FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24101

FusionGeneSummary for NF1_POLDIP2

check button Fusion gene summary
Fusion gene informationFusion gene name: NF1_POLDIP2
Fusion gene ID: 24101
HgeneTgene
Gene symbol

NF1

POLDIP2

Gene ID

4763

26073

Gene nameneurofibromin 1DNA polymerase delta interacting protein 2
SynonymsNFNS|VRNF|WSSPDIP38|POLD4|p38
Cytomap

17q11.2

17q11.2

Type of geneprotein-codingprotein-coding
Descriptionneurofibrominneurofibromatosis 1neurofibromatosis-related protein NF-1truncated neurofibromin 1polymerase delta-interacting protein 238 kDa DNA polymerase delta interaction proteinpolymerase (DNA) delta interacting protein 2polymerase (DNA-directed), delta interacting protein 2polymerase delta interacting protein 38
Modification date2018052720180519
UniProtAcc

P21359

Ensembl transtripts involved in fusion geneENST00000356175, ENST00000358273, 
ENST00000431387, ENST00000581113, 
ENST00000417592, ENST00000444181, 
ENST00000540200, ENST00000003607, 
Fusion gene scores* DoF score35 X 18 X 19=119702 X 2 X 2=8
# samples 462
** MAII scorelog2(46/11970*10)=-4.70164548088649
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: NF1 [Title/Abstract] AND POLDIP2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNF1

GO:0043547

positive regulation of GTPase activity

2121371


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCOADTCGA-AZ-6600-01ANF1chr17

29592357

+POLDIP2chr17

26682902

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000356175ENST00000540200NF1chr17

29592357

+POLDIP2chr17

26682902

-
5CDS-5UTRENST00000356175ENST00000003607NF1chr17

29592357

+POLDIP2chr17

26682902

-
In-frameENST00000358273ENST00000540200NF1chr17

29592357

+POLDIP2chr17

26682902

-
5CDS-5UTRENST00000358273ENST00000003607NF1chr17

29592357

+POLDIP2chr17

26682902

-
intron-3CDSENST00000431387ENST00000540200NF1chr17

29592357

+POLDIP2chr17

26682902

-
intron-5UTRENST00000431387ENST00000003607NF1chr17

29592357

+POLDIP2chr17

26682902

-
intron-3CDSENST00000581113ENST00000540200NF1chr17

29592357

+POLDIP2chr17

26682902

-
intron-5UTRENST00000581113ENST00000003607NF1chr17

29592357

+POLDIP2chr17

26682902

-
intron-3CDSENST00000417592ENST00000540200NF1chr17

29592357

+POLDIP2chr17

26682902

-
intron-5UTRENST00000417592ENST00000003607NF1chr17

29592357

+POLDIP2chr17

26682902

-
intron-3CDSENST00000444181ENST00000540200NF1chr17

29592357

+POLDIP2chr17

26682902

-
intron-5UTRENST00000444181ENST00000003607NF1chr17

29592357

+POLDIP2chr17

26682902

-

Top

FusionProtFeatures for NF1_POLDIP2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NF1

P21359

POLDIP2

Stimulates the GTPase activity of Ras. NF1 shows greateraffinity for Ras GAP, but lower specific activity. May be aregulator of Ras activity. {ECO:0000269|PubMed:2121371,ECO:0000269|PubMed:8417346}. Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNF1chr17:29592357chr17:26682902ENST00000356175+35571352_135515902819Compositional biasNote=Poly-Ser
HgeneNF1chr17:29592357chr17:26682902ENST00000358273+36581352_135516112840Compositional biasNote=Poly-Ser
HgeneNF1chr17:29592357chr17:26682902ENST00000356175+35571235_145115902819DomainRas-GAP
HgeneNF1chr17:29592357chr17:26682902ENST00000358273+36581235_145116112840DomainRas-GAP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNF1chr17:29592357chr17:26682902ENST00000431387+1151352_1355-111594Compositional biasNote=Poly-Ser
HgeneNF1chr17:29592357chr17:26682902ENST00000356175+35571580_173815902819DomainCRAL-TRIO
HgeneNF1chr17:29592357chr17:26682902ENST00000358273+36581580_173816112840DomainCRAL-TRIO
HgeneNF1chr17:29592357chr17:26682902ENST00000431387+1151235_1451-111594DomainRas-GAP
HgeneNF1chr17:29592357chr17:26682902ENST00000431387+1151580_1738-111594DomainCRAL-TRIO
HgeneNF1chr17:29592357chr17:26682902ENST00000356175+35572555_257115902819MotifNote=Bipartite nuclear localization signal
HgeneNF1chr17:29592357chr17:26682902ENST00000358273+36582555_257116112840MotifNote=Bipartite nuclear localization signal
HgeneNF1chr17:29592357chr17:26682902ENST00000431387+1152555_2571-111594MotifNote=Bipartite nuclear localization signal
HgeneNF1chr17:29592357chr17:26682902ENST00000356175+35571580_183715902819RegionNote=Lipid binding
HgeneNF1chr17:29592357chr17:26682902ENST00000358273+36581580_183716112840RegionNote=Lipid binding
HgeneNF1chr17:29592357chr17:26682902ENST00000431387+1151580_1837-111594RegionNote=Lipid binding


Top

FusionGeneSequence for NF1_POLDIP2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NF1_ENST00000356175_chr17_29592357_+_POLDIP2_ENST00000540200_chr17_26682902_-_1906aa
MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTL
EKCLAGQPKDTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELL
QYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQTDMAECAEKLFDLVDGFAESTKRKAAVWPLQ
IILLILCPEIIQDISKDVVDENNMNKKLFLDSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNP
SKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITNSALDWWPKIDAVYCHSVELRNMFGETLHKA
VQGCGAHPAIRMAPSLTFKEKVTSLKFKEKPTDLETRSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGSTAELITGLVQLVPQSHMPE
IAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNKQADRSSCHFLLFYGV
GCDIPSSGNTSQMSMDHEELLRTPGASLRKGKGNSSMDSAAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCEEADIR
CGVDEVSVHNLLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPTAGNTEAWEDTHAKWEQATKLILNYPKAKMEDGQAAESLHK
TIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSNSGLATYSPPMGPVSERKGSMISVMSSEGNADTPVSKFMDRLLS
LMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIET
MMLNLVRYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDLDQASMEAVVSLL
AGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDESAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYH
KDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNM
FSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVITSSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHAI
ISSSSEFPPQLRSVCHCLYQVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKILQSIANHVLFTKEEHM
RPFNDFVKSNFDAARRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPEH
KPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVARRNRPEGKVLETVGVFEVPKQNGKYETGQLF
LHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGL
DYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWW
RYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSL

>In-frame_NF1_ENST00000358273_chr17_29592357_+_POLDIP2_ENST00000540200_chr17_26682902_-_1927aa
MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTL
EKCLAGQPKDTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELL
QYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQTDMAECAEKLFDLVDGFAESTKRKAAVWPLQ
IILLILCPEIIQDISKDVVDENNMNKKLFLDSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNP
SKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITNSALDWWPKIDAVYCHSVELRNMFGETLHKA
VQGCGAHPAIRMAPSLTFKEKVTSLKFKEKPTDLETRSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGSTAELITGLVQLVPQSHMPE
IAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNKQADRSSCHFLLFYGV
GCDIPSSGNTSQMSMDHEELLRTPGASLRKGKGNSSMDSAAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCEEADIR
CGVDEVSVHNLLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPTAGNTEAWEDTHAKWEQATKLILNYPKAKMEDGQAAESLHK
TIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSNSGLATYSPPMGPVSERKGSMISVMSSEGNADTPVSKFMDRLLS
LMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIET
MMLNLVRYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDLDQASMEAVVSLL
AGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDESAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYH
KDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNM
FSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVITSSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHAI
ISSSSEFPPQLRSVCHCLYQATCHSLLNKATVKEKKENKKSVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLK
LMSKILQSIANHVLFTKEEHMRPFNDFVKSNFDAARRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKA
VGRRPFDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVARRNRPEGKVL
ETVGVFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHISQRSQT
EAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTENIR
VTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NF1_ENST00000356175_chr17_29592357_+_POLDIP2_ENST00000540200_chr17_26682902_-_5718nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGCTTCCAATAAAAACAGGACAGCAGAACACA
CATACCAAAGTCAGTACTGAGCACAACAAGGAATGTCTAATCAATATTTCCAAATACAAGTTTTCTTTGGTTATAAGCGGCCTCACTACT
ATTTTAAAGAATGTTAACAATATGAGAATATTTGGAGAAGCTGCTGAAAAAAATTTATATCTCTCTCAGTTGATTATATTGGATACACTG
GAAAAATGTCTTGCTGGGCAACCAAAGGACACAATGAGATTAGATGAAACGATGCTGGTCAAACAGTTGCTGCCAGAAATCTGCCATTTT
CTTCACACCTGTCGTGAAGGAAACCAGCATGCAGCTGAACTTCGGAATTCTGCCTCTGGGGTTTTATTTTCTCTCAGCTGCAACAACTTC
AATGCAGTCTTTAGTCGCATTTCTACCAGGTTACAGGAATTAACTGTTTGTTCAGAAGACAATGTTGATGTTCATGATATAGAATTGTTA
CAGTATATCAATGTGGATTGTGCAAAATTAAAACGACTCCTGAAGGAAACAGCATTTAAATTTAAAGCCCTAAAGAAGGTTGCGCAGTTA
GCAGTTATAAATAGCCTGGAAAAGGCATTTTGGAACTGGGTAGAAAATTATCCAGATGAATTTACAAAACTGTACCAGATCCCACAGACT
GATATGGCTGAATGTGCAGAAAAGCTATTTGACTTGGTGGATGGTTTTGCTGAAAGCACCAAACGTAAAGCAGCAGTTTGGCCACTACAA
ATCATTCTCCTTATCTTGTGTCCAGAAATAATCCAGGATATATCCAAAGACGTGGTTGATGAAAACAACATGAATAAGAAGTTATTTCTG
GACAGTCTACGAAAAGCTCTTGCTGGCCATGGAGGAAGTAGGCAGCTGACAGAAAGTGCTGCAATTGCCTGTGTCAAACTGTGTAAAGCA
AGTACTTACATCAATTGGGAAGATAACTCTGTCATTTTCCTACTTGTTCAGTCCATGGTGGTTGATCTTAAGAACCTGCTTTTTAATCCA
AGTAAGCCATTCTCAAGAGGCAGTCAGCCTGCAGATGTGGATCTAATGATTGACTGCCTTGTTTCTTGCTTTCGTATAAGCCCTCACAAC
AACCAACACTTTAAGATCTGCCTGGCTCAGAATTCACCTTCTACATTTCACTATGTGCTGGTAAATTCACTCCATCGAATCATCACCAAT
TCCGCATTGGATTGGTGGCCTAAGATTGATGCTGTGTATTGTCACTCGGTTGAACTTCGAAATATGTTTGGTGAAACACTTCATAAAGCA
GTGCAAGGTTGTGGAGCACACCCAGCAATACGAATGGCACCGAGTCTTACATTTAAAGAAAAAGTAACAAGCCTTAAATTTAAAGAAAAA
CCTACAGACCTGGAGACAAGAAGCTATAAGTATCTTCTCTTGTCCATGGTGAAACTAATTCATGCAGATCCAAAGCTCTTGCTTTGTAAT
CCAAGAAAACAGGGGCCCGAAACCCAAGGCAGTACAGCAGAATTAATTACAGGGCTCGTCCAACTGGTCCCTCAGTCACACATGCCAGAG
ATTGCTCAGGAAGCAATGGAGGCTCTGCTGGTTCTTCATCAGTTAGATAGCATTGATTTGTGGAATCCTGATGCTCCTGTAGAAACATTT
TGGGAGATTAGCTCACAAATGCTTTTTTACATCTGCAAGAAATTAACTAGTCATCAAATGCTTAGTAGCACAGAAATTCTCAAGTGGTTG
CGGGAAATATTGATCTGCAGGAATAAATTTCTTCTTAAAAATAAGCAGGCAGATAGAAGTTCCTGTCACTTTCTCCTTTTTTACGGGGTA
GGATGTGATATTCCTTCTAGTGGAAATACCAGTCAAATGTCCATGGATCATGAAGAATTACTACGTACTCCTGGAGCCTCTCTCCGGAAG
GGAAAAGGGAACTCCTCTATGGATAGTGCAGCAGGATGCAGCGGAACCCCCCCGATTTGCCGACAAGCCCAGACCAAACTAGAAGTGGCC
CTGTACATGTTTCTGTGGAACCCTGACACTGAAGCTGTTCTGGTTGCCATGTCCTGTTTCCGCCACCTCTGTGAGGAAGCAGATATCCGG
TGTGGGGTGGATGAAGTGTCAGTGCATAACCTCTTGCCCAACTATAACACATTCATGGAGTTTGCCTCTGTCAGCAATATGATGTCAACA
GGAAGAGCAGCACTTCAGAAAAGAGTGATGGCACTGCTGAGGCGCATTGAGCATCCCACTGCAGGAAACACTGAGGCTTGGGAAGATACA
CATGCAAAATGGGAACAAGCAACAAAGCTAATCCTTAACTATCCAAAAGCCAAAATGGAAGATGGCCAGGCTGCTGAAAGCCTTCACAAG
ACCATTGTTAAGAGGCGAATGTCCCATGTGAGTGGAGGAGGATCCATAGATTTGTCTGACACAGACTCCCTACAGGAATGGATCAACATG
ACTGGCTTCCTTTGTGCCCTTGGGGGAGTGTGCCTCCAGCAGAGAAGCAATTCTGGCCTGGCAACCTATAGCCCACCCATGGGTCCAGTC
AGTGAACGTAAGGGTTCTATGATTTCAGTGATGTCTTCAGAGGGAAACGCAGATACACCTGTCAGCAAATTTATGGATCGGCTGTTGTCC
TTAATGGTGTGTAACCATGAGAAAGTGGGACTTCAAATACGGACCAATGTTAAGGATCTGGTGGGTCTAGAATTGAGTCCTGCTCTGTAT
CCAATGCTATTTAACAAATTGAAGAATACCATCAGCAAGTTTTTTGACTCCCAAGGACAGGTTTTATTGACTGATACCAATACTCAATTT
GTAGAACAAACCATAGCTATAATGAAGAACTTGCTAGATAATCATACTGAAGGCAGCTCTGAACATCTAGGGCAAGCTAGCATTGAAACA
ATGATGTTAAATCTGGTCAGGTATGTTCGTGTGCTTGGGAATATGGTCCATGCAATTCAAATAAAAACGAAACTGTGTCAATTAGTTGAA
GTAATGATGGCAAGGAGAGATGACCTCTCATTTTGCCAAGAGATGAAATTTAGGAATAAGATGGTAGAATACCTGACAGACTGGGTTATG
GGAACATCAAACCAAGCAGCAGATGATGATGTAAAATGTCTTACAAGAGATTTGGACCAGGCAAGCATGGAAGCAGTAGTTTCACTTCTA
GCTGGTCTCCCTCTGCAGCCTGAAGAAGGAGATGGTGTGGAATTGATGGAAGCCAAATCACAGTTATTTCTTAAATACTTCACATTATTT
ATGAACCTTTTGAATGACTGCAGTGAAGTTGAAGATGAAAGTGCGCAAACAGGTGGCAGGAAACGTGGCATGTCTCGGAGGCTGGCATCA
CTGAGGCACTGTACGGTCCTTGCAATGTCAAACTTACTCAATGCCAACGTAGACAGTGGTCTCATGCACTCCATAGGCTTAGGTTACCAC
AAGGATCTCCAGACAAGAGCTACATTTATGGAAGTTCTGACAAAAATCCTTCAACAAGGCACAGAATTTGACACACTTGCAGAAACAGTA
TTGGCTGATCGGTTTGAGAGATTGGTGGAACTGGTCACAATGATGGGTGATCAAGGAGAACTCCCTATAGCGATGGCTCTGGCCAATGTG
GTTCCTTGTTCTCAGTGGGATGAACTAGCTCGAGTTCTGGTTACTCTGTTTGATTCTCGGCATTTACTCTACCAACTGCTCTGGAACATG
TTTTCTAAAGAAGTAGAATTGGCAGACTCCATGCAGACTCTCTTCCGAGGCAACAGCTTGGCCAGTAAAATAATGACATTCTGTTTCAAG
GTATATGGTGCTACCTATCTACAAAAACTCCTGGATCCTTTATTACGAATTGTGATCACATCCTCTGATTGGCAACATGTTAGCTTTGAA
GTGGATCCTACCAGGTTAGAACCATCAGAGAGCCTTGAGGAAAACCAGCGGAACCTCCTTCAGATGACTGAAAAGTTCTTCCATGCCATC
ATCAGTTCCTCCTCAGAATTCCCCCCTCAACTTCGAAGTGTGTGCCACTGTTTATACCAGGTGGTTAGCCAGCGTTTCCCTCAGAACAGC
ATCGGTGCAGTAGGAAGTGCCATGTTCCTCAGATTTATCAATCCTGCCATTGTCTCACCGTATGAAGCAGGGATTTTAGATAAAAAGCCA
CCACCTAGAATCGAAAGGGGCTTGAAGTTAATGTCAAAGATACTTCAGAGTATTGCCAATCATGTTCTCTTCACAAAAGAAGAACATATG
CGGCCTTTCAATGATTTTGTGAAAAGCAACTTTGATGCAGCACGCAGGTTTTTCCTTGATATAGCATCTGATTGTCCTACAAGTGATGCA
GTAAATCATAGTCTTTCCTTCATAAGTGACGGCAATGTGCTTGCTTTACATCGTCTACTCTGGAACAATCAGGAGAAAATTGGGCAGTAT
CTTTCCAGCAACAGGGATCATAAAGCTGTTGGAAGACGACCTTTTGATAAGATGGCAACACTTCTTGCATACCTGGGTCCTCCAGAGCAC
AAACCTGTGGCAGATACACACTGGTCCAGCCTTAACCTTACCAGTTCAAAGTTTGAGGAATTTATGACTAGGCATCAGGTACATGAAAAA
GAAGAATTCAAGGCTTTGAAAACGTTAAGTATTTTCTACCAAGCTGGGACTTCCAAAGCTGGGAATCCTATTTTTTATTATGTTGCACGG
AGAAACCGACCAGAGGGCAAAGTGTTGGAGACAGTTGGTGTGTTTGAGGTGCCAAAACAGAATGGAAAATATGAGACCGGGCAGCTTTTC
CTTCATAGCATTTTTGGCTACCGAGGTGTCGTCCTGTTTCCCTGGCAGGCCAGACTGTATGACCGGGATGTGGCTTCTGCAGCTCCAGAA
AAAGCAGAGAACCCTGCTGGCCATGGCTCCAAGGAGGTGAAAGGCAAAACTCACACTTACTATCAGGTGCTGATTGATGCTCGTGACTGC
CCACATATATCTCAGAGATCTCAGACAGAAGCTGTGACCTTCTTGGCTAACCATGATGACAGTCGGGCCCTCTATGCCATCCCAGGCTTG
GACTATGTCAGCCATGAAGACATCCTCCCCTACACCTCCACTGATCAGGTTCCCATCCAACATGAACTCTTTGAAAGATTTCTTCTGTAT
GACCAGACAAAAGCACCTCCTTTTGTGGCTCGGGAGACGCTAAGGGCCTGGCAAGAGAAGAATCACCCCTGGCTGGAGCTCTCCGATGTT
CATCGGGAAACAACTGAGAACATACGTGTCACTGTCATCCCCTTCTACATGGGCATGAGGGAAGCCCAGAATTCCCACGTGTACTGGTGG
CGCTACTGTATCCGTTTGGAGAACCTTGACAGTGATGTGGTACAGCTCCGGGAGCGGCACTGGAGGATATTCAGTCTCTCTGGCACCTTG
GAGACAGTGCGAGGCCGAGGGGTAGTGGGCAGGGAACCAGTGTTATCCAAGGAGCAGCCTGCGTTCCAGTATAGCAGCCACGTCTCGCTG
CAGGCTTCCAGTGGGCACATGTGGGGCACGTTCCGCTTTGAAAGACCTGATGGCTCCCACTTTGATGTTCGGATTCCTCCCTTCTCCCTG

>In-frame_NF1_ENST00000358273_chr17_29592357_+_POLDIP2_ENST00000540200_chr17_26682902_-_5781nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGCTTCCAATAAAAACAGGACAGCAGAACACA
CATACCAAAGTCAGTACTGAGCACAACAAGGAATGTCTAATCAATATTTCCAAATACAAGTTTTCTTTGGTTATAAGCGGCCTCACTACT
ATTTTAAAGAATGTTAACAATATGAGAATATTTGGAGAAGCTGCTGAAAAAAATTTATATCTCTCTCAGTTGATTATATTGGATACACTG
GAAAAATGTCTTGCTGGGCAACCAAAGGACACAATGAGATTAGATGAAACGATGCTGGTCAAACAGTTGCTGCCAGAAATCTGCCATTTT
CTTCACACCTGTCGTGAAGGAAACCAGCATGCAGCTGAACTTCGGAATTCTGCCTCTGGGGTTTTATTTTCTCTCAGCTGCAACAACTTC
AATGCAGTCTTTAGTCGCATTTCTACCAGGTTACAGGAATTAACTGTTTGTTCAGAAGACAATGTTGATGTTCATGATATAGAATTGTTA
CAGTATATCAATGTGGATTGTGCAAAATTAAAACGACTCCTGAAGGAAACAGCATTTAAATTTAAAGCCCTAAAGAAGGTTGCGCAGTTA
GCAGTTATAAATAGCCTGGAAAAGGCATTTTGGAACTGGGTAGAAAATTATCCAGATGAATTTACAAAACTGTACCAGATCCCACAGACT
GATATGGCTGAATGTGCAGAAAAGCTATTTGACTTGGTGGATGGTTTTGCTGAAAGCACCAAACGTAAAGCAGCAGTTTGGCCACTACAA
ATCATTCTCCTTATCTTGTGTCCAGAAATAATCCAGGATATATCCAAAGACGTGGTTGATGAAAACAACATGAATAAGAAGTTATTTCTG
GACAGTCTACGAAAAGCTCTTGCTGGCCATGGAGGAAGTAGGCAGCTGACAGAAAGTGCTGCAATTGCCTGTGTCAAACTGTGTAAAGCA
AGTACTTACATCAATTGGGAAGATAACTCTGTCATTTTCCTACTTGTTCAGTCCATGGTGGTTGATCTTAAGAACCTGCTTTTTAATCCA
AGTAAGCCATTCTCAAGAGGCAGTCAGCCTGCAGATGTGGATCTAATGATTGACTGCCTTGTTTCTTGCTTTCGTATAAGCCCTCACAAC
AACCAACACTTTAAGATCTGCCTGGCTCAGAATTCACCTTCTACATTTCACTATGTGCTGGTAAATTCACTCCATCGAATCATCACCAAT
TCCGCATTGGATTGGTGGCCTAAGATTGATGCTGTGTATTGTCACTCGGTTGAACTTCGAAATATGTTTGGTGAAACACTTCATAAAGCA
GTGCAAGGTTGTGGAGCACACCCAGCAATACGAATGGCACCGAGTCTTACATTTAAAGAAAAAGTAACAAGCCTTAAATTTAAAGAAAAA
CCTACAGACCTGGAGACAAGAAGCTATAAGTATCTTCTCTTGTCCATGGTGAAACTAATTCATGCAGATCCAAAGCTCTTGCTTTGTAAT
CCAAGAAAACAGGGGCCCGAAACCCAAGGCAGTACAGCAGAATTAATTACAGGGCTCGTCCAACTGGTCCCTCAGTCACACATGCCAGAG
ATTGCTCAGGAAGCAATGGAGGCTCTGCTGGTTCTTCATCAGTTAGATAGCATTGATTTGTGGAATCCTGATGCTCCTGTAGAAACATTT
TGGGAGATTAGCTCACAAATGCTTTTTTACATCTGCAAGAAATTAACTAGTCATCAAATGCTTAGTAGCACAGAAATTCTCAAGTGGTTG
CGGGAAATATTGATCTGCAGGAATAAATTTCTTCTTAAAAATAAGCAGGCAGATAGAAGTTCCTGTCACTTTCTCCTTTTTTACGGGGTA
GGATGTGATATTCCTTCTAGTGGAAATACCAGTCAAATGTCCATGGATCATGAAGAATTACTACGTACTCCTGGAGCCTCTCTCCGGAAG
GGAAAAGGGAACTCCTCTATGGATAGTGCAGCAGGATGCAGCGGAACCCCCCCGATTTGCCGACAAGCCCAGACCAAACTAGAAGTGGCC
CTGTACATGTTTCTGTGGAACCCTGACACTGAAGCTGTTCTGGTTGCCATGTCCTGTTTCCGCCACCTCTGTGAGGAAGCAGATATCCGG
TGTGGGGTGGATGAAGTGTCAGTGCATAACCTCTTGCCCAACTATAACACATTCATGGAGTTTGCCTCTGTCAGCAATATGATGTCAACA
GGAAGAGCAGCACTTCAGAAAAGAGTGATGGCACTGCTGAGGCGCATTGAGCATCCCACTGCAGGAAACACTGAGGCTTGGGAAGATACA
CATGCAAAATGGGAACAAGCAACAAAGCTAATCCTTAACTATCCAAAAGCCAAAATGGAAGATGGCCAGGCTGCTGAAAGCCTTCACAAG
ACCATTGTTAAGAGGCGAATGTCCCATGTGAGTGGAGGAGGATCCATAGATTTGTCTGACACAGACTCCCTACAGGAATGGATCAACATG
ACTGGCTTCCTTTGTGCCCTTGGGGGAGTGTGCCTCCAGCAGAGAAGCAATTCTGGCCTGGCAACCTATAGCCCACCCATGGGTCCAGTC
AGTGAACGTAAGGGTTCTATGATTTCAGTGATGTCTTCAGAGGGAAACGCAGATACACCTGTCAGCAAATTTATGGATCGGCTGTTGTCC
TTAATGGTGTGTAACCATGAGAAAGTGGGACTTCAAATACGGACCAATGTTAAGGATCTGGTGGGTCTAGAATTGAGTCCTGCTCTGTAT
CCAATGCTATTTAACAAATTGAAGAATACCATCAGCAAGTTTTTTGACTCCCAAGGACAGGTTTTATTGACTGATACCAATACTCAATTT
GTAGAACAAACCATAGCTATAATGAAGAACTTGCTAGATAATCATACTGAAGGCAGCTCTGAACATCTAGGGCAAGCTAGCATTGAAACA
ATGATGTTAAATCTGGTCAGGTATGTTCGTGTGCTTGGGAATATGGTCCATGCAATTCAAATAAAAACGAAACTGTGTCAATTAGTTGAA
GTAATGATGGCAAGGAGAGATGACCTCTCATTTTGCCAAGAGATGAAATTTAGGAATAAGATGGTAGAATACCTGACAGACTGGGTTATG
GGAACATCAAACCAAGCAGCAGATGATGATGTAAAATGTCTTACAAGAGATTTGGACCAGGCAAGCATGGAAGCAGTAGTTTCACTTCTA
GCTGGTCTCCCTCTGCAGCCTGAAGAAGGAGATGGTGTGGAATTGATGGAAGCCAAATCACAGTTATTTCTTAAATACTTCACATTATTT
ATGAACCTTTTGAATGACTGCAGTGAAGTTGAAGATGAAAGTGCGCAAACAGGTGGCAGGAAACGTGGCATGTCTCGGAGGCTGGCATCA
CTGAGGCACTGTACGGTCCTTGCAATGTCAAACTTACTCAATGCCAACGTAGACAGTGGTCTCATGCACTCCATAGGCTTAGGTTACCAC
AAGGATCTCCAGACAAGAGCTACATTTATGGAAGTTCTGACAAAAATCCTTCAACAAGGCACAGAATTTGACACACTTGCAGAAACAGTA
TTGGCTGATCGGTTTGAGAGATTGGTGGAACTGGTCACAATGATGGGTGATCAAGGAGAACTCCCTATAGCGATGGCTCTGGCCAATGTG
GTTCCTTGTTCTCAGTGGGATGAACTAGCTCGAGTTCTGGTTACTCTGTTTGATTCTCGGCATTTACTCTACCAACTGCTCTGGAACATG
TTTTCTAAAGAAGTAGAATTGGCAGACTCCATGCAGACTCTCTTCCGAGGCAACAGCTTGGCCAGTAAAATAATGACATTCTGTTTCAAG
GTATATGGTGCTACCTATCTACAAAAACTCCTGGATCCTTTATTACGAATTGTGATCACATCCTCTGATTGGCAACATGTTAGCTTTGAA
GTGGATCCTACCAGGTTAGAACCATCAGAGAGCCTTGAGGAAAACCAGCGGAACCTCCTTCAGATGACTGAAAAGTTCTTCCATGCCATC
ATCAGTTCCTCCTCAGAATTCCCCCCTCAACTTCGAAGTGTGTGCCACTGTTTATACCAGGCAACTTGCCACTCCCTACTGAATAAAGCT
ACAGTAAAAGAAAAAAAGGAAAACAAAAAATCAGTGGTTAGCCAGCGTTTCCCTCAGAACAGCATCGGTGCAGTAGGAAGTGCCATGTTC
CTCAGATTTATCAATCCTGCCATTGTCTCACCGTATGAAGCAGGGATTTTAGATAAAAAGCCACCACCTAGAATCGAAAGGGGCTTGAAG
TTAATGTCAAAGATACTTCAGAGTATTGCCAATCATGTTCTCTTCACAAAAGAAGAACATATGCGGCCTTTCAATGATTTTGTGAAAAGC
AACTTTGATGCAGCACGCAGGTTTTTCCTTGATATAGCATCTGATTGTCCTACAAGTGATGCAGTAAATCATAGTCTTTCCTTCATAAGT
GACGGCAATGTGCTTGCTTTACATCGTCTACTCTGGAACAATCAGGAGAAAATTGGGCAGTATCTTTCCAGCAACAGGGATCATAAAGCT
GTTGGAAGACGACCTTTTGATAAGATGGCAACACTTCTTGCATACCTGGGTCCTCCAGAGCACAAACCTGTGGCAGATACACACTGGTCC
AGCCTTAACCTTACCAGTTCAAAGTTTGAGGAATTTATGACTAGGCATCAGGTACATGAAAAAGAAGAATTCAAGGCTTTGAAAACGTTA
AGTATTTTCTACCAAGCTGGGACTTCCAAAGCTGGGAATCCTATTTTTTATTATGTTGCACGGAGAAACCGACCAGAGGGCAAAGTGTTG
GAGACAGTTGGTGTGTTTGAGGTGCCAAAACAGAATGGAAAATATGAGACCGGGCAGCTTTTCCTTCATAGCATTTTTGGCTACCGAGGT
GTCGTCCTGTTTCCCTGGCAGGCCAGACTGTATGACCGGGATGTGGCTTCTGCAGCTCCAGAAAAAGCAGAGAACCCTGCTGGCCATGGC
TCCAAGGAGGTGAAAGGCAAAACTCACACTTACTATCAGGTGCTGATTGATGCTCGTGACTGCCCACATATATCTCAGAGATCTCAGACA
GAAGCTGTGACCTTCTTGGCTAACCATGATGACAGTCGGGCCCTCTATGCCATCCCAGGCTTGGACTATGTCAGCCATGAAGACATCCTC
CCCTACACCTCCACTGATCAGGTTCCCATCCAACATGAACTCTTTGAAAGATTTCTTCTGTATGACCAGACAAAAGCACCTCCTTTTGTG
GCTCGGGAGACGCTAAGGGCCTGGCAAGAGAAGAATCACCCCTGGCTGGAGCTCTCCGATGTTCATCGGGAAACAACTGAGAACATACGT
GTCACTGTCATCCCCTTCTACATGGGCATGAGGGAAGCCCAGAATTCCCACGTGTACTGGTGGCGCTACTGTATCCGTTTGGAGAACCTT
GACAGTGATGTGGTACAGCTCCGGGAGCGGCACTGGAGGATATTCAGTCTCTCTGGCACCTTGGAGACAGTGCGAGGCCGAGGGGTAGTG
GGCAGGGAACCAGTGTTATCCAAGGAGCAGCCTGCGTTCCAGTATAGCAGCCACGTCTCGCTGCAGGCTTCCAGTGGGCACATGTGGGGC
ACGTTCCGCTTTGAAAGACCTGATGGCTCCCACTTTGATGTTCGGATTCCTCCCTTCTCCCTGGAAAGCAATAAAGATGAGAAGACACCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NF1_ENST00000356175_chr17_29592357_+_POLDIP2_ENST00000540200_chr17_26682902_-_7585nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGCTTCCAA
TAAAAACAGGACAGCAGAACACACATACCAAAGTCAGTACTGAGCACAACAAGGAATGTCTAATCAATATTTCCAAATACAAGTTTTCTT
TGGTTATAAGCGGCCTCACTACTATTTTAAAGAATGTTAACAATATGAGAATATTTGGAGAAGCTGCTGAAAAAAATTTATATCTCTCTC
AGTTGATTATATTGGATACACTGGAAAAATGTCTTGCTGGGCAACCAAAGGACACAATGAGATTAGATGAAACGATGCTGGTCAAACAGT
TGCTGCCAGAAATCTGCCATTTTCTTCACACCTGTCGTGAAGGAAACCAGCATGCAGCTGAACTTCGGAATTCTGCCTCTGGGGTTTTAT
TTTCTCTCAGCTGCAACAACTTCAATGCAGTCTTTAGTCGCATTTCTACCAGGTTACAGGAATTAACTGTTTGTTCAGAAGACAATGTTG
ATGTTCATGATATAGAATTGTTACAGTATATCAATGTGGATTGTGCAAAATTAAAACGACTCCTGAAGGAAACAGCATTTAAATTTAAAG
CCCTAAAGAAGGTTGCGCAGTTAGCAGTTATAAATAGCCTGGAAAAGGCATTTTGGAACTGGGTAGAAAATTATCCAGATGAATTTACAA
AACTGTACCAGATCCCACAGACTGATATGGCTGAATGTGCAGAAAAGCTATTTGACTTGGTGGATGGTTTTGCTGAAAGCACCAAACGTA
AAGCAGCAGTTTGGCCACTACAAATCATTCTCCTTATCTTGTGTCCAGAAATAATCCAGGATATATCCAAAGACGTGGTTGATGAAAACA
ACATGAATAAGAAGTTATTTCTGGACAGTCTACGAAAAGCTCTTGCTGGCCATGGAGGAAGTAGGCAGCTGACAGAAAGTGCTGCAATTG
CCTGTGTCAAACTGTGTAAAGCAAGTACTTACATCAATTGGGAAGATAACTCTGTCATTTTCCTACTTGTTCAGTCCATGGTGGTTGATC
TTAAGAACCTGCTTTTTAATCCAAGTAAGCCATTCTCAAGAGGCAGTCAGCCTGCAGATGTGGATCTAATGATTGACTGCCTTGTTTCTT
GCTTTCGTATAAGCCCTCACAACAACCAACACTTTAAGATCTGCCTGGCTCAGAATTCACCTTCTACATTTCACTATGTGCTGGTAAATT
CACTCCATCGAATCATCACCAATTCCGCATTGGATTGGTGGCCTAAGATTGATGCTGTGTATTGTCACTCGGTTGAACTTCGAAATATGT
TTGGTGAAACACTTCATAAAGCAGTGCAAGGTTGTGGAGCACACCCAGCAATACGAATGGCACCGAGTCTTACATTTAAAGAAAAAGTAA
CAAGCCTTAAATTTAAAGAAAAACCTACAGACCTGGAGACAAGAAGCTATAAGTATCTTCTCTTGTCCATGGTGAAACTAATTCATGCAG
ATCCAAAGCTCTTGCTTTGTAATCCAAGAAAACAGGGGCCCGAAACCCAAGGCAGTACAGCAGAATTAATTACAGGGCTCGTCCAACTGG
TCCCTCAGTCACACATGCCAGAGATTGCTCAGGAAGCAATGGAGGCTCTGCTGGTTCTTCATCAGTTAGATAGCATTGATTTGTGGAATC
CTGATGCTCCTGTAGAAACATTTTGGGAGATTAGCTCACAAATGCTTTTTTACATCTGCAAGAAATTAACTAGTCATCAAATGCTTAGTA
GCACAGAAATTCTCAAGTGGTTGCGGGAAATATTGATCTGCAGGAATAAATTTCTTCTTAAAAATAAGCAGGCAGATAGAAGTTCCTGTC
ACTTTCTCCTTTTTTACGGGGTAGGATGTGATATTCCTTCTAGTGGAAATACCAGTCAAATGTCCATGGATCATGAAGAATTACTACGTA
CTCCTGGAGCCTCTCTCCGGAAGGGAAAAGGGAACTCCTCTATGGATAGTGCAGCAGGATGCAGCGGAACCCCCCCGATTTGCCGACAAG
CCCAGACCAAACTAGAAGTGGCCCTGTACATGTTTCTGTGGAACCCTGACACTGAAGCTGTTCTGGTTGCCATGTCCTGTTTCCGCCACC
TCTGTGAGGAAGCAGATATCCGGTGTGGGGTGGATGAAGTGTCAGTGCATAACCTCTTGCCCAACTATAACACATTCATGGAGTTTGCCT
CTGTCAGCAATATGATGTCAACAGGAAGAGCAGCACTTCAGAAAAGAGTGATGGCACTGCTGAGGCGCATTGAGCATCCCACTGCAGGAA
ACACTGAGGCTTGGGAAGATACACATGCAAAATGGGAACAAGCAACAAAGCTAATCCTTAACTATCCAAAAGCCAAAATGGAAGATGGCC
AGGCTGCTGAAAGCCTTCACAAGACCATTGTTAAGAGGCGAATGTCCCATGTGAGTGGAGGAGGATCCATAGATTTGTCTGACACAGACT
CCCTACAGGAATGGATCAACATGACTGGCTTCCTTTGTGCCCTTGGGGGAGTGTGCCTCCAGCAGAGAAGCAATTCTGGCCTGGCAACCT
ATAGCCCACCCATGGGTCCAGTCAGTGAACGTAAGGGTTCTATGATTTCAGTGATGTCTTCAGAGGGAAACGCAGATACACCTGTCAGCA
AATTTATGGATCGGCTGTTGTCCTTAATGGTGTGTAACCATGAGAAAGTGGGACTTCAAATACGGACCAATGTTAAGGATCTGGTGGGTC
TAGAATTGAGTCCTGCTCTGTATCCAATGCTATTTAACAAATTGAAGAATACCATCAGCAAGTTTTTTGACTCCCAAGGACAGGTTTTAT
TGACTGATACCAATACTCAATTTGTAGAACAAACCATAGCTATAATGAAGAACTTGCTAGATAATCATACTGAAGGCAGCTCTGAACATC
TAGGGCAAGCTAGCATTGAAACAATGATGTTAAATCTGGTCAGGTATGTTCGTGTGCTTGGGAATATGGTCCATGCAATTCAAATAAAAA
CGAAACTGTGTCAATTAGTTGAAGTAATGATGGCAAGGAGAGATGACCTCTCATTTTGCCAAGAGATGAAATTTAGGAATAAGATGGTAG
AATACCTGACAGACTGGGTTATGGGAACATCAAACCAAGCAGCAGATGATGATGTAAAATGTCTTACAAGAGATTTGGACCAGGCAAGCA
TGGAAGCAGTAGTTTCACTTCTAGCTGGTCTCCCTCTGCAGCCTGAAGAAGGAGATGGTGTGGAATTGATGGAAGCCAAATCACAGTTAT
TTCTTAAATACTTCACATTATTTATGAACCTTTTGAATGACTGCAGTGAAGTTGAAGATGAAAGTGCGCAAACAGGTGGCAGGAAACGTG
GCATGTCTCGGAGGCTGGCATCACTGAGGCACTGTACGGTCCTTGCAATGTCAAACTTACTCAATGCCAACGTAGACAGTGGTCTCATGC
ACTCCATAGGCTTAGGTTACCACAAGGATCTCCAGACAAGAGCTACATTTATGGAAGTTCTGACAAAAATCCTTCAACAAGGCACAGAAT
TTGACACACTTGCAGAAACAGTATTGGCTGATCGGTTTGAGAGATTGGTGGAACTGGTCACAATGATGGGTGATCAAGGAGAACTCCCTA
TAGCGATGGCTCTGGCCAATGTGGTTCCTTGTTCTCAGTGGGATGAACTAGCTCGAGTTCTGGTTACTCTGTTTGATTCTCGGCATTTAC
TCTACCAACTGCTCTGGAACATGTTTTCTAAAGAAGTAGAATTGGCAGACTCCATGCAGACTCTCTTCCGAGGCAACAGCTTGGCCAGTA
AAATAATGACATTCTGTTTCAAGGTATATGGTGCTACCTATCTACAAAAACTCCTGGATCCTTTATTACGAATTGTGATCACATCCTCTG
ATTGGCAACATGTTAGCTTTGAAGTGGATCCTACCAGGTTAGAACCATCAGAGAGCCTTGAGGAAAACCAGCGGAACCTCCTTCAGATGA
CTGAAAAGTTCTTCCATGCCATCATCAGTTCCTCCTCAGAATTCCCCCCTCAACTTCGAAGTGTGTGCCACTGTTTATACCAGGTGGTTA
GCCAGCGTTTCCCTCAGAACAGCATCGGTGCAGTAGGAAGTGCCATGTTCCTCAGATTTATCAATCCTGCCATTGTCTCACCGTATGAAG
CAGGGATTTTAGATAAAAAGCCACCACCTAGAATCGAAAGGGGCTTGAAGTTAATGTCAAAGATACTTCAGAGTATTGCCAATCATGTTC
TCTTCACAAAAGAAGAACATATGCGGCCTTTCAATGATTTTGTGAAAAGCAACTTTGATGCAGCACGCAGGTTTTTCCTTGATATAGCAT
CTGATTGTCCTACAAGTGATGCAGTAAATCATAGTCTTTCCTTCATAAGTGACGGCAATGTGCTTGCTTTACATCGTCTACTCTGGAACA
ATCAGGAGAAAATTGGGCAGTATCTTTCCAGCAACAGGGATCATAAAGCTGTTGGAAGACGACCTTTTGATAAGATGGCAACACTTCTTG
CATACCTGGGTCCTCCAGAGCACAAACCTGTGGCAGATACACACTGGTCCAGCCTTAACCTTACCAGTTCAAAGTTTGAGGAATTTATGA
CTAGGCATCAGGTACATGAAAAAGAAGAATTCAAGGCTTTGAAAACGTTAAGTATTTTCTACCAAGCTGGGACTTCCAAAGCTGGGAATC
CTATTTTTTATTATGTTGCACGGAGAAACCGACCAGAGGGCAAAGTGTTGGAGACAGTTGGTGTGTTTGAGGTGCCAAAACAGAATGGAA
AATATGAGACCGGGCAGCTTTTCCTTCATAGCATTTTTGGCTACCGAGGTGTCGTCCTGTTTCCCTGGCAGGCCAGACTGTATGACCGGG
ATGTGGCTTCTGCAGCTCCAGAAAAAGCAGAGAACCCTGCTGGCCATGGCTCCAAGGAGGTGAAAGGCAAAACTCACACTTACTATCAGG
TGCTGATTGATGCTCGTGACTGCCCACATATATCTCAGAGATCTCAGACAGAAGCTGTGACCTTCTTGGCTAACCATGATGACAGTCGGG
CCCTCTATGCCATCCCAGGCTTGGACTATGTCAGCCATGAAGACATCCTCCCCTACACCTCCACTGATCAGGTTCCCATCCAACATGAAC
TCTTTGAAAGATTTCTTCTGTATGACCAGACAAAAGCACCTCCTTTTGTGGCTCGGGAGACGCTAAGGGCCTGGCAAGAGAAGAATCACC
CCTGGCTGGAGCTCTCCGATGTTCATCGGGAAACAACTGAGAACATACGTGTCACTGTCATCCCCTTCTACATGGGCATGAGGGAAGCCC
AGAATTCCCACGTGTACTGGTGGCGCTACTGTATCCGTTTGGAGAACCTTGACAGTGATGTGGTACAGCTCCGGGAGCGGCACTGGAGGA
TATTCAGTCTCTCTGGCACCTTGGAGACAGTGCGAGGCCGAGGGGTAGTGGGCAGGGAACCAGTGTTATCCAAGGAGCAGCCTGCGTTCC
AGTATAGCAGCCACGTCTCGCTGCAGGCTTCCAGTGGGCACATGTGGGGCACGTTCCGCTTTGAAAGACCTGATGGCTCCCACTTTGATG
TTCGGATTCCTCCCTTCTCCCTGGAAAGCAATAAAGATGAGAAGACACCACCCTCAGGCCTTCACTGGTAGGCCAGCTGAGGCCCCAAGT
GCCCAGGCTTGGTCACCGGGAAGAACAACTCTCATCCCACAATTGCTGCAGAACTCTTCTCTCCCCATCATGGGCCACAGTGGGTCTCTT
AATTTGATTGTGGGGTTCTTTTTGTGGGGAGGGGTGGTATAACTTTTCTTCAGAAGACCCATGTGGGACACCTCCAAGGCTGGCCTCCTC
ATAAGCCCTGCCTACACCATGTTCCAGTAAACCTCTCCACCAAGGAACTGTGTTCAGCTGCCACAGGCCTGGAGGAGTTTCCTGGCCTGT
CACGTGAGGTTTGATCAGTAAACCAGTGCACGCTTGGCCACCCTTGCCATTTCTGCTCCCAGAGTCTCAGGCTCCCCTTCTGACCCAGTG
TGCGCCCTTGACTGCTTTCTTTGCTGCCCTTCCAGGGAGCTGCCCCCCTGGTAGGGCATGTGCCTGTTTCCCTCTCAGCCTGGAGGCTGG
CTGGACATCTCCTAGGGTCACTGTGCCTCTCAGCTAGTTGGCGGGGGTGCTGGACTGGACTCTTGTTCACTTTACCTTCTGCCAAATGCA
GAGAGGGAGGCCAGTGTCAGGGTCGGAGTGGCCTGGCTCTTAGCACTGACCGACCATTGCCATTTCTGGCCTCGCTAGGCCCAGGAGAGG
AGGGAGGCAAGCCAGTCGGGTTTCCTGGAGCAATGGGTGTGCCAGCCCTCAGCATGACTCTGCCAAGCATCCAGACCACAAATGCAGGAA
TTTGGCTGAGGAGCAGCTTTAGGTATGGATTGATGACTAAGTCAAGCTACTTCCTGAGCTTCTCTCAGATTTCCAAGAGCCAGAGATGAA
TTGTGCTGCATCTTGCCCCAATTCTTAGGATTTCTTTTCCTCCGCCACTGCAGTGATTGTTAGAGGTAGTTTTCTTGAATTAATATTAAA
TCACAGTTCCAGCCCTTGTTATTCTTGTCCTTAGTCCTCCAGGGGGAGCTGGGGTTGCAGGGCAACAGTACAGTCGCGCTTACGACCTGG
CTAGAACACAAGGTCAGATGATAAACAGAAGCACAGGAACTCAGCCCATGGCCGCAAGCTGGTCAAGGCCTGCTCACTGTAAACATGGCT
CTGTACCATTGAGTTTAACACAATTTTATTAGAAATTAGTGTTTGCTTCCATCACTTATGCTGAGCAACCAAATATTACAGTTATGTGAT
AAAGGAAAAATTCTTTCCTGCCCAGGACCTGCGCCATCCTTTAGGCCGACCTTGGTCACATACCAAATTCAATAAAACCCAATACTGGCC
TGTGTTGTTAACAGCAGGCTGCCAGGTTTCTCAGAAACTGACAAGAAAATCTGACCTTCATCCATACTTTGTTTACTTACCCCTGGGCTG
CTTGGAGTTGAAAAATGCACACAGCCAAGAGTTGCTTTCTGAATAGGGCTGGAAACTTTCAAAGAAAACCCCCAAACTTTTAAGTCACAA

>In-frame_NF1_ENST00000358273_chr17_29592357_+_POLDIP2_ENST00000540200_chr17_26682902_-_7648nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGCTTCCAA
TAAAAACAGGACAGCAGAACACACATACCAAAGTCAGTACTGAGCACAACAAGGAATGTCTAATCAATATTTCCAAATACAAGTTTTCTT
TGGTTATAAGCGGCCTCACTACTATTTTAAAGAATGTTAACAATATGAGAATATTTGGAGAAGCTGCTGAAAAAAATTTATATCTCTCTC
AGTTGATTATATTGGATACACTGGAAAAATGTCTTGCTGGGCAACCAAAGGACACAATGAGATTAGATGAAACGATGCTGGTCAAACAGT
TGCTGCCAGAAATCTGCCATTTTCTTCACACCTGTCGTGAAGGAAACCAGCATGCAGCTGAACTTCGGAATTCTGCCTCTGGGGTTTTAT
TTTCTCTCAGCTGCAACAACTTCAATGCAGTCTTTAGTCGCATTTCTACCAGGTTACAGGAATTAACTGTTTGTTCAGAAGACAATGTTG
ATGTTCATGATATAGAATTGTTACAGTATATCAATGTGGATTGTGCAAAATTAAAACGACTCCTGAAGGAAACAGCATTTAAATTTAAAG
CCCTAAAGAAGGTTGCGCAGTTAGCAGTTATAAATAGCCTGGAAAAGGCATTTTGGAACTGGGTAGAAAATTATCCAGATGAATTTACAA
AACTGTACCAGATCCCACAGACTGATATGGCTGAATGTGCAGAAAAGCTATTTGACTTGGTGGATGGTTTTGCTGAAAGCACCAAACGTA
AAGCAGCAGTTTGGCCACTACAAATCATTCTCCTTATCTTGTGTCCAGAAATAATCCAGGATATATCCAAAGACGTGGTTGATGAAAACA
ACATGAATAAGAAGTTATTTCTGGACAGTCTACGAAAAGCTCTTGCTGGCCATGGAGGAAGTAGGCAGCTGACAGAAAGTGCTGCAATTG
CCTGTGTCAAACTGTGTAAAGCAAGTACTTACATCAATTGGGAAGATAACTCTGTCATTTTCCTACTTGTTCAGTCCATGGTGGTTGATC
TTAAGAACCTGCTTTTTAATCCAAGTAAGCCATTCTCAAGAGGCAGTCAGCCTGCAGATGTGGATCTAATGATTGACTGCCTTGTTTCTT
GCTTTCGTATAAGCCCTCACAACAACCAACACTTTAAGATCTGCCTGGCTCAGAATTCACCTTCTACATTTCACTATGTGCTGGTAAATT
CACTCCATCGAATCATCACCAATTCCGCATTGGATTGGTGGCCTAAGATTGATGCTGTGTATTGTCACTCGGTTGAACTTCGAAATATGT
TTGGTGAAACACTTCATAAAGCAGTGCAAGGTTGTGGAGCACACCCAGCAATACGAATGGCACCGAGTCTTACATTTAAAGAAAAAGTAA
CAAGCCTTAAATTTAAAGAAAAACCTACAGACCTGGAGACAAGAAGCTATAAGTATCTTCTCTTGTCCATGGTGAAACTAATTCATGCAG
ATCCAAAGCTCTTGCTTTGTAATCCAAGAAAACAGGGGCCCGAAACCCAAGGCAGTACAGCAGAATTAATTACAGGGCTCGTCCAACTGG
TCCCTCAGTCACACATGCCAGAGATTGCTCAGGAAGCAATGGAGGCTCTGCTGGTTCTTCATCAGTTAGATAGCATTGATTTGTGGAATC
CTGATGCTCCTGTAGAAACATTTTGGGAGATTAGCTCACAAATGCTTTTTTACATCTGCAAGAAATTAACTAGTCATCAAATGCTTAGTA
GCACAGAAATTCTCAAGTGGTTGCGGGAAATATTGATCTGCAGGAATAAATTTCTTCTTAAAAATAAGCAGGCAGATAGAAGTTCCTGTC
ACTTTCTCCTTTTTTACGGGGTAGGATGTGATATTCCTTCTAGTGGAAATACCAGTCAAATGTCCATGGATCATGAAGAATTACTACGTA
CTCCTGGAGCCTCTCTCCGGAAGGGAAAAGGGAACTCCTCTATGGATAGTGCAGCAGGATGCAGCGGAACCCCCCCGATTTGCCGACAAG
CCCAGACCAAACTAGAAGTGGCCCTGTACATGTTTCTGTGGAACCCTGACACTGAAGCTGTTCTGGTTGCCATGTCCTGTTTCCGCCACC
TCTGTGAGGAAGCAGATATCCGGTGTGGGGTGGATGAAGTGTCAGTGCATAACCTCTTGCCCAACTATAACACATTCATGGAGTTTGCCT
CTGTCAGCAATATGATGTCAACAGGAAGAGCAGCACTTCAGAAAAGAGTGATGGCACTGCTGAGGCGCATTGAGCATCCCACTGCAGGAA
ACACTGAGGCTTGGGAAGATACACATGCAAAATGGGAACAAGCAACAAAGCTAATCCTTAACTATCCAAAAGCCAAAATGGAAGATGGCC
AGGCTGCTGAAAGCCTTCACAAGACCATTGTTAAGAGGCGAATGTCCCATGTGAGTGGAGGAGGATCCATAGATTTGTCTGACACAGACT
CCCTACAGGAATGGATCAACATGACTGGCTTCCTTTGTGCCCTTGGGGGAGTGTGCCTCCAGCAGAGAAGCAATTCTGGCCTGGCAACCT
ATAGCCCACCCATGGGTCCAGTCAGTGAACGTAAGGGTTCTATGATTTCAGTGATGTCTTCAGAGGGAAACGCAGATACACCTGTCAGCA
AATTTATGGATCGGCTGTTGTCCTTAATGGTGTGTAACCATGAGAAAGTGGGACTTCAAATACGGACCAATGTTAAGGATCTGGTGGGTC
TAGAATTGAGTCCTGCTCTGTATCCAATGCTATTTAACAAATTGAAGAATACCATCAGCAAGTTTTTTGACTCCCAAGGACAGGTTTTAT
TGACTGATACCAATACTCAATTTGTAGAACAAACCATAGCTATAATGAAGAACTTGCTAGATAATCATACTGAAGGCAGCTCTGAACATC
TAGGGCAAGCTAGCATTGAAACAATGATGTTAAATCTGGTCAGGTATGTTCGTGTGCTTGGGAATATGGTCCATGCAATTCAAATAAAAA
CGAAACTGTGTCAATTAGTTGAAGTAATGATGGCAAGGAGAGATGACCTCTCATTTTGCCAAGAGATGAAATTTAGGAATAAGATGGTAG
AATACCTGACAGACTGGGTTATGGGAACATCAAACCAAGCAGCAGATGATGATGTAAAATGTCTTACAAGAGATTTGGACCAGGCAAGCA
TGGAAGCAGTAGTTTCACTTCTAGCTGGTCTCCCTCTGCAGCCTGAAGAAGGAGATGGTGTGGAATTGATGGAAGCCAAATCACAGTTAT
TTCTTAAATACTTCACATTATTTATGAACCTTTTGAATGACTGCAGTGAAGTTGAAGATGAAAGTGCGCAAACAGGTGGCAGGAAACGTG
GCATGTCTCGGAGGCTGGCATCACTGAGGCACTGTACGGTCCTTGCAATGTCAAACTTACTCAATGCCAACGTAGACAGTGGTCTCATGC
ACTCCATAGGCTTAGGTTACCACAAGGATCTCCAGACAAGAGCTACATTTATGGAAGTTCTGACAAAAATCCTTCAACAAGGCACAGAAT
TTGACACACTTGCAGAAACAGTATTGGCTGATCGGTTTGAGAGATTGGTGGAACTGGTCACAATGATGGGTGATCAAGGAGAACTCCCTA
TAGCGATGGCTCTGGCCAATGTGGTTCCTTGTTCTCAGTGGGATGAACTAGCTCGAGTTCTGGTTACTCTGTTTGATTCTCGGCATTTAC
TCTACCAACTGCTCTGGAACATGTTTTCTAAAGAAGTAGAATTGGCAGACTCCATGCAGACTCTCTTCCGAGGCAACAGCTTGGCCAGTA
AAATAATGACATTCTGTTTCAAGGTATATGGTGCTACCTATCTACAAAAACTCCTGGATCCTTTATTACGAATTGTGATCACATCCTCTG
ATTGGCAACATGTTAGCTTTGAAGTGGATCCTACCAGGTTAGAACCATCAGAGAGCCTTGAGGAAAACCAGCGGAACCTCCTTCAGATGA
CTGAAAAGTTCTTCCATGCCATCATCAGTTCCTCCTCAGAATTCCCCCCTCAACTTCGAAGTGTGTGCCACTGTTTATACCAGGCAACTT
GCCACTCCCTACTGAATAAAGCTACAGTAAAAGAAAAAAAGGAAAACAAAAAATCAGTGGTTAGCCAGCGTTTCCCTCAGAACAGCATCG
GTGCAGTAGGAAGTGCCATGTTCCTCAGATTTATCAATCCTGCCATTGTCTCACCGTATGAAGCAGGGATTTTAGATAAAAAGCCACCAC
CTAGAATCGAAAGGGGCTTGAAGTTAATGTCAAAGATACTTCAGAGTATTGCCAATCATGTTCTCTTCACAAAAGAAGAACATATGCGGC
CTTTCAATGATTTTGTGAAAAGCAACTTTGATGCAGCACGCAGGTTTTTCCTTGATATAGCATCTGATTGTCCTACAAGTGATGCAGTAA
ATCATAGTCTTTCCTTCATAAGTGACGGCAATGTGCTTGCTTTACATCGTCTACTCTGGAACAATCAGGAGAAAATTGGGCAGTATCTTT
CCAGCAACAGGGATCATAAAGCTGTTGGAAGACGACCTTTTGATAAGATGGCAACACTTCTTGCATACCTGGGTCCTCCAGAGCACAAAC
CTGTGGCAGATACACACTGGTCCAGCCTTAACCTTACCAGTTCAAAGTTTGAGGAATTTATGACTAGGCATCAGGTACATGAAAAAGAAG
AATTCAAGGCTTTGAAAACGTTAAGTATTTTCTACCAAGCTGGGACTTCCAAAGCTGGGAATCCTATTTTTTATTATGTTGCACGGAGAA
ACCGACCAGAGGGCAAAGTGTTGGAGACAGTTGGTGTGTTTGAGGTGCCAAAACAGAATGGAAAATATGAGACCGGGCAGCTTTTCCTTC
ATAGCATTTTTGGCTACCGAGGTGTCGTCCTGTTTCCCTGGCAGGCCAGACTGTATGACCGGGATGTGGCTTCTGCAGCTCCAGAAAAAG
CAGAGAACCCTGCTGGCCATGGCTCCAAGGAGGTGAAAGGCAAAACTCACACTTACTATCAGGTGCTGATTGATGCTCGTGACTGCCCAC
ATATATCTCAGAGATCTCAGACAGAAGCTGTGACCTTCTTGGCTAACCATGATGACAGTCGGGCCCTCTATGCCATCCCAGGCTTGGACT
ATGTCAGCCATGAAGACATCCTCCCCTACACCTCCACTGATCAGGTTCCCATCCAACATGAACTCTTTGAAAGATTTCTTCTGTATGACC
AGACAAAAGCACCTCCTTTTGTGGCTCGGGAGACGCTAAGGGCCTGGCAAGAGAAGAATCACCCCTGGCTGGAGCTCTCCGATGTTCATC
GGGAAACAACTGAGAACATACGTGTCACTGTCATCCCCTTCTACATGGGCATGAGGGAAGCCCAGAATTCCCACGTGTACTGGTGGCGCT
ACTGTATCCGTTTGGAGAACCTTGACAGTGATGTGGTACAGCTCCGGGAGCGGCACTGGAGGATATTCAGTCTCTCTGGCACCTTGGAGA
CAGTGCGAGGCCGAGGGGTAGTGGGCAGGGAACCAGTGTTATCCAAGGAGCAGCCTGCGTTCCAGTATAGCAGCCACGTCTCGCTGCAGG
CTTCCAGTGGGCACATGTGGGGCACGTTCCGCTTTGAAAGACCTGATGGCTCCCACTTTGATGTTCGGATTCCTCCCTTCTCCCTGGAAA
GCAATAAAGATGAGAAGACACCACCCTCAGGCCTTCACTGGTAGGCCAGCTGAGGCCCCAAGTGCCCAGGCTTGGTCACCGGGAAGAACA
ACTCTCATCCCACAATTGCTGCAGAACTCTTCTCTCCCCATCATGGGCCACAGTGGGTCTCTTAATTTGATTGTGGGGTTCTTTTTGTGG
GGAGGGGTGGTATAACTTTTCTTCAGAAGACCCATGTGGGACACCTCCAAGGCTGGCCTCCTCATAAGCCCTGCCTACACCATGTTCCAG
TAAACCTCTCCACCAAGGAACTGTGTTCAGCTGCCACAGGCCTGGAGGAGTTTCCTGGCCTGTCACGTGAGGTTTGATCAGTAAACCAGT
GCACGCTTGGCCACCCTTGCCATTTCTGCTCCCAGAGTCTCAGGCTCCCCTTCTGACCCAGTGTGCGCCCTTGACTGCTTTCTTTGCTGC
CCTTCCAGGGAGCTGCCCCCCTGGTAGGGCATGTGCCTGTTTCCCTCTCAGCCTGGAGGCTGGCTGGACATCTCCTAGGGTCACTGTGCC
TCTCAGCTAGTTGGCGGGGGTGCTGGACTGGACTCTTGTTCACTTTACCTTCTGCCAAATGCAGAGAGGGAGGCCAGTGTCAGGGTCGGA
GTGGCCTGGCTCTTAGCACTGACCGACCATTGCCATTTCTGGCCTCGCTAGGCCCAGGAGAGGAGGGAGGCAAGCCAGTCGGGTTTCCTG
GAGCAATGGGTGTGCCAGCCCTCAGCATGACTCTGCCAAGCATCCAGACCACAAATGCAGGAATTTGGCTGAGGAGCAGCTTTAGGTATG
GATTGATGACTAAGTCAAGCTACTTCCTGAGCTTCTCTCAGATTTCCAAGAGCCAGAGATGAATTGTGCTGCATCTTGCCCCAATTCTTA
GGATTTCTTTTCCTCCGCCACTGCAGTGATTGTTAGAGGTAGTTTTCTTGAATTAATATTAAATCACAGTTCCAGCCCTTGTTATTCTTG
TCCTTAGTCCTCCAGGGGGAGCTGGGGTTGCAGGGCAACAGTACAGTCGCGCTTACGACCTGGCTAGAACACAAGGTCAGATGATAAACA
GAAGCACAGGAACTCAGCCCATGGCCGCAAGCTGGTCAAGGCCTGCTCACTGTAAACATGGCTCTGTACCATTGAGTTTAACACAATTTT
ATTAGAAATTAGTGTTTGCTTCCATCACTTATGCTGAGCAACCAAATATTACAGTTATGTGATAAAGGAAAAATTCTTTCCTGCCCAGGA
CCTGCGCCATCCTTTAGGCCGACCTTGGTCACATACCAAATTCAATAAAACCCAATACTGGCCTGTGTTGTTAACAGCAGGCTGCCAGGT
TTCTCAGAAACTGACAAGAAAATCTGACCTTCATCCATACTTTGTTTACTTACCCCTGGGCTGCTTGGAGTTGAAAAATGCACACAGCCA


Top

FusionGenePPI for NF1_POLDIP2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NF1HRAS, SMARCA4, POLR2A, TIRAP, SIRT7, VCP, NSFL1C, CAV1, YWHAB, FAF2, NXF1, CCDC8, HLA-DPA1, EFNB2, CD274, TNFSF13B, CA14, SLAMF1, VSIG4, TGOLN2, HTR6, NOSIP, KRAS, CLK1, CDC5L, APP, YWHAH, PML, TRAF6, PTEN, SDC2, EGFR, CD79B, P4HA3, SCN3B, VSIG1, SIGLECL1, EPHA1, FAM174A, KCTD3, KIF13B, ZBTB21, KSR1, CGN, GIGYF1, LRFN1, RTKN, MAST3, DENND1A, SH3PXD2A, SRGAP2, DENND4C, PPM1H, EIF4E2, SIPA1L1, LIMA1, RALGPS2, MAGI1, CBY1, TESK2, CDC25C, DCLK1, GIGYF2, HDAC4, LPIN3, ZNF638, CAMSAP2, NADK, MAPKAP1, SRSF12, RASAL2, SYDE1, KIAA1804, TIAM1, AGAP1, CDC25B, CDK16, SH3RF3, PHLDB2, PLEKHA7, KIF1C, OSBPL6, FAM110B, USP21, NAV1, TANC2, PTPN13, FAM53C, ANKRD34A, STARD13, PTPN14, GAB2, DENND4A, INPP5E, TOP1, TOP2A, TOP3A, NRASPOLDIP2ASCC2, SELENBP1, CPE, PCNA, POLN, REV1, MAD2L2, ICT1, PDPK1, HDAC6, TAB1, CUL3, APP, PPP2R1A, TP53, ALAS1, MTUS2, SHMT2, MOV10, NXF1, EGFR, PTEN, MED23, MCM2, CHCHD2, CHCHD10, CISD3, C7orf55, SPATA20, NDUFA4, PTPMT1, NME4, COQ9, COQ6, XPNPEP3, C17orf89, TRUB2, NDUFS3, C6orf203, COQ5, DHRS4, C15orf48, LACTB, ATP5A1, COQ7, ADCK4, LYRM2, COQ10B, PAK7, FAM136A, COQ4, ADCK3, NIT1, SUGCT, OCIAD1, NDUFAF4, CECR5, NFATC2, MTMR4, PTP4A1, PTPDC1, TENC1, CLPX, NT5DC2, POLDIP2, ZNHIT2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NF1_POLDIP2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NF1_POLDIP2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNF1C0027831Neurofibromatosis 134CTD_human;ORPHANET;UNIPROT
HgeneNF1C2931482Neurofibromatosis-Noonan syndrome5CTD_human;ORPHANET;UNIPROT
HgeneNF1C0349639Juvenile Myelomonocytic Leukemia3CTD_human;HPO;ORPHANET
HgeneNF1C0004114Astrocytoma2CTD_human;HPO
HgeneNF1C0023467Leukemia, Myelocytic, Acute2CTD_human
HgeneNF1C0025202melanoma2CTD_human
HgeneNF1C0206727Nerve Sheath Tumors2CTD_human
HgeneNF1C0001430Adenoma1CTD_human
HgeneNF1C0004352Autistic Disorder1CTD_human
HgeneNF1C0016057Fibrosarcoma1CTD_human
HgeneNF1C0017636Glioblastoma1CTD_human
HgeneNF1C0017638Glioma1CTD_human
HgeneNF1C0023186Learning Disorders1CTD_human
HgeneNF1C0023827liposarcoma1CTD_human
HgeneNF1C0027809Neurilemmoma1CTD_human
HgeneNF1C0027830neurofibroma1CTD_human
HgeneNF1C0027962Melanocytic nevus1CTD_human
HgeneNF1C0031511Pheochromocytoma1CTD_human
HgeneNF1C0162678Neurofibromatoses1CTD_human;HPO
HgeneNF1C1261473Sarcoma1CTD_human
HgeneNF1C1834235NEUROFIBROMATOSIS, FAMILIAL SPINAL1CTD_human;UNIPROT
HgeneNF1C3714756Intellectual Disability1CTD_human;HPO