FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24126

FusionGeneSummary for NF2_PIAS1

check button Fusion gene summary
Fusion gene informationFusion gene name: NF2_PIAS1
Fusion gene ID: 24126
HgeneTgene
Gene symbol

NF2

PIAS1

Gene ID

4771

8554

Gene nameneurofibromin 2protein inhibitor of activated STAT 1
SynonymsACN|BANF|SCHDDXBP1|GBP|GU/RH-II|ZMIZ3
Cytomap

22q12.2

15q23

Type of geneprotein-codingprotein-coding
Descriptionmerlinmoesin-ezrin-radixin likemoesin-ezrin-radixin-like proteinmoesin-ezrin-radizin-like proteinneurofibromin 2 (bilateral acoustic neuroma)schwannomerlinschwannominE3 SUMO-protein ligase PIAS1AR interacting proteinDEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1DEAD/H box-binding protein 1E3 SUMO-protein transferase PIAS1RNA helicase II-binding proteingu-binding proteinprotein inhibitor of activated STAT pr
Modification date2018051920180522
UniProtAcc

P35240

O75925

Ensembl transtripts involved in fusion geneENST00000347330, ENST00000413209, 
ENST00000338641, ENST00000403435, 
ENST00000361452, ENST00000403999, 
ENST00000334961, ENST00000353887, 
ENST00000361166, ENST00000397789, 
ENST00000361676, 
ENST00000249636, 
ENST00000545237, ENST00000567417, 
Fusion gene scores* DoF score12 X 7 X 7=5884 X 3 X 4=48
# samples 134
** MAII scorelog2(13/588*10)=-2.17730453180791
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NF2 [Title/Abstract] AND PIAS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNF2

GO:0008285

negative regulation of cell proliferation

12444102|20178741

HgeneNF2

GO:0022408

negative regulation of cell-cell adhesion

17210637

HgeneNF2

GO:0042532

negative regulation of tyrosine phosphorylation of STAT protein

12444102

HgeneNF2

GO:0046426

negative regulation of JAK-STAT cascade

12444102

TgenePIAS1

GO:0016925

protein sumoylation

18579533

TgenePIAS1

GO:0033235

positive regulation of protein sumoylation

17696781|21965678


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVMESOTCGA-LK-A4O7-01ANF2chr22

30000101

+PIAS1chr15

68378644

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000347330ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000347330ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000347330ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000413209ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000413209ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000413209ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000338641ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000338641ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000338641ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000403435ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000403435ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000403435ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000361452ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000361452ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000361452ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000403999ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000403999ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000403999ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000334961ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000334961ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000334961ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000353887ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000353887ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000353887ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000361166ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000361166ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000361166ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000397789ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000397789ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000397789ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000361676ENST00000249636NF2chr22

30000101

+PIAS1chr15

68378644

+
In-frameENST00000361676ENST00000545237NF2chr22

30000101

+PIAS1chr15

68378644

+
5CDS-intronENST00000361676ENST00000567417NF2chr22

30000101

+PIAS1chr15

68378644

+

Top

FusionProtFeatures for NF2_PIAS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NF2

P35240

PIAS1

O75925

Functions as an E3-type small ubiquitin-like modifier(SUMO) ligase, stabilizing the interaction between UBE2I and thesubstrate, and as a SUMO-tethering factor. Plays a crucial role asa transcriptional coregulation in various cellular pathways,including the STAT pathway, the p53 pathway and the steroidhormone signaling pathway. In vitro, binds A/T-rich DNA. Theeffects of this transcriptional coregulation, transactivation orsilencing, may vary depending upon the biological context.Together with PRMT1, may repress STAT1 transcriptional activity,in the late phase of interferon gamma (IFN-gamma) signaling.Sumoylates PML (at'Lys-65' and 'Lys-160') and PML-RAR and promotestheir ubiquitin-mediated degradation. PIAS1-mediated sumoylationof PML promotes its interaction with CSNK2A1/CK2 which in turnpromotes PML phosphorylation and degradation (By similarity).Enhances the sumoylation of MTA1 and may participate in itsparalog-selective sumoylation. Plays a dynamic role inadipogenesis by promoting the SUMOylation and degradation of CEBPB(By similarity). {ECO:0000250|UniProtKB:O88907,ECO:0000269|PubMed:14500712, ECO:0000269|PubMed:19136629,ECO:0000269|PubMed:21965678}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014577_6348652Compositional biasNote=Ser-rich
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+01411_458652DomainSAP
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014124_2888652DomainPINIT
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+01419_238652MotifNote=LXXLL motif
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014368_3808652MotifNuclear localization signal
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+01456_648652MotifNuclear localization signal
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014462_4738652RegionSUMO1-binding
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014520_6158652RegionNote=4 X 4 AA repeats of N-T-S-L
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014520_5238652RepeatNote=1
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014557_5608652RepeatNote=2
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014598_6018652RepeatNote=3%3B approximate
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014612_6158652RepeatNote=4%3B approximate
TgenePIAS1chr22:30000101chr15:68378644ENST00000249636+014320_3978652Zinc fingerSP-RING-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNF2chr22:30000101chr15:68378644ENST00000334961+115327_46538451Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000338641+116327_46538596Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000347330+110327_465381312Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000353887+115327_46538406Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000361166+117327_46538571Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000361452+116327_465381665Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000361676+116327_46538531Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000397789+117327_46538573Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000403435+117327_46538541Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000403999+116327_46538591Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000413209+15327_46538166Compositional biasNote=Glu-rich
HgeneNF2chr22:30000101chr15:68378644ENST00000334961+11522_31138451DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000338641+11622_31138596DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000347330+11022_311381312DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000353887+11522_31138406DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000361166+11722_31138571DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000361452+11622_311381665DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000361676+11622_31138531DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000397789+11722_31138573DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000403435+11722_31138541DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000403999+11622_31138591DomainFERM
HgeneNF2chr22:30000101chr15:68378644ENST00000413209+1522_31138166DomainFERM


Top

FusionGeneSequence for NF2_PIAS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NF2_ENST00000347330_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000347330_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000413209_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000413209_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000338641_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000338641_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000403435_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000403435_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000361452_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000361452_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000403999_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000403999_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000334961_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000334961_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000353887_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000353887_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000361166_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000361166_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000397789_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000397789_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000361676_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS

>In-frame_NF2_ENST00000361676_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_682aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
TRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNTSMAVTLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLR
VSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPTEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPS
LPAVDTSYINTSLIQDTRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPTTSSQMFLDQLSAGGSTS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NF2_ENST00000347330_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000347330_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000413209_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000413209_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000338641_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000338641_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000403435_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000403435_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000361452_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000361452_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000403999_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000403999_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000334961_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000334961_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000353887_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000353887_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000361166_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000361166_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000397789_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000397789_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000361676_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA

>In-frame_NF2_ENST00000361676_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2046nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NF2_ENST00000347330_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2718nt
TGCGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCG
GCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGT
GCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGC
AGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAG
GCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCG
GGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGA
TGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGAC
GCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGC
GGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTA
CCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCC
CACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAAC
CCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTA
GTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAG
ATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAAC
CAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAG
AAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAA
GGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTC
TACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACA
TTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTA
TGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTAC
AGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATA
AAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTT
CCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTG
CTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGAT
TAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAG
ACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAA
CCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGA
GCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCC
CAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTC
CTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGACTGCCTGT

>In-frame_NF2_ENST00000347330_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2718nt
TGCGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCG
GCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGT
GCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGC
AGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAG
GCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCG
GGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGA
TGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGAC
GCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGC
GGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTA
CCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCC
CACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAAC
CCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTA
GTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAG
ATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAAC
CAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAG
AAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAA
GGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTC
TACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACA
TTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTA
TGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTAC
AGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATA
AAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTT
CCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTG
CTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGAT
TAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAG
ACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAA
CCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGA
GCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCC
CAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTC
CTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGACTGCCTGT

>In-frame_NF2_ENST00000413209_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2718nt
TGCGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCG
GCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGT
GCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGC
AGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAG
GCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCG
GGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGA
TGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGAC
GCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGC
GGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTA
CCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCC
CACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAAC
CCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTA
GTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAG
ATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAAC
CAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAG
AAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAA
GGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTC
TACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACA
TTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTA
TGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTAC
AGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATA
AAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTT
CCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTG
CTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGAT
TAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAG
ACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAA
CCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGA
GCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCC
CAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTC
CTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGACTGCCTGT

>In-frame_NF2_ENST00000413209_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2718nt
TGCGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCG
GCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGT
GCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGC
AGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAG
GCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCG
GGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGA
TGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGAC
GCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGC
GGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTA
CCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCC
CACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAAC
CCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTA
GTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAG
ATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAAC
CAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAG
AAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAA
GGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTC
TACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACA
TTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTA
TGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTAC
AGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATA
AAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTT
CCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTG
CTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGAT
TAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAG
ACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAA
CCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGA
GCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCC
CAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTC
CTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGACTGCCTGT

>In-frame_NF2_ENST00000338641_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2716nt
CGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCGGC
CGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGTGC
CGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAG
GGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGC
CTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGG
GCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATG
GAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGACGC
AAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGCGG
CGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTACC
ATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCCCA
CATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAACCC
ACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTAGT
TCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAGAT
CACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAACCA
AAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAGAA
ATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAAGG
AATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTCTA
CTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACATT
CAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTATG
GAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTACAG
GAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATAAA
AACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTTCC
CTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTGCT
GTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGATTA
GATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAGAC
CTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAACC
ACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGAGC
AGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCCCA
GATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTCCT
TTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGACTGCCTGTGT

>In-frame_NF2_ENST00000338641_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2716nt
CGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCGGC
CGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGTGC
CGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAG
GGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGC
CTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGG
GCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATG
GAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGACGC
AAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGCGG
CGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTACC
ATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCCCA
CATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAACCC
ACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTAGT
TCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAGAT
CACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAACCA
AAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAGAA
ATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAAGG
AATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTCTA
CTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACATT
CAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTATG
GAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTACAG
GAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATAAA
AACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTTCC
CTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTGCT
GTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGATTA
GATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAGAC
CTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAACC
ACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGAGC
AGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCCCA
GATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTCCT
TTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGACTGCCTGTGT

>In-frame_NF2_ENST00000403435_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2686nt
GTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCT
GCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCT
CCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGG
ACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGG
CTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCT
CTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGC
CTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCAT
TTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCA
GACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCT
GCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCAT
CCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGC
TTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGAC
TTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTG
AATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACC
TCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATAT
CTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAA
GAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACA
ATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTT
TGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGAT
GAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGAT
GGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACC
ATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAA
GGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTC
ATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAAT
CAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTAT
ACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGC
AGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATC
ATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAA
CTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTA

>In-frame_NF2_ENST00000403435_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2686nt
GTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCT
GCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCT
CCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGG
ACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGG
CTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCT
CTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGC
CTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCAT
TTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCA
GACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCT
GCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCAT
CCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGC
TTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGAC
TTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTG
AATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACC
TCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATAT
CTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAA
GAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACA
ATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTT
TGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGAT
GAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGAT
GGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACC
ATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAA
GGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTC
ATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAAT
CAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTAT
ACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGC
AGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATC
ATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAA
CTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTA

>In-frame_NF2_ENST00000361452_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2657nt
GATGCAGCGCGGCCCCGTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTC
CCCGGCATCTCCGGCCCGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCC
CGTCCCCCAACTCCCCTTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCC
GGGCAGCCGGCCACCATGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGG
TCCCGGGCCTGAGCCCCGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCAC
CGTGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTT
GGGCTACGCCGGGAGAAACAAGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGT
GCAAATGAAAATTAAGGAACTCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAG
TCCTATGCCAGCAACTTTGTCTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCT
TCTGGGACCTAAACATGAACTGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATT
TTATGATTTACTGGATGAACTGATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTT
GACACCACAACAAGTGCAGCAAATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTG
TTTATCAGAAACCAGTTGTCCACAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTA
CCTTCCACCTACAAAAAATGGCGTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACC
AAACACGATTGTTGTTTCTTGGACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCT
TCTTCAGAGGTTACGAGCAAAGGGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGA
AATAGCTACAACCAGCCTAAGGGTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCA
TCTACAATGTTTTGACGCAACTCTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATA
TGAACACCTTATTATTGATGGCTTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTG
GGCACCGATGAGATCAAAAAAGGAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCA
GGTAGCGTCTCACCACCAGTCCTCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGA
AGAGCCATCTGCCAAGAGGACCTGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATC
TCCAGTATCCCGCACCCCAAGCCTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACAT
GACACCCATGCCTTACGACTTACAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGC
TGCAGCAGCAGCAGTTTCAGATGATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTT
AAGTGCAGGAGGCAGTACTTCTCTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGA
AAGCCATAGCCACACCGTCACAAACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATT
CCCAGGCCCTGCTGCTCCCATCCCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTT
TAGAAAAGTATACAAGCGTGTTTTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTA

>In-frame_NF2_ENST00000361452_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2657nt
GATGCAGCGCGGCCCCGTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTC
CCCGGCATCTCCGGCCCGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCC
CGTCCCCCAACTCCCCTTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCC
GGGCAGCCGGCCACCATGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGG
TCCCGGGCCTGAGCCCCGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCAC
CGTGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTT
GGGCTACGCCGGGAGAAACAAGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGT
GCAAATGAAAATTAAGGAACTCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAG
TCCTATGCCAGCAACTTTGTCTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCT
TCTGGGACCTAAACATGAACTGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATT
TTATGATTTACTGGATGAACTGATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTT
GACACCACAACAAGTGCAGCAAATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTG
TTTATCAGAAACCAGTTGTCCACAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTA
CCTTCCACCTACAAAAAATGGCGTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACC
AAACACGATTGTTGTTTCTTGGACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCT
TCTTCAGAGGTTACGAGCAAAGGGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGA
AATAGCTACAACCAGCCTAAGGGTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCA
TCTACAATGTTTTGACGCAACTCTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATA
TGAACACCTTATTATTGATGGCTTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTG
GGCACCGATGAGATCAAAAAAGGAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCA
GGTAGCGTCTCACCACCAGTCCTCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGA
AGAGCCATCTGCCAAGAGGACCTGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATC
TCCAGTATCCCGCACCCCAAGCCTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACAT
GACACCCATGCCTTACGACTTACAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGC
TGCAGCAGCAGCAGTTTCAGATGATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTT
AAGTGCAGGAGGCAGTACTTCTCTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGA
AAGCCATAGCCACACCGTCACAAACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATT
CCCAGGCCCTGCTGCTCCCATCCCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTT
TAGAAAAGTATACAAGCGTGTTTTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTA

>In-frame_NF2_ENST00000403999_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2641nt
GTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCC
CGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCC
TTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCA
TGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCC
CGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACC
ATGGACGCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGA
AACAAGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAG
GAACTCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACT
TTGTCTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACAT
GAACTGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGAT
GAACTGATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTG
CAGCAAATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGT
TGTCCACAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAA
AATGGCGTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTT
TCTTGGACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGA
GCAAAGGGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGC
CTAAGGGTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGAC
GCAACTCTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATT
GATGGCTTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCA
AAAAAGGAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCAC
CAGTCCTCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAG
AGGACCTGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACC
CCAAGCCTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTAC
GACTTACAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTT
TCAGATGATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGT
ACTTCTCTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACC
GTCACAAACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCT
CCCATCCCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAG
CGTGTTTTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATC

>In-frame_NF2_ENST00000403999_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2641nt
GTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCC
CGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCC
TTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCA
TGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCC
CGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACC
ATGGACGCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGA
AACAAGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAG
GAACTCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACT
TTGTCTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACAT
GAACTGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGAT
GAACTGATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTG
CAGCAAATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGT
TGTCCACAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAA
AATGGCGTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTT
TCTTGGACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGA
GCAAAGGGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGC
CTAAGGGTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGAC
GCAACTCTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATT
GATGGCTTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCA
AAAAAGGAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCAC
CAGTCCTCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAG
AGGACCTGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACC
CCAAGCCTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTAC
GACTTACAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTT
TCAGATGATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGT
ACTTCTCTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACC
GTCACAAACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCT
CCCATCCCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAG
CGTGTTTTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATC

>In-frame_NF2_ENST00000334961_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2547nt
TCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTC
CGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGT
GGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCG
CCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGG
ACGCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACA
AGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAAC
TCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGT
CTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAAC
TGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAAC
TGATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGC
AAATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTC
CACAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATG
GCGTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTT
GGACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAA
AGGGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAA
GGGTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAA
CTCTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATG
GCTTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAA
AGGAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGT
CCTCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGA
CCTGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAA
GCCTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACT
TACAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAG
ATGATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTT
CTCTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCA
CAAACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCA
TCCCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTG
TTTTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAG

>In-frame_NF2_ENST00000334961_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2547nt
TCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTC
CGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGT
GGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCG
CCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGG
ACGCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACA
AGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAAC
TCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGT
CTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAAC
TGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAAC
TGATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGC
AAATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTC
CACAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATG
GCGTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTT
GGACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAA
AGGGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAA
GGGTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAA
CTCTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATG
GCTTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAA
AGGAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGT
CCTCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGA
CCTGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAA
GCCTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACT
TACAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAG
ATGATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTT
CTCTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCA
CAAACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCA
TCCCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTG
TTTTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAG

>In-frame_NF2_ENST00000353887_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2527nt
CCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAGGGTCCTCGC
GGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGCCTGTGCAGC
AACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGGGCCATCGCT
TCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAAT
TGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGACGCAAACACGAA
CTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGCGGCGGTTCCCA
CAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTACCATTCCACAA
CTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCCCACATCTTACA
TCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAACCCACCAGTCTA
GCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTAGTTCCATGGAT
ATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAGATCACTTCCCA
CCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAACCAAAGCGACCC
AGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAGAAATTGGAAGA
AACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAAGGAATCCGGAT
CATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTCTACTATGTCCA
CTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACATTCAGATGAAT
GAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTATGGAAATCCTA
AAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTACAGGAAGTTTCT
GCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATAAAAACAAGAAA
GTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTTCCCTATCTCCC
ACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTGCTGTAGACACA
AGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGATTAGATTTCTTT
CCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAGACCTCCTACAC
TCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAACCACCAATGGA
AGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGAGCAGCACGGAC
ACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCCCAGATCGAATG
AACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTCCTTTTTTTAGG
GAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGACTGCCTGTGTGATAAAACA

>In-frame_NF2_ENST00000353887_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2527nt
CCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAGGGTCCTCGC
GGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGCCTGTGCAGC
AACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGGGCCATCGCT
TCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAAT
TGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGACGCAAACACGAA
CTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGCGGCGGTTCCCA
CAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTACCATTCCACAA
CTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCCCACATCTTACA
TCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAACCCACCAGTCTA
GCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAAATCAGTAGTTCCATGGAT
ATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCACAAGAAGATCACTTCCCA
CCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGCGTGGAACCAAAGCGACCC
AGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGGACTGCAGAAATTGGAAGA
AACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAGGGAATAAGGAATCCGGAT
CATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGGGTTTCTCTACTATGTCCA
CTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACTCTTTACATTCAGATGAAT
GAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGCTTGTTTATGGAAATCCTA
AAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAGGAAGTACAGGAAGTTTCT
GCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCCTCAAATAAAAACAAGAAA
GTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACCTGTCCTTCCCTATCTCCC
ACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGCCTTCCTGCTGTAGACACA
AGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTACAAGGATTAGATTTCTTT
CCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGATGATCAAGACCTCCTACAC
TCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCTCTGCCAACCACCAATGGA
AGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACAAACAGGAGCAGCACGGAC
ACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATCCCCACCCCAGATCGAATG
AACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTTTTTTTTCCTTTTTTTAGG
GAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGACTGCCTGTGTGATAAAACA

>In-frame_NF2_ENST00000361166_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2275nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA
AACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATC
CCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTT
TTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGAC

>In-frame_NF2_ENST00000361166_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2275nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA
AACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATC
CCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTT
TTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGAC

>In-frame_NF2_ENST00000397789_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2275nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA
AACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATC
CCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTT
TTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGAC

>In-frame_NF2_ENST00000397789_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2275nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA
AACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATC
CCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTT
TTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGAC

>In-frame_NF2_ENST00000361676_chr22_30000101_+_PIAS1_ENST00000249636_chr15_68378644_+_2275nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA
AACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATC
CCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTT
TTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGAC

>In-frame_NF2_ENST00000361676_chr22_30000101_+_PIAS1_ENST00000545237_chr15_68378644_+_2275nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGCATCAGACAACAGTCAGCGCTTTCGAGAAACCTGTTTTGCATTTGCCTTGACACCACAACAAGTGCAGCAA
ATCAGTAGTTCCATGGATATTTCTGGGACCAAATGTGACTTCACAGTACAGGTCCAGTTAAGGTTTTGTTTATCAGAAACCAGTTGTCCA
CAAGAAGATCACTTCCCACCCAATCTTTGTGTGAAAGTGAATACAAAACCTTGCAGCCTTCCAGGTTACCTTCCACCTACAAAAAATGGC
GTGGAACCAAAGCGACCCAGCCGACCAATTAATATCACCTCACTTGTCCGACTGTCCACAACAGTACCAAACACGATTGTTGTTTCTTGG
ACTGCAGAAATTGGAAGAAACTATTCCATGGCAGTATATCTTGTAAAACAGTTGTCCTCAACAGTTCTTCTTCAGAGGTTACGAGCAAAG
GGAATAAGGAATCCGGATCATTCTAGAGCTTTAATTAAAGAGAAGTTGACTGCGGATCCAGACAGTGAAATAGCTACAACCAGCCTAAGG
GTTTCTCTACTATGTCCACTTGGTAAAATGCGGCTGACAATTCCGTGTCGGGCCCTTACATGTTCTCATCTACAATGTTTTGACGCAACT
CTTTACATTCAGATGAATGAGAAAAAACCAACCTGGGTTTGTCCTGTCTGTGATAAGAAGGCTCCATATGAACACCTTATTATTGATGGC
TTGTTTATGGAAATCCTAAAGTACTGTACAGACTGTGATGAAATACAATTTAAGGAGGATGGCACTTGGGCACCGATGAGATCAAAAAAG
GAAGTACAGGAAGTTTCTGCCTCTTACAATGGAGTCGATGGATGCTTGAGCTCCACATTGGAGCATCAGGTAGCGTCTCACCACCAGTCC
TCAAATAAAAACAAGAAAGTAGAAGTGATTGACCTAACCATAGACAGTTCATCTGATGAAGAGGAAGAAGAGCCATCTGCCAAGAGGACC
TGTCCTTCCCTATCTCCCACATCACCACTAAATAATAAAGGCATTTTAAGTCTTCCACATCAAGCATCTCCAGTATCCCGCACCCCAAGC
CTTCCTGCTGTAGACACAAGCTACATTAATACCTCCCTCATCCAAGACTATAGGCATCCTTTCCACATGACACCCATGCCTTACGACTTA
CAAGGATTAGATTTCTTTCCTTTCTTATCAGGAGACAATCAGCATTACAACACCTCCTTGCTTGCCGCTGCAGCAGCAGCAGTTTCAGAT
GATCAAGACCTCCTACACTCGTCTCGGTTTTTCCCGTATACCTCCTCACAGATGTTTCTTGATCAGTTAAGTGCAGGAGGCAGTACTTCT
CTGCCAACCACCAATGGAAGCAGTAGTGGCAGTAACAGCAGCCTGGTTTCTTCCAACAGCCTAAGGGAAAGCCATAGCCACACCGTCACA
AACAGGAGCAGCACGGACACGGCATCCATCTTTGGCATCATACCAGACATTATTTCATTGGACTGATTCCCAGGCCCTGCTGCTCCCATC
CCCACCCCAGATCGAATGAACTTGGCAGAAAGAAGAGAACTTTGTGCTCTGTTTTACCTTACTCTGTTTAGAAAAGTATACAAGCGTGTT
TTTTTTCCTTTTTTTAGGGAAAAAATTAAAAGAAATGTACAGAGAACAAAACTATATTTTCAGTTTTACTTTTGTATATAAATCTAAGAC


Top

FusionGenePPI for NF2_PIAS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NF2SGSM3, MED28, HGS, EZR, NF2, SOS1, PXN, SLC9A3R1, SPTBN1, SDCBP, SCHIP1, VPRBP, DDB1, CUL4A, RIT1, AKT1, AGAP2, CD44, AMOT, PYGO2, WWC1, GPS1, CCNB1IP1, PPP1R8, AMOTL2, YAP1, KDM1A, MOV10, NXF1, RNF166, CCNL2, LATS1, LATS2, AMOTL1, DNAJA1, DNAJA2, DYNLL1, HSPH1, HSPA4, TUBA1C, DBN1, SLC33A1, KSR1, SRRM2, LIG3, TFCP2, TMPO, CLCC1, UBA3, EMD, LEMD2, CHMP4B, LIN7C, TRIM21, IST1, RPA1, ZBTB10, EPDR1, PDCD6IP, PRPF38B, XRCC1, PNKP, RPA2, PGAM5, MVP, SP1, TBP, PRKAG2, DBT, CPNE3, PARP1, PANX1, SLC25A6, WBP2, CHMP1A, OR4X1, GPD2, LPCAT1, PYCR2, CD2AP, ATP6V1H, LUC7L3, TUBB4A, GRPEL1, XRCC4, CBR4, HSPA9, TSG101, SRPR, RBBP4, NIT1, TBL2, EIF3M, DLAT, XRCC5, PEF1, CDK1, TSN, IRS4, TAF15, RPL18A, ERLIN2, XRCC6, RFC1, DNPEP, KPNA2, RPS5, SLC25A1, SLC25A5, MPP2, AFG3L2, MPP6, S100A8, TGM3, GRN, MTTP, GTPBP1, PABPC4, MTPAP, RPL15, SERBP1, RPL13, CALML5, RPL14, PDHX, RPL13A, TOP1, PRPF19, MC1R, DHX30, SLC25A12, SMAD3, RPL18, SLC25A11, AKAP8L, SSRP1, VTA1, RPS3, PREB, SERPINB3, PIP4K2C, FARSA, EIF2S3, RPS7, CPSF6, ATAD3A, ATAD3B, LSM12, GRSF1, SLC25A13, HDAC1, RPS2, SLC25A22, CDK5, RPL8, PDCD6, SH3GL1, RFC3, CBS, GMDS, SARS2, DSC1, SEC23B, SMC3, HSD17B4, G3BP2, DECR1, RPL10, DHX15, SUPT16H, SMC1A, EIF3J, C1orf35, RARS, TPR, SF3B4, RCC2, RPS3A, PHB, IGF2BP1, DARS, RPL3, PRDX1, SFXN2, SLC25A3, RPL4, CAPRIN1, RPS4X, CKAP5, S100A9, LANCL2, IKBIP, PRKCA, GLTSCR2, CDH1, EGFR, CTDSPL, PTPRA, PTPRG, PPFIA1, TSPYL4, PDCL, CYLD, UBE2APIAS1STAT1, DNMT3A, STAB2, UBE2I, SUMO1, SP3, TP53, CSRP2, AR, MX1, SUMO2, SIAH1, SIAH2, AKT1, ZMIZ2, BRCA1, MBD1, CREB1, SREBF2, GLUL, MITF, NCOR1, PPARG, TRIM27, ZNF76, JUN, HIC1, DDX5, SATB1, MAML1, DCLRE1A, DNMT3B, RBBP6, SAFB, ESR1, PPP1CA, MDC1, PRDM1, MDM2, CHUK, DNM1, PML, ATXN7, SRSF1, NFATC1, CEBPE, CEBPA, FLI1, CSNK2A1, CASP8AP2, MYB, SERBP1, ZMYND11, RAD54L2, PLAG1, NR1H3, NR1H2, PPARGC1B, PPARGC1A, BARD1, PAXIP1, PPP1CC, HTT, ATXN1, SMAD7, PRPF40A, SKIL, SMAD4, SMAD1, SOX2, SGTA, YWHAZ, SPOP, SUMO3, SHFM1, CBS, L3MBTL2, CEP250, TRIM63, TRIM55, ZNF451, PIAS1, FOXA1, HIF1A, ID1, KLC1, FRAT1, ERP44, POLK, VPS16, PIAS2, PTK2, TERF2, TRIM5, HECTD2, GSK3B, NCOA3, PSME3, TRIM35, GTF2IRD1, NR0B2, EP300


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NF2_PIAS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NF2_PIAS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNF2C0027832Neurofibromatosis 29CTD_human;ORPHANET;UNIPROT
HgeneNF2C0025500Mesothelioma6CTD_human
HgeneNF2C0345967Malignant mesothelioma4CTD_human
HgeneNF2C0007134Renal Cell Carcinoma1CTD_human
HgeneNF2C0025286Meningioma1CTD_human;HPO
HgeneNF2C0032229Pleural Neoplasms1CTD_human
TgenePIAS1C0037274Dermatologic disorders1CTD_human
TgenePIAS1C0311375Arsenic Poisoning1CTD_human