TXLNA, RAD23B, TBCE, ACAD9, THADA, GCN1L1, SLK, PNKP, ACLY, ATP6V0A1, VTA1, TXNDC5, OXSR1, ACACA, TNPO3, CCDC93, TIPRL, RAN, HOOK3, PSME4, YWHAQ, PPM1G, PSMC3, SCARB2, EXOC7, DFNA5, TRMT6, CPNE3, SLC3A2, G6PD, EIF2B1, SF3B1, EXOC6B, HGS, DYNC1H1, DNAJC7, CANX, TSR1, TTC37, DARS2, ZPR1, SERBP1, HSP90AB1, TBCB, UCHL5, IMPDH2, PUF60, RANGAP1, PDXDC1, YWHAH, LARS2, ZC3H15, GMPS, YWHAG, SUPV3L1, SPAG9, IMPDH1, HSD17B10, GTF2F1, EXOSC9, CUL3, ARHGAP35, TUBB4B, EIF5B, KIF5C, PDIA6, LDHA, ATL2, SNX1, SF3B3, SRM, MAP2, DIAPH1, DBH, NHLRC2, ELP2, GRPEL1, TWF1, WBP11, ERP44, SERPINB6, VCP, HSPH1, CMTR1, KIF1A, USP47, EML4, PRMT1, ATP6V1B2, GPS1, CAND1, CLPB, PCNA, RPLP0, CORO7, TUBB, ANXA2, API5, SUPT16H, RUFY1, KIAA1279, PDIA3, ACTA1, SF3A3, DCTN4, CUL2, WARS, PGM2, NELFB, XPO5, UGP2, HSP90B1, GSR, SHMT2, IPO11, EIF3E, RDX, DNAJB1, KIAA1598, AARS, EFTUD1, HEATR5B, ENAH, TNPO1, LIG1, NRD1, DLD, STRA6, PAFAH1B1, NT5C2, SSRP1, NTRK3, HDGFRP2, EIF3G, CSE1L, ACAT1, TBCD, NAA10, MTHFD1, RALA, EIF3A, PRPS1, ISOC1, IPO7, HNRNPD, GAPDH, U2AF1, SUPT5H, PSMD8, RPS6KA1, NUF2, GDAP1, VPS26A, TUBB2B, CDH2, TMOD1, CBR1, HDLBP, CS, HSPD1, LMAN1, EIF3B, DDB1, PSMD1, DPYSL2, STRAP, RTN4, FLNA, AHCY, HSD17B4, GOLIM4, SPTAN1, IPO4, PKM, EIF3I, SF1, BZW2, XPO7, ACADVL, STAG2, DPP9, RECQL, GDI1, GARS, MMS19, EIF2A, IPO5, TCOF1, RAB5C, SAP30BP, VDAC1, TUBA1A, SEPT2, DBNL, PLAA, TOMM70A, NOMO1, ISYNA1, CTNNA2, EEF1B2, PAK4, NELFCD, GSPT1, KPNB1, MAP1A, COPS4, YWHAZ, KPNA2, EIF4B, PLS3, COPS3, HSPBP1, AP1B1, NASP, DDX39A, LUC7L2, APMAP, SEC31A, SRSF2, TXNRD1, ATP1A3, RRM2, COG7, FSD1, PRDX4, DCPS, NCAM1, NUDCD1, NAA25, RPL9, NPLOC4, YWHAB, ATP1B1, LSS, DNAAF5, METTL16, COPS6, XPNPEP1, ELAC2, PUS7, CCT3, SFN, AGL, PAPOLA, SRSF11, ALDH2, PSME2, CKMT1B, LDHB, PSMA7, RAB11A, PPP2R1A, GNAO1, LUC7L, COPS5, IMPA1, RRM1, PPID, DPP3, KIAA0368, SLC1A5, YARS, NUP50, TPM4, ITGB1, SARS, SEZ6L2, GTF2F2, GART, ALDOC, PSMD11, EIF6, DFFA, RAP1GDS1, NELFA, CARS, CCT4, P4HB, FSCN1, PSMD13, PSMA5, CCT5, PAPSS1, OSBP, SAE1, ATP6V1A, LMAN2, YWHAE, SRP54, IDE, SNX2, RPSA, BZW1, SND1, UBQLN1, MAPK1, CALR, MARCKSL1, SUGT1, TBC1D4, GLRX3, LETM1, HMGB1, EIF3H, SLC9A3R1, DDX42, LAP3, PRKCSH, EEF2, PSMD6, BCAP31, ANXA11, ACTN1, CCT6A, PSMA4, ANXA5, CCT7, EIF3L, FUBP1, SSB, PGM1, MAPRE1, UBA2, AMPD2, PPAT, CLIC1, CCT2, ECHS1, LTA4H, USP14, CCT8, ANK2, PDIA4, TPR, NRCAM, MAT2A, HTATSF1, THOP1, RANBP1, RSRC2, NMT1, AK2, EEF1G, TPM3, PSMA3, EIF4H, GLUD1, CAP1, TKT, ATP5B, TXNL1, STIP1, HMGB2, GGH, HSPB1, CALU, RPL17, PSMA1, RSRC1, ST13, PRDX6, EIF3J, PNPT1, APEX1, TARS, MARCKS, PSMA6, EEF1A1, COPB2, NUDT5, HSPA1A, ERO1L, ME2, RPH3A, ESD, EIF5, ADSL, RUFY3, DPYSL5, ANXA6, NUDC, NANS, GOT2, GLDC, PSAT1, SET, PAK2, UBA6, UCHL1, L1CAM, PGLS, MAP1B, CCDC124, EIF3M, VAT1, PAFAH1B3, ALDOA, IRGQ, UBQLN2, NACA, OLA1, ACTN4, ARHGDIA, PSMD7, CACYBP, PSMA2, CPNE1, MDH2, PGAM1, DDX46, ACAT2, ALCAM, HARS, CKB, FKBP4, ASNA1, GPI, INA, HYOU1, CHGA, MDH1, EZR, ANP32A, UBA1, ARG1, ANP32B, PAICS, ATIC, TPI1, PPA1, TALDO1, PGK1, DDX39B, TLN1, AKR1B1, ENO1, NGFR, TPTE


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneNTRK1chr1:204951148chr1:156844363ENST00000368196+716469_490392791SQSTM1
TgeneNTRK1chr1:204951148chr1:156844363ENST00000392302+817469_490362761SQSTM1
TgeneNTRK1chr1:204951148chr1:156844363ENST00000524377+817469_490398797SQSTM1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NFASC_NTRK1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneNTRK1P04629DB00321AmitriptylineHigh affinity nerve growth factor receptorsmall moleculeapproved
TgeneNTRK1P04629DB00619ImatinibHigh affinity nerve growth factor receptorsmall moleculeapproved
TgeneNTRK1P04629DB08896RegorafenibHigh affinity nerve growth factor receptorsmall moleculeapproved

Top

RelatedDiseases for NFASC_NTRK1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNFASCC0036341Schizophrenia1PSYGENET
TgeneNTRK1C0020074HSAN Type IV8ORPHANET;UNIPROT
TgeneNTRK1C0005586Bipolar Disorder1CTD_human
TgeneNTRK1C0017638Glioma1CTD_human
TgeneNTRK1C0027796Neuralgia1CTD_human
TgeneNTRK1C0027819Neuroblastoma1CTD_human
TgeneNTRK1C0033975Psychotic Disorders1CTD_human
TgeneNTRK1C0036341Schizophrenia1CTD_human
TgeneNTRK1C0273115Lung Injury1CTD_human
TgeneNTRK1C0752347Lewy Body Disease1CTD_human