FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24120

FusionGeneSummary for NF2_GRAP2

check button Fusion gene summary
Fusion gene informationFusion gene name: NF2_GRAP2
Fusion gene ID: 24120
HgeneTgene
Gene symbol

NF2

GRAP2

Gene ID

4771

9402

Gene nameneurofibromin 2GRB2 related adaptor protein 2
SynonymsACN|BANF|SCHGADS|GRAP-2|GRB2L|GRBLG|GRID|GRPL|GrbX|Grf40|Mona|P38
Cytomap

22q12.2

22q13.1

Type of geneprotein-codingprotein-coding
Descriptionmerlinmoesin-ezrin-radixin likemoesin-ezrin-radixin-like proteinmoesin-ezrin-radizin-like proteinneurofibromin 2 (bilateral acoustic neuroma)schwannomerlinschwannominGRB2-related adapter protein 2GRB-2-like proteinGRB2-related protein with insert domainSH3-SH2-SH3 adapter MonaSH3-SH2-SH3 adaptor moleculeadapter protein GRIDgrf-40grf40 adapter proteingrowth factor receptor-binding proteingrowth factor receptor
Modification date2018051920180522
UniProtAcc

P35240

O75791

Ensembl transtripts involved in fusion geneENST00000347330, ENST00000413209, 
ENST00000338641, ENST00000403435, 
ENST00000361452, ENST00000403999, 
ENST00000334961, ENST00000353887, 
ENST00000361166, ENST00000397789, 
ENST00000361676, 
ENST00000543252, 
ENST00000344138, ENST00000540310, 
ENST00000478445, ENST00000544756, 
ENST00000399090, ENST00000407075, 
Fusion gene scores* DoF score12 X 7 X 7=5886 X 4 X 5=120
# samples 137
** MAII scorelog2(13/588*10)=-2.17730453180791
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/120*10)=-0.777607578663552
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NF2 [Title/Abstract] AND GRAP2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNF2

GO:0008285

negative regulation of cell proliferation

12444102|20178741

HgeneNF2

GO:0022408

negative regulation of cell-cell adhesion

17210637

HgeneNF2

GO:0042532

negative regulation of tyrosine phosphorylation of STAT protein

12444102

HgeneNF2

GO:0046426

negative regulation of JAK-STAT cascade

12444102


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A2-A0SV-01ANF2chr22

30035201

+GRAP2chr22

40351823

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000347330ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3CDSENST00000347330ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000347330ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3UTRENST00000347330ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000347330ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000347330ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000347330ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000413209ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000413209ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000413209ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-3UTRENST00000413209ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000413209ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000413209ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000413209ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000338641ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000338641ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000338641ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-3UTRENST00000338641ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000338641ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000338641ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000338641ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000403435ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000403435ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000403435ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-3UTRENST00000403435ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000403435ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000403435ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000403435ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3CDSENST00000361452ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3CDSENST00000361452ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000361452ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3UTRENST00000361452ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000361452ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000361452ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000361452ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000403999ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000403999ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000403999ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-3UTRENST00000403999ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000403999ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000403999ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000403999ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3CDSENST00000334961ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3CDSENST00000334961ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000334961ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3UTRENST00000334961ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000334961ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000334961ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000334961ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3CDSENST00000353887ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3CDSENST00000353887ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000353887ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-3UTRENST00000353887ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000353887ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000353887ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
intron-intronENST00000353887ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000361166ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000361166ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000361166ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-3UTRENST00000361166ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000361166ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000361166ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000361166ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000397789ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000397789ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000397789ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-3UTRENST00000397789ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000397789ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000397789ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000397789ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000361676ENST00000543252NF2chr22

30035201

+GRAP2chr22

40351823

+
In-frameENST00000361676ENST00000344138NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000361676ENST00000540310NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-3UTRENST00000361676ENST00000478445NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000361676ENST00000544756NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000361676ENST00000399090NF2chr22

30035201

+GRAP2chr22

40351823

+
5CDS-intronENST00000361676ENST00000407075NF2chr22

30035201

+GRAP2chr22

40351823

+

Top

FusionProtFeatures for NF2_GRAP2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NF2

P35240

GRAP2

O75791

Interacts with SLP-76 to regulate NF-AT activation.Binds to tyrosine-phosphorylated shc.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for NF2_GRAP2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NF2_ENST00000413209_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_374aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKHEDDVQHFKVMRDNKGNYFLWTEKFPSL
NKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQ
QPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALTDFEALEEVLDSSNPSWWTGRLHNKL

>In-frame_NF2_ENST00000413209_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_426aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRAS
QSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVG
EEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQQPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPV

>In-frame_NF2_ENST00000338641_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_374aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKHEDDVQHFKVMRDNKGNYFLWTEKFPSL
NKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQ
QPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALTDFEALEEVLDSSNPSWWTGRLHNKL

>In-frame_NF2_ENST00000338641_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_426aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRAS
QSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVG
EEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQQPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPV

>In-frame_NF2_ENST00000403435_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_374aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKHEDDVQHFKVMRDNKGNYFLWTEKFPSL
NKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQ
QPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALTDFEALEEVLDSSNPSWWTGRLHNKL

>In-frame_NF2_ENST00000403435_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_426aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRAS
QSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVG
EEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQQPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPV

>In-frame_NF2_ENST00000403999_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_374aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKHEDDVQHFKVMRDNKGNYFLWTEKFPSL
NKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQ
QPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALTDFEALEEVLDSSNPSWWTGRLHNKL

>In-frame_NF2_ENST00000403999_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_426aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRAS
QSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVG
EEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQQPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPV

>In-frame_NF2_ENST00000361166_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_374aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKHEDDVQHFKVMRDNKGNYFLWTEKFPSL
NKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQ
QPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALTDFEALEEVLDSSNPSWWTGRLHNKL

>In-frame_NF2_ENST00000361166_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_426aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRAS
QSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVG
EEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQQPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPV

>In-frame_NF2_ENST00000397789_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_374aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKHEDDVQHFKVMRDNKGNYFLWTEKFPSL
NKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQ
QPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALTDFEALEEVLDSSNPSWWTGRLHNKL

>In-frame_NF2_ENST00000397789_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_426aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEE
PVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKAELGSQEGTVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRAS
QSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVG
EEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQQPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPV

>In-frame_NF2_ENST00000361676_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_332aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEVLDHDVSKEEPVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKA
ELGSQEGTVPKNFIDIQFPKHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGG
PHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQQPPQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALM

>In-frame_NF2_ENST00000361676_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_384aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEVLDHDVSKEEPVTFHFLAKFTPENAEEELVQEITQHLFFLQILSNQEEWFKA
ELGSQEGTVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNK
LVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQTAPAPQQLQQP
PQQRTLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALTDFEALEDDELGFHSGEVVEVLDSSNPS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NF2_ENST00000413209_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1122nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTA
AATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCAC
CGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAG
CTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAG
CAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGC
ACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGG
GCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTG

>In-frame_NF2_ENST00000413209_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_1278nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGC
CAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTAC
TTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTT
AGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGA
GAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCG
CAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGC
AGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTG
CAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGG
GAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTG

>In-frame_NF2_ENST00000338641_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1122nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTA
AATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCAC
CGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAG
CTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAG
CAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGC
ACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGG
GCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTG

>In-frame_NF2_ENST00000338641_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_1278nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGC
CAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTAC
TTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTT
AGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGA
GAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCG
CAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGC
AGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTG
CAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGG
GAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTG

>In-frame_NF2_ENST00000403435_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1122nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTA
AATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCAC
CGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAG
CTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAG
CAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGC
ACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGG
GCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTG

>In-frame_NF2_ENST00000403435_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_1278nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGC
CAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTAC
TTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTT
AGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGA
GAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCG
CAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGC
AGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTG
CAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGG
GAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTG

>In-frame_NF2_ENST00000403999_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1122nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTA
AATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCAC
CGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAG
CTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAG
CAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGC
ACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGG
GCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTG

>In-frame_NF2_ENST00000403999_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_1278nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGC
CAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTAC
TTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTT
AGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGA
GAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCG
CAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGC
AGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTG
CAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGG
GAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTG

>In-frame_NF2_ENST00000361166_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1122nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTA
AATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCAC
CGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAG
CTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAG
CAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGC
ACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGG
GCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTG

>In-frame_NF2_ENST00000361166_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_1278nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGC
CAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTAC
TTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTT
AGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGA
GAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCG
CAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGC
AGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTG
CAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGG
GAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTG

>In-frame_NF2_ENST00000397789_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1122nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTA
AATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCAC
CGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAG
CTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAG
CAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGC
ACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGG
GCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTG

>In-frame_NF2_ENST00000397789_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_1278nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGC
CAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTAC
TTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTT
AGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGA
GAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCG
CAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGC
AGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTG
CAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGG
GAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTG

>In-frame_NF2_ENST00000361676_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_996nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCT
GAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCG
GAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAGCATGAGGATGACGTTCAACACTTCAAGGTC
ATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATC
TCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGC
CCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAG
CACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCAT
TTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATG
CATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAG
GTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTGGCACCCATGACC

>In-frame_NF2_ENST00000361676_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_1152nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCT
GAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCG
GAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAG
GCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGCCAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGG
CATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAG
CTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGC
AACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCG
GATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCC
CCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGCACCGGC
TTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGG
GCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGGGAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NF2_ENST00000413209_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1565nt
TGCGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCG
GCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGT
GCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGC
AGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAG
GCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCG
GGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGA
TGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGGTTCTTTG
GACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCA
CCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTT
TAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAGC
ATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGC
TGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCA
ACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGG
ATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCC
CACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGCACCGGCT
TGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGG
CGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCT

>In-frame_NF2_ENST00000413209_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_4358nt
TGCGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCG
GCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGT
GCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGC
AGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAG
GCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCG
GGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGA
TGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGGTTCTTTG
GACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCA
CCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTT
TAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAAT
GGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGCCAGAGCT
CCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGT
GGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACA
GAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAA
TCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATG
CCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTG
ACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCC
AGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGGGAGGTGG
TGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTGGCACCCA
TGACCCGATAAACTCTTCAGGGGACAGAAGCTTTTTGTCTGGAGCTGCCCACAAGAAAGAGGGCAAGGAAAAAAGGCTGGACTCCATGAC
TATATATACATACATCTATCTACATCTGCCTGTGTACACACACAACTTTTTATACTAGTAATTTATTGGCAATTGGGCTGGTAATTAGTT
GATGCAAAAGGGAACTCAGGTGGAGAATAATATTGACACTTGCTTTTCTGCCCCCCTCAGGGGTGTGTGGAAGGCAGTGGGGGAGTTGGG
AGGGGGGCAGGGAAATGAAATGGAGTTTTGTCCTGGCCTTCAGCTGTCACTGCTTCCTCCTTGTCTTGGGAATTTTCACGGAGAACAGCT
AAGCAGAGACCACACCTCGGCACTGGACACAGAACAACAGGGTGGGGTTGAACTTGGTGGGGCACGTTCTAGCTGACCTGCAAGCCCCGC
TCACCTGGAGGGCTTGCAGAGCAGCTCTCCTCCTGTTCTCCAAGGGGTGGGCACTGTTGCATTAGGAATTAAGGTGCAGCCCAGTGCTGC
GGGCAGCCAAGCGAGTCTGAGCGGGGATGTGAAGGCAGGACGGGGTTGGAGAGACCCTGCCTGTGCAAGGCTGGCCTCCTAGTCAACACC
TAGCTGAGACATTCATCTCTGTTCAAATTAATATTCCTTGGGTCTTTCAAATGAATGTTTCAATGTGAGGAGCGAAGTACTGGGAAATCG
AGGGATTTTCCACAATCCCCAAGCAGCTTACTCAGTGGAACCTCTGTTTCCCCAGCTATGAAGGAAATAGCATCCTACATTCCGTAAAGT
GCTTGAAGAAGCTCTAGCTGAGAATGCTGAATTTTACAGTCATTGTTTTATGGTTACAAGGGTATGTCTTCAGGGCTCTGTTCATTTTCC
CTCTTGATTTTCTCTTTTGAAGATGCCTTGCCCAGTGGCATGGAAAGAAGCCCACTTGATGATAGGAGCCTGACTATGAATTGATTGACT
AAACATGACCCCAGGTGGAAGCTGGCTTTGACACCAGCTTCCTGTTCAGTCTGACCACTGCTGTCCTCCTGCTGCCCAAGAGTTGCACCT
GGAGCAAGGAACCCCACCATGGCTGTCGCTCTCCATCCCATCACGCTAGAATCATGTGTCCAAGGGCTCACTCTGGAGGTGCACAGCACA
GGTCAGCCTGGCCAGGGGCGAAGGAGACAGTAGAGAGGAAGCTCAGGGCCTTAGGGGAGGCCGGGTGCAAACCCGTTCTGCACCAAGTGC
ACTCGGAGTTTGTGGGTATGGGTGTGTACCCCTGCAGGTGTGCACATGTGTGCTTGCACGCACATATTTGTGCACTCCTGTGTGTATACA
TGTGTGCTTGTGTATGCATATGTGTGCATTCCTGCATGTGTGGACATGTGCGTGCATGCATCTGTGTGTCTGTGTGTGTGCTGAGACAGG
AAAGGGGGTGAAAGTGTTGGTGAGGGAGCCTGGAAGTTTTCTCTTCCCCAACCTCTCTTGCTCTAAGGAGGGATGGGGTTGGGGGCAGCC
GTTATTGAAGGTGATCGGAGAAGAAAGATTTTCTGACTCAGAAGTGACTGCCAGTGTAGCACAAGCAGTGTCCCTTGTGACTGTGATTCT
ACAGTTCTCTGATCCTCATGTTTCCTTTAGAGGAAAGAGGAAAAAAGGAACTCTGTGGTGGGTATTGGGAGGGAAAAGAAAATAGCCTGG
TGGAGGCAGGAGGGAGTCGAGTGTGAGTAAGGAGCACCTGCAGCTTTTGGAAGTGAAAGCAGAGAGAGGGAAAGGTAGCTAAGACATCCA
GGAGGATCAAGGGGCAGCGTGAGAGGCACAGGGGGAGGAAAGGGAGAGGGTGAGTGGGGCCAGGGAAGAGAACGGTGTGGAGTTGGTGGG
CAGATGGTGCAGGAGGAGGGCTGGGCAGTGGGGAGAGGAAGAATCAGAGCAGAGAAACCGCTGCTGCGGAAGGCAGGGAGCAAAGAAGCA
TAAGGAAAAGAACAGGAGAAAGAACAAAGGCAGAGAAGACCTCCTCAGCTATTTTGGTGCTAGGTAATGTGAAATGCTGCAGTAAATAAA
AGCCATAAGTAATGTTTGATTTTACAGTATTTACAAACCATATGCTTTAAACAGCCCACAAACTCCATCCAGTTGTCTGATGATGTGGGA
GGACCAGCTCTAGTTAGACGGAGGTATGTGATTCGATTCTGGTGGAGACTTTGTGCCTTGAAAGGCTTCTCAGGAAAGCAGTAATAAAAC
AAAGTGTCCTTGTTTGGCCAGGCCGTGTCTGGTGTCTGCGTTGCATACCCCTCAGGTAGAGAGTGAGAACGAGACCAGGGGGTGACAGGG
GTCATCGGCCTGCAGGAGCTGACCCCGTAGGCAGGCGGTATGAGCAGAGCTTTCAGAACCCCTGGAGCTCGGTGTTCTGTTGTAGCAAAA
GCTACTGAAGAGTATTTTGTACTGAGATGCCAAAGCATCTTTCCCTTGCTCATCAGCCTCCATTCAGAAGGAAGCGGGAAAGTCACCCAA
ACCACCTACAAGGAATGAGGGCTCTTAGCGGCCAGGTAAAGAGGACAAGAACCAAACTGTCCACATTATGGAGGGGAGGGGGAAAGAGAG

>In-frame_NF2_ENST00000338641_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1563nt
CGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCGGC
CGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGTGC
CGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAG
GGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGC
CTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGG
GCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATG
GAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGGTTCTTTGGA
CTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACC
TTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTTTA
AGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAGCAT
GAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTG
GTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAAC
AGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGAT
CACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCA
CAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTG
GGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCG
CTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTC

>In-frame_NF2_ENST00000338641_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_4356nt
CGCTTCCCGCGGGCGCGCGGAGTGAGGACGGTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCGGC
CGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGTGC
CGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAG
GGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGC
CTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGG
GCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATG
GAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGGTTCTTTGGA
CTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACC
TTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTTTA
AGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAATGG
TTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGCCAGAGCTCC
CCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGG
ACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGA
ACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATC
CGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCC
CCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGAC
ATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAG
GCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGGGAGGTGGTG
GAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTGGCACCCATG
ACCCGATAAACTCTTCAGGGGACAGAAGCTTTTTGTCTGGAGCTGCCCACAAGAAAGAGGGCAAGGAAAAAAGGCTGGACTCCATGACTA
TATATACATACATCTATCTACATCTGCCTGTGTACACACACAACTTTTTATACTAGTAATTTATTGGCAATTGGGCTGGTAATTAGTTGA
TGCAAAAGGGAACTCAGGTGGAGAATAATATTGACACTTGCTTTTCTGCCCCCCTCAGGGGTGTGTGGAAGGCAGTGGGGGAGTTGGGAG
GGGGGCAGGGAAATGAAATGGAGTTTTGTCCTGGCCTTCAGCTGTCACTGCTTCCTCCTTGTCTTGGGAATTTTCACGGAGAACAGCTAA
GCAGAGACCACACCTCGGCACTGGACACAGAACAACAGGGTGGGGTTGAACTTGGTGGGGCACGTTCTAGCTGACCTGCAAGCCCCGCTC
ACCTGGAGGGCTTGCAGAGCAGCTCTCCTCCTGTTCTCCAAGGGGTGGGCACTGTTGCATTAGGAATTAAGGTGCAGCCCAGTGCTGCGG
GCAGCCAAGCGAGTCTGAGCGGGGATGTGAAGGCAGGACGGGGTTGGAGAGACCCTGCCTGTGCAAGGCTGGCCTCCTAGTCAACACCTA
GCTGAGACATTCATCTCTGTTCAAATTAATATTCCTTGGGTCTTTCAAATGAATGTTTCAATGTGAGGAGCGAAGTACTGGGAAATCGAG
GGATTTTCCACAATCCCCAAGCAGCTTACTCAGTGGAACCTCTGTTTCCCCAGCTATGAAGGAAATAGCATCCTACATTCCGTAAAGTGC
TTGAAGAAGCTCTAGCTGAGAATGCTGAATTTTACAGTCATTGTTTTATGGTTACAAGGGTATGTCTTCAGGGCTCTGTTCATTTTCCCT
CTTGATTTTCTCTTTTGAAGATGCCTTGCCCAGTGGCATGGAAAGAAGCCCACTTGATGATAGGAGCCTGACTATGAATTGATTGACTAA
ACATGACCCCAGGTGGAAGCTGGCTTTGACACCAGCTTCCTGTTCAGTCTGACCACTGCTGTCCTCCTGCTGCCCAAGAGTTGCACCTGG
AGCAAGGAACCCCACCATGGCTGTCGCTCTCCATCCCATCACGCTAGAATCATGTGTCCAAGGGCTCACTCTGGAGGTGCACAGCACAGG
TCAGCCTGGCCAGGGGCGAAGGAGACAGTAGAGAGGAAGCTCAGGGCCTTAGGGGAGGCCGGGTGCAAACCCGTTCTGCACCAAGTGCAC
TCGGAGTTTGTGGGTATGGGTGTGTACCCCTGCAGGTGTGCACATGTGTGCTTGCACGCACATATTTGTGCACTCCTGTGTGTATACATG
TGTGCTTGTGTATGCATATGTGTGCATTCCTGCATGTGTGGACATGTGCGTGCATGCATCTGTGTGTCTGTGTGTGTGCTGAGACAGGAA
AGGGGGTGAAAGTGTTGGTGAGGGAGCCTGGAAGTTTTCTCTTCCCCAACCTCTCTTGCTCTAAGGAGGGATGGGGTTGGGGGCAGCCGT
TATTGAAGGTGATCGGAGAAGAAAGATTTTCTGACTCAGAAGTGACTGCCAGTGTAGCACAAGCAGTGTCCCTTGTGACTGTGATTCTAC
AGTTCTCTGATCCTCATGTTTCCTTTAGAGGAAAGAGGAAAAAAGGAACTCTGTGGTGGGTATTGGGAGGGAAAAGAAAATAGCCTGGTG
GAGGCAGGAGGGAGTCGAGTGTGAGTAAGGAGCACCTGCAGCTTTTGGAAGTGAAAGCAGAGAGAGGGAAAGGTAGCTAAGACATCCAGG
AGGATCAAGGGGCAGCGTGAGAGGCACAGGGGGAGGAAAGGGAGAGGGTGAGTGGGGCCAGGGAAGAGAACGGTGTGGAGTTGGTGGGCA
GATGGTGCAGGAGGAGGGCTGGGCAGTGGGGAGAGGAAGAATCAGAGCAGAGAAACCGCTGCTGCGGAAGGCAGGGAGCAAAGAAGCATA
AGGAAAAGAACAGGAGAAAGAACAAAGGCAGAGAAGACCTCCTCAGCTATTTTGGTGCTAGGTAATGTGAAATGCTGCAGTAAATAAAAG
CCATAAGTAATGTTTGATTTTACAGTATTTACAAACCATATGCTTTAAACAGCCCACAAACTCCATCCAGTTGTCTGATGATGTGGGAGG
ACCAGCTCTAGTTAGACGGAGGTATGTGATTCGATTCTGGTGGAGACTTTGTGCCTTGAAAGGCTTCTCAGGAAAGCAGTAATAAAACAA
AGTGTCCTTGTTTGGCCAGGCCGTGTCTGGTGTCTGCGTTGCATACCCCTCAGGTAGAGAGTGAGAACGAGACCAGGGGGTGACAGGGGT
CATCGGCCTGCAGGAGCTGACCCCGTAGGCAGGCGGTATGAGCAGAGCTTTCAGAACCCCTGGAGCTCGGTGTTCTGTTGTAGCAAAAGC
TACTGAAGAGTATTTTGTACTGAGATGCCAAAGCATCTTTCCCTTGCTCATCAGCCTCCATTCAGAAGGAAGCGGGAAAGTCACCCAAAC
CACCTACAAGGAATGAGGGCTCTTAGCGGCCAGGTAAAGAGGACAAGAACCAAACTGTCCACATTATGGAGGGGAGGGGGAAAGAGAGCT

>In-frame_NF2_ENST00000403435_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1533nt
GTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCT
GCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCT
CCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGG
ACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGG
CTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCT
CTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGG
AAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGGTTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCC
TGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAG
AATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAG
CTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATG
CGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCC
AGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCA
CACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCAC
CAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTC
CACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCAT
CGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTC
CTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTGGCACCCATGACCCGA

>In-frame_NF2_ENST00000403435_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_4326nt
GTGACAGCCACGCGCGCGCGTACGCGCCCGATGCAGCGCGGCCCCGTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCT
GCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCCCGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCT
CCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCCTTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGG
ACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCATGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGG
CTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCCCGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCT
CTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGG
AAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGGTTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCC
TGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAG
AATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAG
CTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCA
GAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGCCAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCAT
GAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTG
GTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAAC
AGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGAT
CACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCA
CAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTG
GGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCG
CTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGGGAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGG
TGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTGGCACCCATGACCCGATAAACTCTTCAGGGGACAGAAGCT
TTTTGTCTGGAGCTGCCCACAAGAAAGAGGGCAAGGAAAAAAGGCTGGACTCCATGACTATATATACATACATCTATCTACATCTGCCTG
TGTACACACACAACTTTTTATACTAGTAATTTATTGGCAATTGGGCTGGTAATTAGTTGATGCAAAAGGGAACTCAGGTGGAGAATAATA
TTGACACTTGCTTTTCTGCCCCCCTCAGGGGTGTGTGGAAGGCAGTGGGGGAGTTGGGAGGGGGGCAGGGAAATGAAATGGAGTTTTGTC
CTGGCCTTCAGCTGTCACTGCTTCCTCCTTGTCTTGGGAATTTTCACGGAGAACAGCTAAGCAGAGACCACACCTCGGCACTGGACACAG
AACAACAGGGTGGGGTTGAACTTGGTGGGGCACGTTCTAGCTGACCTGCAAGCCCCGCTCACCTGGAGGGCTTGCAGAGCAGCTCTCCTC
CTGTTCTCCAAGGGGTGGGCACTGTTGCATTAGGAATTAAGGTGCAGCCCAGTGCTGCGGGCAGCCAAGCGAGTCTGAGCGGGGATGTGA
AGGCAGGACGGGGTTGGAGAGACCCTGCCTGTGCAAGGCTGGCCTCCTAGTCAACACCTAGCTGAGACATTCATCTCTGTTCAAATTAAT
ATTCCTTGGGTCTTTCAAATGAATGTTTCAATGTGAGGAGCGAAGTACTGGGAAATCGAGGGATTTTCCACAATCCCCAAGCAGCTTACT
CAGTGGAACCTCTGTTTCCCCAGCTATGAAGGAAATAGCATCCTACATTCCGTAAAGTGCTTGAAGAAGCTCTAGCTGAGAATGCTGAAT
TTTACAGTCATTGTTTTATGGTTACAAGGGTATGTCTTCAGGGCTCTGTTCATTTTCCCTCTTGATTTTCTCTTTTGAAGATGCCTTGCC
CAGTGGCATGGAAAGAAGCCCACTTGATGATAGGAGCCTGACTATGAATTGATTGACTAAACATGACCCCAGGTGGAAGCTGGCTTTGAC
ACCAGCTTCCTGTTCAGTCTGACCACTGCTGTCCTCCTGCTGCCCAAGAGTTGCACCTGGAGCAAGGAACCCCACCATGGCTGTCGCTCT
CCATCCCATCACGCTAGAATCATGTGTCCAAGGGCTCACTCTGGAGGTGCACAGCACAGGTCAGCCTGGCCAGGGGCGAAGGAGACAGTA
GAGAGGAAGCTCAGGGCCTTAGGGGAGGCCGGGTGCAAACCCGTTCTGCACCAAGTGCACTCGGAGTTTGTGGGTATGGGTGTGTACCCC
TGCAGGTGTGCACATGTGTGCTTGCACGCACATATTTGTGCACTCCTGTGTGTATACATGTGTGCTTGTGTATGCATATGTGTGCATTCC
TGCATGTGTGGACATGTGCGTGCATGCATCTGTGTGTCTGTGTGTGTGCTGAGACAGGAAAGGGGGTGAAAGTGTTGGTGAGGGAGCCTG
GAAGTTTTCTCTTCCCCAACCTCTCTTGCTCTAAGGAGGGATGGGGTTGGGGGCAGCCGTTATTGAAGGTGATCGGAGAAGAAAGATTTT
CTGACTCAGAAGTGACTGCCAGTGTAGCACAAGCAGTGTCCCTTGTGACTGTGATTCTACAGTTCTCTGATCCTCATGTTTCCTTTAGAG
GAAAGAGGAAAAAAGGAACTCTGTGGTGGGTATTGGGAGGGAAAAGAAAATAGCCTGGTGGAGGCAGGAGGGAGTCGAGTGTGAGTAAGG
AGCACCTGCAGCTTTTGGAAGTGAAAGCAGAGAGAGGGAAAGGTAGCTAAGACATCCAGGAGGATCAAGGGGCAGCGTGAGAGGCACAGG
GGGAGGAAAGGGAGAGGGTGAGTGGGGCCAGGGAAGAGAACGGTGTGGAGTTGGTGGGCAGATGGTGCAGGAGGAGGGCTGGGCAGTGGG
GAGAGGAAGAATCAGAGCAGAGAAACCGCTGCTGCGGAAGGCAGGGAGCAAAGAAGCATAAGGAAAAGAACAGGAGAAAGAACAAAGGCA
GAGAAGACCTCCTCAGCTATTTTGGTGCTAGGTAATGTGAAATGCTGCAGTAAATAAAAGCCATAAGTAATGTTTGATTTTACAGTATTT
ACAAACCATATGCTTTAAACAGCCCACAAACTCCATCCAGTTGTCTGATGATGTGGGAGGACCAGCTCTAGTTAGACGGAGGTATGTGAT
TCGATTCTGGTGGAGACTTTGTGCCTTGAAAGGCTTCTCAGGAAAGCAGTAATAAAACAAAGTGTCCTTGTTTGGCCAGGCCGTGTCTGG
TGTCTGCGTTGCATACCCCTCAGGTAGAGAGTGAGAACGAGACCAGGGGGTGACAGGGGTCATCGGCCTGCAGGAGCTGACCCCGTAGGC
AGGCGGTATGAGCAGAGCTTTCAGAACCCCTGGAGCTCGGTGTTCTGTTGTAGCAAAAGCTACTGAAGAGTATTTTGTACTGAGATGCCA
AAGCATCTTTCCCTTGCTCATCAGCCTCCATTCAGAAGGAAGCGGGAAAGTCACCCAAACCACCTACAAGGAATGAGGGCTCTTAGCGGC
CAGGTAAAGAGGACAAGAACCAAACTGTCCACATTATGGAGGGGAGGGGGAAAGAGAGCTCAACCCCCCTCAGCCTCTGGTGCTGCCAGG

>In-frame_NF2_ENST00000403999_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1488nt
GTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCC
CGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCC
TTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCA
TGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCC
CGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACC
ATGGACGCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAA
ACCTGGTTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAG
GAAGAACCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTC
TTCTTACAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATC
CAGTTTCCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCA
TCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAG
GGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAAC
CGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAG
CTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCAT
TGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTG
CGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAAC

>In-frame_NF2_ENST00000403999_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_4281nt
GTGACCCTAGTCGGCCGCTGAGAGGCGCGCGGAGTCTGGGCCGCTGCCGTCTAGGGGTCCCGTCCCGAGGCGTCCCCGGCATCTCCGGCC
CGAATCCCGGAGTGCCGGGTCGCGCCTGCACCGAAGGTCCCGGCTCCTGTGCCCTCCCTGCAGCCGTCAGGGCCCGTCCCCCAACTCCCC
TTTCCGCTCAGGCAGGGTCCTCGCGGCCCATGCTGGCCGCTGGGGACCCGCGCAGCCCAGACCGTTCCCGGGCCGGGCAGCCGGCCACCA
TGGTGGCCCTGAGGCCTGTGCAGCAACTCCAGGGGGGCTAAAGGGCTCAGAGTGCAGGCCGTGGGGCGCGAGGGTCCCGGGCCTGAGCCC
CGCGCCATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACC
ATGGACGCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAA
ACCTGGTTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAG
GAAGAACCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTC
TTCTTACAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATC
CAGTTTCCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGG
GCCAGCCAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGT
AATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATC
TTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCT
GTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAG
CCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGA
GGAGGCAGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGAC
CCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCAC
AGCGGGGAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAAC
TACGTGGCACCCATGACCCGATAAACTCTTCAGGGGACAGAAGCTTTTTGTCTGGAGCTGCCCACAAGAAAGAGGGCAAGGAAAAAAGGC
TGGACTCCATGACTATATATACATACATCTATCTACATCTGCCTGTGTACACACACAACTTTTTATACTAGTAATTTATTGGCAATTGGG
CTGGTAATTAGTTGATGCAAAAGGGAACTCAGGTGGAGAATAATATTGACACTTGCTTTTCTGCCCCCCTCAGGGGTGTGTGGAAGGCAG
TGGGGGAGTTGGGAGGGGGGCAGGGAAATGAAATGGAGTTTTGTCCTGGCCTTCAGCTGTCACTGCTTCCTCCTTGTCTTGGGAATTTTC
ACGGAGAACAGCTAAGCAGAGACCACACCTCGGCACTGGACACAGAACAACAGGGTGGGGTTGAACTTGGTGGGGCACGTTCTAGCTGAC
CTGCAAGCCCCGCTCACCTGGAGGGCTTGCAGAGCAGCTCTCCTCCTGTTCTCCAAGGGGTGGGCACTGTTGCATTAGGAATTAAGGTGC
AGCCCAGTGCTGCGGGCAGCCAAGCGAGTCTGAGCGGGGATGTGAAGGCAGGACGGGGTTGGAGAGACCCTGCCTGTGCAAGGCTGGCCT
CCTAGTCAACACCTAGCTGAGACATTCATCTCTGTTCAAATTAATATTCCTTGGGTCTTTCAAATGAATGTTTCAATGTGAGGAGCGAAG
TACTGGGAAATCGAGGGATTTTCCACAATCCCCAAGCAGCTTACTCAGTGGAACCTCTGTTTCCCCAGCTATGAAGGAAATAGCATCCTA
CATTCCGTAAAGTGCTTGAAGAAGCTCTAGCTGAGAATGCTGAATTTTACAGTCATTGTTTTATGGTTACAAGGGTATGTCTTCAGGGCT
CTGTTCATTTTCCCTCTTGATTTTCTCTTTTGAAGATGCCTTGCCCAGTGGCATGGAAAGAAGCCCACTTGATGATAGGAGCCTGACTAT
GAATTGATTGACTAAACATGACCCCAGGTGGAAGCTGGCTTTGACACCAGCTTCCTGTTCAGTCTGACCACTGCTGTCCTCCTGCTGCCC
AAGAGTTGCACCTGGAGCAAGGAACCCCACCATGGCTGTCGCTCTCCATCCCATCACGCTAGAATCATGTGTCCAAGGGCTCACTCTGGA
GGTGCACAGCACAGGTCAGCCTGGCCAGGGGCGAAGGAGACAGTAGAGAGGAAGCTCAGGGCCTTAGGGGAGGCCGGGTGCAAACCCGTT
CTGCACCAAGTGCACTCGGAGTTTGTGGGTATGGGTGTGTACCCCTGCAGGTGTGCACATGTGTGCTTGCACGCACATATTTGTGCACTC
CTGTGTGTATACATGTGTGCTTGTGTATGCATATGTGTGCATTCCTGCATGTGTGGACATGTGCGTGCATGCATCTGTGTGTCTGTGTGT
GTGCTGAGACAGGAAAGGGGGTGAAAGTGTTGGTGAGGGAGCCTGGAAGTTTTCTCTTCCCCAACCTCTCTTGCTCTAAGGAGGGATGGG
GTTGGGGGCAGCCGTTATTGAAGGTGATCGGAGAAGAAAGATTTTCTGACTCAGAAGTGACTGCCAGTGTAGCACAAGCAGTGTCCCTTG
TGACTGTGATTCTACAGTTCTCTGATCCTCATGTTTCCTTTAGAGGAAAGAGGAAAAAAGGAACTCTGTGGTGGGTATTGGGAGGGAAAA
GAAAATAGCCTGGTGGAGGCAGGAGGGAGTCGAGTGTGAGTAAGGAGCACCTGCAGCTTTTGGAAGTGAAAGCAGAGAGAGGGAAAGGTA
GCTAAGACATCCAGGAGGATCAAGGGGCAGCGTGAGAGGCACAGGGGGAGGAAAGGGAGAGGGTGAGTGGGGCCAGGGAAGAGAACGGTG
TGGAGTTGGTGGGCAGATGGTGCAGGAGGAGGGCTGGGCAGTGGGGAGAGGAAGAATCAGAGCAGAGAAACCGCTGCTGCGGAAGGCAGG
GAGCAAAGAAGCATAAGGAAAAGAACAGGAGAAAGAACAAAGGCAGAGAAGACCTCCTCAGCTATTTTGGTGCTAGGTAATGTGAAATGC
TGCAGTAAATAAAAGCCATAAGTAATGTTTGATTTTACAGTATTTACAAACCATATGCTTTAAACAGCCCACAAACTCCATCCAGTTGTC
TGATGATGTGGGAGGACCAGCTCTAGTTAGACGGAGGTATGTGATTCGATTCTGGTGGAGACTTTGTGCCTTGAAAGGCTTCTCAGGAAA
GCAGTAATAAAACAAAGTGTCCTTGTTTGGCCAGGCCGTGTCTGGTGTCTGCGTTGCATACCCCTCAGGTAGAGAGTGAGAACGAGACCA
GGGGGTGACAGGGGTCATCGGCCTGCAGGAGCTGACCCCGTAGGCAGGCGGTATGAGCAGAGCTTTCAGAACCCCTGGAGCTCGGTGTTC
TGTTGTAGCAAAAGCTACTGAAGAGTATTTTGTACTGAGATGCCAAAGCATCTTTCCCTTGCTCATCAGCCTCCATTCAGAAGGAAGCGG
GAAAGTCACCCAAACCACCTACAAGGAATGAGGGCTCTTAGCGGCCAGGTAAAGAGGACAAGAACCAAACTGTCCACATTATGGAGGGGA

>In-frame_NF2_ENST00000361166_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1122nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTA
AATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCAC
CGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAG
CTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAG
CAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGC
ACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGG
GCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTG

>In-frame_NF2_ENST00000361166_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_3915nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGC
CAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTAC
TTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTT
AGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGA
GAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCG
CAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGC
AGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTG
CAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGG
GAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTG
GCACCCATGACCCGATAAACTCTTCAGGGGACAGAAGCTTTTTGTCTGGAGCTGCCCACAAGAAAGAGGGCAAGGAAAAAAGGCTGGACT
CCATGACTATATATACATACATCTATCTACATCTGCCTGTGTACACACACAACTTTTTATACTAGTAATTTATTGGCAATTGGGCTGGTA
ATTAGTTGATGCAAAAGGGAACTCAGGTGGAGAATAATATTGACACTTGCTTTTCTGCCCCCCTCAGGGGTGTGTGGAAGGCAGTGGGGG
AGTTGGGAGGGGGGCAGGGAAATGAAATGGAGTTTTGTCCTGGCCTTCAGCTGTCACTGCTTCCTCCTTGTCTTGGGAATTTTCACGGAG
AACAGCTAAGCAGAGACCACACCTCGGCACTGGACACAGAACAACAGGGTGGGGTTGAACTTGGTGGGGCACGTTCTAGCTGACCTGCAA
GCCCCGCTCACCTGGAGGGCTTGCAGAGCAGCTCTCCTCCTGTTCTCCAAGGGGTGGGCACTGTTGCATTAGGAATTAAGGTGCAGCCCA
GTGCTGCGGGCAGCCAAGCGAGTCTGAGCGGGGATGTGAAGGCAGGACGGGGTTGGAGAGACCCTGCCTGTGCAAGGCTGGCCTCCTAGT
CAACACCTAGCTGAGACATTCATCTCTGTTCAAATTAATATTCCTTGGGTCTTTCAAATGAATGTTTCAATGTGAGGAGCGAAGTACTGG
GAAATCGAGGGATTTTCCACAATCCCCAAGCAGCTTACTCAGTGGAACCTCTGTTTCCCCAGCTATGAAGGAAATAGCATCCTACATTCC
GTAAAGTGCTTGAAGAAGCTCTAGCTGAGAATGCTGAATTTTACAGTCATTGTTTTATGGTTACAAGGGTATGTCTTCAGGGCTCTGTTC
ATTTTCCCTCTTGATTTTCTCTTTTGAAGATGCCTTGCCCAGTGGCATGGAAAGAAGCCCACTTGATGATAGGAGCCTGACTATGAATTG
ATTGACTAAACATGACCCCAGGTGGAAGCTGGCTTTGACACCAGCTTCCTGTTCAGTCTGACCACTGCTGTCCTCCTGCTGCCCAAGAGT
TGCACCTGGAGCAAGGAACCCCACCATGGCTGTCGCTCTCCATCCCATCACGCTAGAATCATGTGTCCAAGGGCTCACTCTGGAGGTGCA
CAGCACAGGTCAGCCTGGCCAGGGGCGAAGGAGACAGTAGAGAGGAAGCTCAGGGCCTTAGGGGAGGCCGGGTGCAAACCCGTTCTGCAC
CAAGTGCACTCGGAGTTTGTGGGTATGGGTGTGTACCCCTGCAGGTGTGCACATGTGTGCTTGCACGCACATATTTGTGCACTCCTGTGT
GTATACATGTGTGCTTGTGTATGCATATGTGTGCATTCCTGCATGTGTGGACATGTGCGTGCATGCATCTGTGTGTCTGTGTGTGTGCTG
AGACAGGAAAGGGGGTGAAAGTGTTGGTGAGGGAGCCTGGAAGTTTTCTCTTCCCCAACCTCTCTTGCTCTAAGGAGGGATGGGGTTGGG
GGCAGCCGTTATTGAAGGTGATCGGAGAAGAAAGATTTTCTGACTCAGAAGTGACTGCCAGTGTAGCACAAGCAGTGTCCCTTGTGACTG
TGATTCTACAGTTCTCTGATCCTCATGTTTCCTTTAGAGGAAAGAGGAAAAAAGGAACTCTGTGGTGGGTATTGGGAGGGAAAAGAAAAT
AGCCTGGTGGAGGCAGGAGGGAGTCGAGTGTGAGTAAGGAGCACCTGCAGCTTTTGGAAGTGAAAGCAGAGAGAGGGAAAGGTAGCTAAG
ACATCCAGGAGGATCAAGGGGCAGCGTGAGAGGCACAGGGGGAGGAAAGGGAGAGGGTGAGTGGGGCCAGGGAAGAGAACGGTGTGGAGT
TGGTGGGCAGATGGTGCAGGAGGAGGGCTGGGCAGTGGGGAGAGGAAGAATCAGAGCAGAGAAACCGCTGCTGCGGAAGGCAGGGAGCAA
AGAAGCATAAGGAAAAGAACAGGAGAAAGAACAAAGGCAGAGAAGACCTCCTCAGCTATTTTGGTGCTAGGTAATGTGAAATGCTGCAGT
AAATAAAAGCCATAAGTAATGTTTGATTTTACAGTATTTACAAACCATATGCTTTAAACAGCCCACAAACTCCATCCAGTTGTCTGATGA
TGTGGGAGGACCAGCTCTAGTTAGACGGAGGTATGTGATTCGATTCTGGTGGAGACTTTGTGCCTTGAAAGGCTTCTCAGGAAAGCAGTA
ATAAAACAAAGTGTCCTTGTTTGGCCAGGCCGTGTCTGGTGTCTGCGTTGCATACCCCTCAGGTAGAGAGTGAGAACGAGACCAGGGGGT
GACAGGGGTCATCGGCCTGCAGGAGCTGACCCCGTAGGCAGGCGGTATGAGCAGAGCTTTCAGAACCCCTGGAGCTCGGTGTTCTGTTGT
AGCAAAAGCTACTGAAGAGTATTTTGTACTGAGATGCCAAAGCATCTTTCCCTTGCTCATCAGCCTCCATTCAGAAGGAAGCGGGAAAGT
CACCCAAACCACCTACAAGGAATGAGGGCTCTTAGCGGCCAGGTAAAGAGGACAAGAACCAAACTGTCCACATTATGGAGGGGAGGGGGA

>In-frame_NF2_ENST00000397789_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_1122nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTA
AATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCAC
CGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAG
CTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAG
CAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGC
ACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGG
GCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTG

>In-frame_NF2_ENST00000397789_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_3915nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTTTGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGG
TTCTTTGGACTGCAGTACACAATCAAGGACACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAA
CCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTA
CAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCGGAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTT
CCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAGGCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGC
CAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGGCATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTAC
TTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTT
AGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGA
GAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCG
CAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGC
AGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTG
CAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGG
GAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTG
GCACCCATGACCCGATAAACTCTTCAGGGGACAGAAGCTTTTTGTCTGGAGCTGCCCACAAGAAAGAGGGCAAGGAAAAAAGGCTGGACT
CCATGACTATATATACATACATCTATCTACATCTGCCTGTGTACACACACAACTTTTTATACTAGTAATTTATTGGCAATTGGGCTGGTA
ATTAGTTGATGCAAAAGGGAACTCAGGTGGAGAATAATATTGACACTTGCTTTTCTGCCCCCCTCAGGGGTGTGTGGAAGGCAGTGGGGG
AGTTGGGAGGGGGGCAGGGAAATGAAATGGAGTTTTGTCCTGGCCTTCAGCTGTCACTGCTTCCTCCTTGTCTTGGGAATTTTCACGGAG
AACAGCTAAGCAGAGACCACACCTCGGCACTGGACACAGAACAACAGGGTGGGGTTGAACTTGGTGGGGCACGTTCTAGCTGACCTGCAA
GCCCCGCTCACCTGGAGGGCTTGCAGAGCAGCTCTCCTCCTGTTCTCCAAGGGGTGGGCACTGTTGCATTAGGAATTAAGGTGCAGCCCA
GTGCTGCGGGCAGCCAAGCGAGTCTGAGCGGGGATGTGAAGGCAGGACGGGGTTGGAGAGACCCTGCCTGTGCAAGGCTGGCCTCCTAGT
CAACACCTAGCTGAGACATTCATCTCTGTTCAAATTAATATTCCTTGGGTCTTTCAAATGAATGTTTCAATGTGAGGAGCGAAGTACTGG
GAAATCGAGGGATTTTCCACAATCCCCAAGCAGCTTACTCAGTGGAACCTCTGTTTCCCCAGCTATGAAGGAAATAGCATCCTACATTCC
GTAAAGTGCTTGAAGAAGCTCTAGCTGAGAATGCTGAATTTTACAGTCATTGTTTTATGGTTACAAGGGTATGTCTTCAGGGCTCTGTTC
ATTTTCCCTCTTGATTTTCTCTTTTGAAGATGCCTTGCCCAGTGGCATGGAAAGAAGCCCACTTGATGATAGGAGCCTGACTATGAATTG
ATTGACTAAACATGACCCCAGGTGGAAGCTGGCTTTGACACCAGCTTCCTGTTCAGTCTGACCACTGCTGTCCTCCTGCTGCCCAAGAGT
TGCACCTGGAGCAAGGAACCCCACCATGGCTGTCGCTCTCCATCCCATCACGCTAGAATCATGTGTCCAAGGGCTCACTCTGGAGGTGCA
CAGCACAGGTCAGCCTGGCCAGGGGCGAAGGAGACAGTAGAGAGGAAGCTCAGGGCCTTAGGGGAGGCCGGGTGCAAACCCGTTCTGCAC
CAAGTGCACTCGGAGTTTGTGGGTATGGGTGTGTACCCCTGCAGGTGTGCACATGTGTGCTTGCACGCACATATTTGTGCACTCCTGTGT
GTATACATGTGTGCTTGTGTATGCATATGTGTGCATTCCTGCATGTGTGGACATGTGCGTGCATGCATCTGTGTGTCTGTGTGTGTGCTG
AGACAGGAAAGGGGGTGAAAGTGTTGGTGAGGGAGCCTGGAAGTTTTCTCTTCCCCAACCTCTCTTGCTCTAAGGAGGGATGGGGTTGGG
GGCAGCCGTTATTGAAGGTGATCGGAGAAGAAAGATTTTCTGACTCAGAAGTGACTGCCAGTGTAGCACAAGCAGTGTCCCTTGTGACTG
TGATTCTACAGTTCTCTGATCCTCATGTTTCCTTTAGAGGAAAGAGGAAAAAAGGAACTCTGTGGTGGGTATTGGGAGGGAAAAGAAAAT
AGCCTGGTGGAGGCAGGAGGGAGTCGAGTGTGAGTAAGGAGCACCTGCAGCTTTTGGAAGTGAAAGCAGAGAGAGGGAAAGGTAGCTAAG
ACATCCAGGAGGATCAAGGGGCAGCGTGAGAGGCACAGGGGGAGGAAAGGGAGAGGGTGAGTGGGGCCAGGGAAGAGAACGGTGTGGAGT
TGGTGGGCAGATGGTGCAGGAGGAGGGCTGGGCAGTGGGGAGAGGAAGAATCAGAGCAGAGAAACCGCTGCTGCGGAAGGCAGGGAGCAA
AGAAGCATAAGGAAAAGAACAGGAGAAAGAACAAAGGCAGAGAAGACCTCCTCAGCTATTTTGGTGCTAGGTAATGTGAAATGCTGCAGT
AAATAAAAGCCATAAGTAATGTTTGATTTTACAGTATTTACAAACCATATGCTTTAAACAGCCCACAAACTCCATCCAGTTGTCTGATGA
TGTGGGAGGACCAGCTCTAGTTAGACGGAGGTATGTGATTCGATTCTGGTGGAGACTTTGTGCCTTGAAAGGCTTCTCAGGAAAGCAGTA
ATAAAACAAAGTGTCCTTGTTTGGCCAGGCCGTGTCTGGTGTCTGCGTTGCATACCCCTCAGGTAGAGAGTGAGAACGAGACCAGGGGGT
GACAGGGGTCATCGGCCTGCAGGAGCTGACCCCGTAGGCAGGCGGTATGAGCAGAGCTTTCAGAACCCCTGGAGCTCGGTGTTCTGTTGT
AGCAAAAGCTACTGAAGAGTATTTTGTACTGAGATGCCAAAGCATCTTTCCCTTGCTCATCAGCCTCCATTCAGAAGGAAGCGGGAAAGT
CACCCAAACCACCTACAAGGAATGAGGGCTCTTAGCGGCCAGGTAAAGAGGACAAGAACCAAACTGTCCACATTATGGAGGGGAGGGGGA

>In-frame_NF2_ENST00000361676_chr22_30035201_+_GRAP2_ENST00000543252_chr22_40351823_+_996nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCT
GAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCG
GAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAGCATGAGGATGACGTTCAACACTTCAAGGTC
ATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAGCTGGTAGACTACTACAGGACAAATTCCATC
TCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGCAACAGCCTGGACCGGAGGTCCCAGGGAGGC
CCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCGGATCACCCCCCGACCCTTCCCCTGCAGCAG
CACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCCCCACAGCAGCGATATCTGCAGCACCACCAT
TTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGCACCGGCTTGGGCAGTGAAATGAATGCGGCCCTCATG
CATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGGGCGCTGTATGACTTTGAGGCCCTGGAGGAG
GTCCTGGATAGCTCCAACCCATCCTGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTGGCACCCATGACC

>In-frame_NF2_ENST00000361676_chr22_30035201_+_GRAP2_ENST00000344138_chr22_40351823_+_3789nt
ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCGTGAGGATCGTCACCATGGAC
GCCGAGATGGAGTTCAATTGCGAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACCTTTCACTTCTTGGCCAAATTTTATCCT
GAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTTATTCTTCTTACAGATTTTAAGTAACCAAGAGGAGTGGTTTAAGGCG
GAGCTTGGGAGCCAGGAAGGATATGTGCCCAAGAATTTCATAGACATCCAGTTTCCCAAATGGTTTCACGAAGGCCTCTCTCGACACCAG
GCAGAGAACTTACTCATGGGCAAGGAGGTTGGCTTCTTCATCATCCGGGCCAGCCAGAGCTCCCCAGGGGACTTCTCCATCTCTGTCAGG
CATGAGGATGACGTTCAACACTTCAAGGTCATGCGAGACAACAAGGGTAATTACTTTCTGTGGACTGAGAAGTTTCCATCCCTAAATAAG
CTGGTAGACTACTACAGGACAAATTCCATCTCCAGACAGAAGCAGATCTTCCTTAGAGACAGAACCCGAGAAGACCAGGGTCACCGGGGC
AACAGCCTGGACCGGAGGTCCCAGGGAGGCCCACACCTCAGTGGGGCTGTGGGAGAAGAAATCCGACCTTCGATGAACCGGAAGCTGTCG
GATCACCCCCCGACCCTTCCCCTGCAGCAGCACCAGCACCAGCCACAGCCTCCGCAATATGCCCCAGCGCCCCAGCAGCTGCAGCAGCCC
CCACAGCAGCGATATCTGCAGCACCACCATTTCCACCAGGAACGCCGAGGAGGCAGCCTTGACATAAATGATGGGCATTGTGGCACCGGC
TTGGGCAGTGAAATGAATGCGGCCCTCATGCATCGGAGACACACAGACCCAGTGCAGCTCCAGGCGGCAGGGCGAGTGCGGTGGGCCCGG
GCGCTGTATGACTTTGAGGCCCTGGAGGATGACGAGCTGGGGTTCCACAGCGGGGAGGTGGTGGAGGTCCTGGATAGCTCCAACCCATCC
TGGTGGACCGGCCGCCTGCACAACAAGCTGGGCCTCTTCCCTGCCAACTACGTGGCACCCATGACCCGATAAACTCTTCAGGGGACAGAA
GCTTTTTGTCTGGAGCTGCCCACAAGAAAGAGGGCAAGGAAAAAAGGCTGGACTCCATGACTATATATACATACATCTATCTACATCTGC
CTGTGTACACACACAACTTTTTATACTAGTAATTTATTGGCAATTGGGCTGGTAATTAGTTGATGCAAAAGGGAACTCAGGTGGAGAATA
ATATTGACACTTGCTTTTCTGCCCCCCTCAGGGGTGTGTGGAAGGCAGTGGGGGAGTTGGGAGGGGGGCAGGGAAATGAAATGGAGTTTT
GTCCTGGCCTTCAGCTGTCACTGCTTCCTCCTTGTCTTGGGAATTTTCACGGAGAACAGCTAAGCAGAGACCACACCTCGGCACTGGACA
CAGAACAACAGGGTGGGGTTGAACTTGGTGGGGCACGTTCTAGCTGACCTGCAAGCCCCGCTCACCTGGAGGGCTTGCAGAGCAGCTCTC
CTCCTGTTCTCCAAGGGGTGGGCACTGTTGCATTAGGAATTAAGGTGCAGCCCAGTGCTGCGGGCAGCCAAGCGAGTCTGAGCGGGGATG
TGAAGGCAGGACGGGGTTGGAGAGACCCTGCCTGTGCAAGGCTGGCCTCCTAGTCAACACCTAGCTGAGACATTCATCTCTGTTCAAATT
AATATTCCTTGGGTCTTTCAAATGAATGTTTCAATGTGAGGAGCGAAGTACTGGGAAATCGAGGGATTTTCCACAATCCCCAAGCAGCTT
ACTCAGTGGAACCTCTGTTTCCCCAGCTATGAAGGAAATAGCATCCTACATTCCGTAAAGTGCTTGAAGAAGCTCTAGCTGAGAATGCTG
AATTTTACAGTCATTGTTTTATGGTTACAAGGGTATGTCTTCAGGGCTCTGTTCATTTTCCCTCTTGATTTTCTCTTTTGAAGATGCCTT
GCCCAGTGGCATGGAAAGAAGCCCACTTGATGATAGGAGCCTGACTATGAATTGATTGACTAAACATGACCCCAGGTGGAAGCTGGCTTT
GACACCAGCTTCCTGTTCAGTCTGACCACTGCTGTCCTCCTGCTGCCCAAGAGTTGCACCTGGAGCAAGGAACCCCACCATGGCTGTCGC
TCTCCATCCCATCACGCTAGAATCATGTGTCCAAGGGCTCACTCTGGAGGTGCACAGCACAGGTCAGCCTGGCCAGGGGCGAAGGAGACA
GTAGAGAGGAAGCTCAGGGCCTTAGGGGAGGCCGGGTGCAAACCCGTTCTGCACCAAGTGCACTCGGAGTTTGTGGGTATGGGTGTGTAC
CCCTGCAGGTGTGCACATGTGTGCTTGCACGCACATATTTGTGCACTCCTGTGTGTATACATGTGTGCTTGTGTATGCATATGTGTGCAT
TCCTGCATGTGTGGACATGTGCGTGCATGCATCTGTGTGTCTGTGTGTGTGCTGAGACAGGAAAGGGGGTGAAAGTGTTGGTGAGGGAGC
CTGGAAGTTTTCTCTTCCCCAACCTCTCTTGCTCTAAGGAGGGATGGGGTTGGGGGCAGCCGTTATTGAAGGTGATCGGAGAAGAAAGAT
TTTCTGACTCAGAAGTGACTGCCAGTGTAGCACAAGCAGTGTCCCTTGTGACTGTGATTCTACAGTTCTCTGATCCTCATGTTTCCTTTA
GAGGAAAGAGGAAAAAAGGAACTCTGTGGTGGGTATTGGGAGGGAAAAGAAAATAGCCTGGTGGAGGCAGGAGGGAGTCGAGTGTGAGTA
AGGAGCACCTGCAGCTTTTGGAAGTGAAAGCAGAGAGAGGGAAAGGTAGCTAAGACATCCAGGAGGATCAAGGGGCAGCGTGAGAGGCAC
AGGGGGAGGAAAGGGAGAGGGTGAGTGGGGCCAGGGAAGAGAACGGTGTGGAGTTGGTGGGCAGATGGTGCAGGAGGAGGGCTGGGCAGT
GGGGAGAGGAAGAATCAGAGCAGAGAAACCGCTGCTGCGGAAGGCAGGGAGCAAAGAAGCATAAGGAAAAGAACAGGAGAAAGAACAAAG
GCAGAGAAGACCTCCTCAGCTATTTTGGTGCTAGGTAATGTGAAATGCTGCAGTAAATAAAAGCCATAAGTAATGTTTGATTTTACAGTA
TTTACAAACCATATGCTTTAAACAGCCCACAAACTCCATCCAGTTGTCTGATGATGTGGGAGGACCAGCTCTAGTTAGACGGAGGTATGT
GATTCGATTCTGGTGGAGACTTTGTGCCTTGAAAGGCTTCTCAGGAAAGCAGTAATAAAACAAAGTGTCCTTGTTTGGCCAGGCCGTGTC
TGGTGTCTGCGTTGCATACCCCTCAGGTAGAGAGTGAGAACGAGACCAGGGGGTGACAGGGGTCATCGGCCTGCAGGAGCTGACCCCGTA
GGCAGGCGGTATGAGCAGAGCTTTCAGAACCCCTGGAGCTCGGTGTTCTGTTGTAGCAAAAGCTACTGAAGAGTATTTTGTACTGAGATG
CCAAAGCATCTTTCCCTTGCTCATCAGCCTCCATTCAGAAGGAAGCGGGAAAGTCACCCAAACCACCTACAAGGAATGAGGGCTCTTAGC
GGCCAGGTAAAGAGGACAAGAACCAAACTGTCCACATTATGGAGGGGAGGGGGAAAGAGAGCTCAACCCCCCTCAGCCTCTGGTGCTGCC


Top

FusionGenePPI for NF2_GRAP2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NF2SGSM3, MED28, HGS, EZR, NF2, SOS1, PXN, SLC9A3R1, SPTBN1, SDCBP, SCHIP1, VPRBP, DDB1, CUL4A, RIT1, AKT1, AGAP2, CD44, AMOT, PYGO2, WWC1, GPS1, CCNB1IP1, PPP1R8, AMOTL2, YAP1, KDM1A, MOV10, NXF1, RNF166, CCNL2, LATS1, LATS2, AMOTL1, DNAJA1, DNAJA2, DYNLL1, HSPH1, HSPA4, TUBA1C, DBN1, SLC33A1, KSR1, SRRM2, LIG3, TFCP2, TMPO, CLCC1, UBA3, EMD, LEMD2, CHMP4B, LIN7C, TRIM21, IST1, RPA1, ZBTB10, EPDR1, PDCD6IP, PRPF38B, XRCC1, PNKP, RPA2, PGAM5, MVP, SP1, TBP, PRKAG2, DBT, CPNE3, PARP1, PANX1, SLC25A6, WBP2, CHMP1A, OR4X1, GPD2, LPCAT1, PYCR2, CD2AP, ATP6V1H, LUC7L3, TUBB4A, GRPEL1, XRCC4, CBR4, HSPA9, TSG101, SRPR, RBBP4, NIT1, TBL2, EIF3M, DLAT, XRCC5, PEF1, CDK1, TSN, IRS4, TAF15, RPL18A, ERLIN2, XRCC6, RFC1, DNPEP, KPNA2, RPS5, SLC25A1, SLC25A5, MPP2, AFG3L2, MPP6, S100A8, TGM3, GRN, MTTP, GTPBP1, PABPC4, MTPAP, RPL15, SERBP1, RPL13, CALML5, RPL14, PDHX, RPL13A, TOP1, PRPF19, MC1R, DHX30, SLC25A12, SMAD3, RPL18, SLC25A11, AKAP8L, SSRP1, VTA1, RPS3, PREB, SERPINB3, PIP4K2C, FARSA, EIF2S3, RPS7, CPSF6, ATAD3A, ATAD3B, LSM12, GRSF1, SLC25A13, HDAC1, RPS2, SLC25A22, CDK5, RPL8, PDCD6, SH3GL1, RFC3, CBS, GMDS, SARS2, DSC1, SEC23B, SMC3, HSD17B4, G3BP2, DECR1, RPL10, DHX15, SUPT16H, SMC1A, EIF3J, C1orf35, RARS, TPR, SF3B4, RCC2, RPS3A, PHB, IGF2BP1, DARS, RPL3, PRDX1, SFXN2, SLC25A3, RPL4, CAPRIN1, RPS4X, CKAP5, S100A9, LANCL2, IKBIP, PRKCA, GLTSCR2, CDH1, EGFR, CTDSPL, PTPRA, PTPRG, PPFIA1, TSPYL4, PDCL, CYLD, UBE2AGRAP2GAB1, CCNDBP1, ZBTB7B, BEND5, HNRNPK, RBPMS, YWHAE, GFAP, KRTAP4-12, STAMBP, LCP2, CD28, SOS2, GNB2L1, KHDRBS1, MAP4K1, CSF1R, FASLG, LAX1, LAT, SYK, USP8, GAB2, BLNK, CBL, ALB, ERBB2, SPRY2, EGFR, CDC27, TNIP1, ZSCAN21, ANAPC5, PTPN23, ITCH, GAREM, TRIM68, SNX18, ANAPC1, ANAPC16, NAGK, CDC23, ANAPC7, ANAPC2, IFNAR2, KRAS, CBLB, RIN3, ABL1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NF2_GRAP2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NF2_GRAP2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNF2C0027832Neurofibromatosis 29CTD_human;ORPHANET;UNIPROT
HgeneNF2C0025500Mesothelioma6CTD_human
HgeneNF2C0345967Malignant mesothelioma4CTD_human
HgeneNF2C0007134Renal Cell Carcinoma1CTD_human
HgeneNF2C0025286Meningioma1CTD_human;HPO
HgeneNF2C0032229Pleural Neoplasms1CTD_human