FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24081

FusionGeneSummary for NF1_ACACA

check button Fusion gene summary
Fusion gene informationFusion gene name: NF1_ACACA
Fusion gene ID: 24081
HgeneTgene
Gene symbol

NF1

ACACA

Gene ID

4763

31

Gene nameneurofibromin 1acetyl-CoA carboxylase alpha
SynonymsNFNS|VRNF|WSSACAC|ACACAD|ACC|ACC1|ACCA
Cytomap

17q11.2

17q12

Type of geneprotein-codingprotein-coding
Descriptionneurofibrominneurofibromatosis 1neurofibromatosis-related protein NF-1truncated neurofibromin 1acetyl-CoA carboxylase 1ACC-alphaacetyl-Coenzyme A carboxylase alpha
Modification date2018052720180522
UniProtAcc

P21359

Q13085

Ensembl transtripts involved in fusion geneENST00000356175, ENST00000358273, 
ENST00000431387, ENST00000581113, 
ENST00000417592, ENST00000444181, 
ENST00000353139, ENST00000360679, 
ENST00000394406, ENST00000335166, 
ENST00000416895, ENST00000361253, 
ENST00000588142, ENST00000589665, 
Fusion gene scores* DoF score35 X 18 X 19=1197010 X 9 X 5=450
# samples 469
** MAII scorelog2(46/11970*10)=-4.70164548088649
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/450*10)=-2.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NF1 [Title/Abstract] AND ACACA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNF1

GO:0043547

positive regulation of GTPase activity

2121371


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E9-A1N6-01ANF1chr17

29422387

+ACACAchr17

35518964

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000356175ENST00000353139NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000356175ENST00000360679NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000356175ENST00000394406NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000356175ENST00000335166NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000356175ENST00000416895NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000356175ENST00000361253NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000356175ENST00000588142NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000356175ENST00000589665NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000358273ENST00000353139NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000358273ENST00000360679NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000358273ENST00000394406NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000358273ENST00000335166NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000358273ENST00000416895NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000358273ENST00000361253NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000358273ENST00000588142NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000358273ENST00000589665NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000431387ENST00000353139NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000431387ENST00000360679NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000431387ENST00000394406NF1chr17

29422387

+ACACAchr17

35518964

-
In-frameENST00000431387ENST00000335166NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000431387ENST00000416895NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000431387ENST00000361253NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000431387ENST00000588142NF1chr17

29422387

+ACACAchr17

35518964

-
5CDS-intronENST00000431387ENST00000589665NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000581113ENST00000353139NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000581113ENST00000360679NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000581113ENST00000394406NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000581113ENST00000335166NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000581113ENST00000416895NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000581113ENST00000361253NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000581113ENST00000588142NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000581113ENST00000589665NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000417592ENST00000353139NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000417592ENST00000360679NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000417592ENST00000394406NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000417592ENST00000335166NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000417592ENST00000416895NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000417592ENST00000361253NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000417592ENST00000588142NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000417592ENST00000589665NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000444181ENST00000353139NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000444181ENST00000360679NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000444181ENST00000394406NF1chr17

29422387

+ACACAchr17

35518964

-
intron-3CDSENST00000444181ENST00000335166NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000444181ENST00000416895NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000444181ENST00000361253NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000444181ENST00000588142NF1chr17

29422387

+ACACAchr17

35518964

-
intron-intronENST00000444181ENST00000589665NF1chr17

29422387

+ACACAchr17

35518964

-

Top

FusionProtFeatures for NF1_ACACA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NF1

P21359

ACACA

Q13085

Stimulates the GTPase activity of Ras. NF1 shows greateraffinity for Ras GAP, but lower specific activity. May be aregulator of Ras activity. {ECO:0000269|PubMed:2121371,ECO:0000269|PubMed:8417346}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneACACAchr17:29422387chr17:35518964ENST00000335166-39551576_191415782269DomainCoA carboxyltransferase N-terminal
TgeneACACAchr17:29422387chr17:35518964ENST00000335166-39551918_223415782269DomainCoA carboxyltransferase C-terminal
TgeneACACAchr17:29422387chr17:35518964ENST00000353139-40561918_223416932384DomainCoA carboxyltransferase C-terminal
TgeneACACAchr17:29422387chr17:35518964ENST00000360679-38541918_223415982289DomainCoA carboxyltransferase C-terminal
TgeneACACAchr17:29422387chr17:35518964ENST00000394406-40561918_223416562347DomainCoA carboxyltransferase C-terminal
TgeneACACAchr17:29422387chr17:35518964ENST00000335166-39551576_223415782269RegionCarboxyltransferase

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNF1chr17:29422387chr17:35518964ENST00000356175+1571352_1355202819Compositional biasNote=Poly-Ser
HgeneNF1chr17:29422387chr17:35518964ENST00000358273+1581352_1355202840Compositional biasNote=Poly-Ser
HgeneNF1chr17:29422387chr17:35518964ENST00000431387+1151352_135520594Compositional biasNote=Poly-Ser
HgeneNF1chr17:29422387chr17:35518964ENST00000356175+1571235_1451202819DomainRas-GAP
HgeneNF1chr17:29422387chr17:35518964ENST00000356175+1571580_1738202819DomainCRAL-TRIO
HgeneNF1chr17:29422387chr17:35518964ENST00000358273+1581235_1451202840DomainRas-GAP
HgeneNF1chr17:29422387chr17:35518964ENST00000358273+1581580_1738202840DomainCRAL-TRIO
HgeneNF1chr17:29422387chr17:35518964ENST00000431387+1151235_145120594DomainRas-GAP
HgeneNF1chr17:29422387chr17:35518964ENST00000431387+1151580_173820594DomainCRAL-TRIO
HgeneNF1chr17:29422387chr17:35518964ENST00000356175+1572555_2571202819MotifNote=Bipartite nuclear localization signal
HgeneNF1chr17:29422387chr17:35518964ENST00000358273+1582555_2571202840MotifNote=Bipartite nuclear localization signal
HgeneNF1chr17:29422387chr17:35518964ENST00000431387+1152555_257120594MotifNote=Bipartite nuclear localization signal
HgeneNF1chr17:29422387chr17:35518964ENST00000356175+1571580_1837202819RegionNote=Lipid binding
HgeneNF1chr17:29422387chr17:35518964ENST00000358273+1581580_1837202840RegionNote=Lipid binding
HgeneNF1chr17:29422387chr17:35518964ENST00000431387+1151580_183720594RegionNote=Lipid binding
TgeneACACAchr17:29422387chr17:35518964ENST00000335166-3955117_61815782269DomainNote=Biotin carboxylation
TgeneACACAchr17:29422387chr17:35518964ENST00000335166-3955275_46615782269DomainATP-grasp
TgeneACACAchr17:29422387chr17:35518964ENST00000335166-3955745_81915782269DomainBiotinyl-binding
TgeneACACAchr17:29422387chr17:35518964ENST00000353139-4056117_61816932384DomainNote=Biotin carboxylation
TgeneACACAchr17:29422387chr17:35518964ENST00000353139-40561576_191416932384DomainCoA carboxyltransferase N-terminal
TgeneACACAchr17:29422387chr17:35518964ENST00000353139-4056275_46616932384DomainATP-grasp
TgeneACACAchr17:29422387chr17:35518964ENST00000353139-4056745_81916932384DomainBiotinyl-binding
TgeneACACAchr17:29422387chr17:35518964ENST00000360679-3854117_61815982289DomainNote=Biotin carboxylation
TgeneACACAchr17:29422387chr17:35518964ENST00000360679-38541576_191415982289DomainCoA carboxyltransferase N-terminal
TgeneACACAchr17:29422387chr17:35518964ENST00000360679-3854275_46615982289DomainATP-grasp
TgeneACACAchr17:29422387chr17:35518964ENST00000360679-3854745_81915982289DomainBiotinyl-binding
TgeneACACAchr17:29422387chr17:35518964ENST00000394406-4056117_61816562347DomainNote=Biotin carboxylation
TgeneACACAchr17:29422387chr17:35518964ENST00000394406-40561576_191416562347DomainCoA carboxyltransferase N-terminal
TgeneACACAchr17:29422387chr17:35518964ENST00000394406-4056275_46616562347DomainATP-grasp
TgeneACACAchr17:29422387chr17:35518964ENST00000394406-4056745_81916562347DomainBiotinyl-binding
TgeneACACAchr17:29422387chr17:35518964ENST00000335166-3955315_32015782269Nucleotide bindingATP
TgeneACACAchr17:29422387chr17:35518964ENST00000353139-4056315_32016932384Nucleotide bindingATP
TgeneACACAchr17:29422387chr17:35518964ENST00000360679-3854315_32015982289Nucleotide bindingATP
TgeneACACAchr17:29422387chr17:35518964ENST00000394406-4056315_32016562347Nucleotide bindingATP
TgeneACACAchr17:29422387chr17:35518964ENST00000353139-40561576_223416932384RegionCarboxyltransferase
TgeneACACAchr17:29422387chr17:35518964ENST00000360679-38541576_223415982289RegionCarboxyltransferase
TgeneACACAchr17:29422387chr17:35518964ENST00000394406-40561576_223416562347RegionCarboxyltransferase


Top

FusionGeneSequence for NF1_ACACA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000353139_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000360679_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000394406_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000335166_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000353139_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000360679_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000394406_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000335166_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000353139_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000360679_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000394406_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000335166_chr17_35518964_-_711aa
MAAHRPVEWVQAVVSRFDEQIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGL
AEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIIT
ISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSV
HSSVPLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELS
IPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQA
ELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLI
PIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000353139_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000360679_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000394406_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000335166_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000353139_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000360679_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000394406_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000335166_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000353139_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000360679_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000394406_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000335166_chr17_35518964_-_2133nt
ATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTT
AAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGAT
TTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTG
GCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAA
GATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATT
GGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACC
ATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTA
ATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCAC
AACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTG
CACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGG
ATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCC
TGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGT
ATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACA
TATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATG
TACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCT
GAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCT
GTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCAC
TTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATT
CCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTG
GATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAAC
CCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAAT
AATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGC
AGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000353139_chr17_35518964_-_4844nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCA
TGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTG
GGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCA
ACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACA
GGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCA
GGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCAT
TGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCA
TCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGC
TGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGC
TGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAA
AGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGAT
CTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAG
AAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGT
TCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCT
TCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGC
TGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATG
CTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTC
GGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGA
AGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGA
AGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCA
AGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAG
TGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAG
AGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCA
TCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAG
AGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGCCTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAG
ACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTATGCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCC
AGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGCCTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGA
AAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCCCTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAA
GCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCATGAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGG
AGGAAGCCTCAAGTCCATTGTTTATTACCCCGACTCTTAGCCCAGCACACAGTAGGCACTGGAGAGGAATGATTCCCAGTTTAACCACAC
TACGGTACCTTTTATGAAGAAAAATTAGAGCATAAAATCTACTACAAGCTCCATAGGAACTCAAAGATGAGGGCAAAACTGTGAGCCAAG
AAGCAGAGAAAGAAAATAGAACCAGTTATTCTTGATTTAGGGGACCTCAACCTTGGGTTCAGTCTCTGAGGACAAAGGGAAAGGTAGTTG
TTGGCCTGCCTCTCGCCTGCACGTCACTGCTGGACTAGCTGTCGCATGTGGCTGGGAGCTGCAAGGCCAGTGCTTGAGGGGCCCCAGCAG
TTCCACAGGTGGTGAAGCCTGAGTTGGCAGAGGAGGAGCCAGAAGAGAACTGCCCTTTCTGCACTGGTGGAAACTAGTTATTTATGCCAT
GTGGAGAGCCAGTGAGATAGATAGATAGTCTGTTTGTTTTGAGGACTTGGAAAGTTGTTCCTATGAAGCCTGGAGCTTGGATGGTTTTGA
GAGGTTAATGGTGCCTCCACACTCACTCTTCCCTAGTTCCAGGATTACTGTCCTAGCAGCTAACGGTTCTACTCTCTTCCCCAGAGTGTA
GACAGGCAGCAGGTCTCCCCACAGCTCTGAAAGGACCCTGGTGACAGCTACACCCTCAGCACCAGGAGCTGGCCTTCCTGATGAGGGAGG
CTTCCAGGAAACACAGAATCCACATGACCTTAAGATTATTTACAACTCAGTCATGGTGCTGCTGTCCTCCAGGCTTACTGGCCCCTCCTG
ACTGGCATCAGGGGCTTCCTCAGGTGGTGGAGAGAGTTTACTTTCAACAACTAGTTTATTCAAGAAAAGAACTTACTGATTCCTCTGTTC
CTAAAGCAAGAGTGGCAGGTGATCAGGGCTGGTGTAGCATCCGGTTCCTTTAGTGCAGCTAACTGCATTTGTCACTGATGACCAAGGAGG
AAATCACTAAGACATTTGAGAAGCAGTGGTATGAACGTTCTTGGACAAGCCACAGTTCTGAGCCTTAACCCTGTAGTTTGCACACAAGAA
CGAGCTCCACCTCCCCTTCTTCAGGAGGAATCTGTGCGGATAGATTGGCTGGACTTTTCAATGGTTCTGGGTTGCAGGTGGGCACTGTAT
GGCTGGGTATGGAGCGGACAGCCCCCAGGAGTCAGAGCCTCAGCCCGGCTGCCCTGGTGGAAGGTACAGGTGTTCAGCACCTTCAGAAAA
GGGCATAAAGTGGTGGGGGACAATTCTCAGTCCAGGAAAATGCATTGACCATTGCTGGCTATTTGCTTACCTAGTAAGAATTGGATTCAT
TTTTGACCAGATTATTCTTCTATGCTTTTTTGCAATAAATCAAATCCCACATATCTACAAGTGGTATGAAGTCCTGCACCCCCCAGGAGG
CCTGTCCAGGCATGTCTTCAGAGGCAGGGTGGGTTACACTCATTTACCTCCCCTCTCCCCACCAAATTATGACACAAACGAGTATGTTTC
CTCTCTAGAACCCTGTAATGCCTCCTCCCCCATCCCCAGAGCTCCTTACTGTAGGTCTTACCCTGGACAAGGATTTTTTCAAGTTGGAGG
CACAGAACATGAGCAATCTGACATTCCCACAGCCCCTCAAACATGCAAGGCTACTAAGGCAGGAGGAGTATAAATGATGGATATTGACCA
AGACCTGCTTGGACGGAGACCGCCATATTATCTGTTCTCTTCGTTCACAAAACAGCCTTCACTTGTCTCAGAATTTGATGGACACATACT

>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000360679_chr17_35518964_-_4838nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCA
TGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTG
GGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCA
ACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACA
GGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCA
GGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCAT
TGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCA
TCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGC
TGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGC
TGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAA
AGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGAT
CTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAG
AAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGT
TCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCT
TCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGC
TGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATG
CTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTC
GGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGA
AGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGA
AGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCA
AGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAG
TGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAG
AGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCA
TCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAG
AGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGCCTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAG
ACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTATGCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCC
AGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGCCTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGA
AAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCCCTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAA
GCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCATGAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGG
AGGAAGCCTCAAGTCCATTGTTTATTACCCCGACTCTTAGCCCAGCACACAGTAGGCACTGGAGAGGAATGATTCCCAGTTTAACCACAC
TACGGTACCTTTTATGAAGAAAAATTAGAGCATAAAATCTACTACAAGCTCCATAGGAACTCAAAGATGAGGGCAAAACTGTGAGCCAAG
AAGCAGAGAAAGAAAATAGAACCAGTTATTCTTGATTTAGGGGACCTCAACCTTGGGTTCAGTCTCTGAGGACAAAGGGAAAGGTAGTTG
TTGGCCTGCCTCTCGCCTGCACGTCACTGCTGGACTAGCTGTCGCATGTGGCTGGGAGCTGCAAGGCCAGTGCTTGAGGGGCCCCAGCAG
TTCCACAGGTGGTGAAGCCTGAGTTGGCAGAGGAGGAGCCAGAAGAGAACTGCCCTTTCTGCACTGGTGGAAACTAGTTATTTATGCCAT
GTGGAGAGCCAGTGAGATAGATAGATAGTCTGTTTGTTTTGAGGACTTGGAAAGTTGTTCCTATGAAGCCTGGAGCTTGGATGGTTTTGA
GAGGTTAATGGTGCCTCCACACTCACTCTTCCCTAGTTCCAGGATTACTGTCCTAGCAGCTAACGGTTCTACTCTCTTCCCCAGAGTGTA
GACAGGCAGCAGGTCTCCCCACAGCTCTGAAAGGACCCTGGTGACAGCTACACCCTCAGCACCAGGAGCTGGCCTTCCTGATGAGGGAGG
CTTCCAGGAAACACAGAATCCACATGACCTTAAGATTATTTACAACTCAGTCATGGTGCTGCTGTCCTCCAGGCTTACTGGCCCCTCCTG
ACTGGCATCAGGGGCTTCCTCAGGTGGTGGAGAGAGTTTACTTTCAACAACTAGTTTATTCAAGAAAAGAACTTACTGATTCCTCTGTTC
CTAAAGCAAGAGTGGCAGGTGATCAGGGCTGGTGTAGCATCCGGTTCCTTTAGTGCAGCTAACTGCATTTGTCACTGATGACCAAGGAGG
AAATCACTAAGACATTTGAGAAGCAGTGGTATGAACGTTCTTGGACAAGCCACAGTTCTGAGCCTTAACCCTGTAGTTTGCACACAAGAA
CGAGCTCCACCTCCCCTTCTTCAGGAGGAATCTGTGCGGATAGATTGGCTGGACTTTTCAATGGTTCTGGGTTGCAGGTGGGCACTGTAT
GGCTGGGTATGGAGCGGACAGCCCCCAGGAGTCAGAGCCTCAGCCCGGCTGCCCTGGTGGAAGGTACAGGTGTTCAGCACCTTCAGAAAA
GGGCATAAAGTGGTGGGGGACAATTCTCAGTCCAGGAAAATGCATTGACCATTGCTGGCTATTTGCTTACCTAGTAAGAATTGGATTCAT
TTTTGACCAGATTATTCTTCTATGCTTTTTTGCAATAAATCAAATCCCACATATCTACAAGTGGTATGAAGTCCTGCACCCCCCAGGAGG
CCTGTCCAGGCATGTCTTCAGAGGCAGGGTGGGTTACACTCATTTACCTCCCCTCTCCCCACCAAATTATGACACAAACGAGTATGTTTC
CTCTCTAGAACCCTGTAATGCCTCCTCCCCCATCCCCAGAGCTCCTTACTGTAGGTCTTACCCTGGACAAGGATTTTTTCAAGTTGGAGG
CACAGAACATGAGCAATCTGACATTCCCACAGCCCCTCAAACATGCAAGGCTACTAAGGCAGGAGGAGTATAAATGATGGATATTGACCA
AGACCTGCTTGGACGGAGACCGCCATATTATCTGTTCTCTTCGTTCACAAAACAGCCTTCACTTGTCTCAGAATTTGATGGACACATACT

>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000394406_chr17_35518964_-_4838nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCA
TGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTG
GGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCA
ACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACA
GGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCA
GGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCAT
TGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCA
TCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGC
TGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGC
TGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAA
AGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGAT
CTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAG
AAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGT
TCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCT
TCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGC
TGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATG
CTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTC
GGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGA
AGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGA
AGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCA
AGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAG
TGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAG
AGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCA
TCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAG
AGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGCCTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAG
ACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTATGCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCC
AGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGCCTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGA
AAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCCCTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAA
GCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCATGAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGG
AGGAAGCCTCAAGTCCATTGTTTATTACCCCGACTCTTAGCCCAGCACACAGTAGGCACTGGAGAGGAATGATTCCCAGTTTAACCACAC
TACGGTACCTTTTATGAAGAAAAATTAGAGCATAAAATCTACTACAAGCTCCATAGGAACTCAAAGATGAGGGCAAAACTGTGAGCCAAG
AAGCAGAGAAAGAAAATAGAACCAGTTATTCTTGATTTAGGGGACCTCAACCTTGGGTTCAGTCTCTGAGGACAAAGGGAAAGGTAGTTG
TTGGCCTGCCTCTCGCCTGCACGTCACTGCTGGACTAGCTGTCGCATGTGGCTGGGAGCTGCAAGGCCAGTGCTTGAGGGGCCCCAGCAG
TTCCACAGGTGGTGAAGCCTGAGTTGGCAGAGGAGGAGCCAGAAGAGAACTGCCCTTTCTGCACTGGTGGAAACTAGTTATTTATGCCAT
GTGGAGAGCCAGTGAGATAGATAGATAGTCTGTTTGTTTTGAGGACTTGGAAAGTTGTTCCTATGAAGCCTGGAGCTTGGATGGTTTTGA
GAGGTTAATGGTGCCTCCACACTCACTCTTCCCTAGTTCCAGGATTACTGTCCTAGCAGCTAACGGTTCTACTCTCTTCCCCAGAGTGTA
GACAGGCAGCAGGTCTCCCCACAGCTCTGAAAGGACCCTGGTGACAGCTACACCCTCAGCACCAGGAGCTGGCCTTCCTGATGAGGGAGG
CTTCCAGGAAACACAGAATCCACATGACCTTAAGATTATTTACAACTCAGTCATGGTGCTGCTGTCCTCCAGGCTTACTGGCCCCTCCTG
ACTGGCATCAGGGGCTTCCTCAGGTGGTGGAGAGAGTTTACTTTCAACAACTAGTTTATTCAAGAAAAGAACTTACTGATTCCTCTGTTC
CTAAAGCAAGAGTGGCAGGTGATCAGGGCTGGTGTAGCATCCGGTTCCTTTAGTGCAGCTAACTGCATTTGTCACTGATGACCAAGGAGG
AAATCACTAAGACATTTGAGAAGCAGTGGTATGAACGTTCTTGGACAAGCCACAGTTCTGAGCCTTAACCCTGTAGTTTGCACACAAGAA
CGAGCTCCACCTCCCCTTCTTCAGGAGGAATCTGTGCGGATAGATTGGCTGGACTTTTCAATGGTTCTGGGTTGCAGGTGGGCACTGTAT
GGCTGGGTATGGAGCGGACAGCCCCCAGGAGTCAGAGCCTCAGCCCGGCTGCCCTGGTGGAAGGTACAGGTGTTCAGCACCTTCAGAAAA
GGGCATAAAGTGGTGGGGGACAATTCTCAGTCCAGGAAAATGCATTGACCATTGCTGGCTATTTGCTTACCTAGTAAGAATTGGATTCAT
TTTTGACCAGATTATTCTTCTATGCTTTTTTGCAATAAATCAAATCCCACATATCTACAAGTGGTATGAAGTCCTGCACCCCCCAGGAGG
CCTGTCCAGGCATGTCTTCAGAGGCAGGGTGGGTTACACTCATTTACCTCCCCTCTCCCCACCAAATTATGACACAAACGAGTATGTTTC
CTCTCTAGAACCCTGTAATGCCTCCTCCCCCATCCCCAGAGCTCCTTACTGTAGGTCTTACCCTGGACAAGGATTTTTTCAAGTTGGAGG
CACAGAACATGAGCAATCTGACATTCCCACAGCCCCTCAAACATGCAAGGCTACTAAGGCAGGAGGAGTATAAATGATGGATATTGACCA
AGACCTGCTTGGACGGAGACCGCCATATTATCTGTTCTCTTCGTTCACAAAACAGCCTTCACTTGTCTCAGAATTTGATGGACACATACT

>In-frame_NF1_ENST00000356175_chr17_29422387_+_ACACA_ENST00000335166_chr17_35518964_-_3015nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCA
TGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTG
GGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCA
ACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACA
GGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCA
GGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCAT
TGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCA
TCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGC
TGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGC
TGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAA
AGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGAT
CTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAG
AAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGT
TCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCT
TCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGC
TGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATG
CTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTC
GGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGA
AGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGA
AGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCA
AGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAG
TGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAG
AGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCA
TCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAG
AGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGCCTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAG
ACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTATGCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCC
AGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGCCTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGA
AAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCCCTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAA
GCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCATGAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGG

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000353139_chr17_35518964_-_4844nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCA
TGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTG
GGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCA
ACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACA
GGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCA
GGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCAT
TGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCA
TCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGC
TGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGC
TGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAA
AGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGAT
CTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAG
AAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGT
TCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCT
TCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGC
TGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATG
CTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTC
GGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGA
AGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGA
AGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCA
AGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAG
TGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAG
AGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCA
TCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAG
AGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGCCTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAG
ACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTATGCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCC
AGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGCCTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGA
AAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCCCTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAA
GCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCATGAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGG
AGGAAGCCTCAAGTCCATTGTTTATTACCCCGACTCTTAGCCCAGCACACAGTAGGCACTGGAGAGGAATGATTCCCAGTTTAACCACAC
TACGGTACCTTTTATGAAGAAAAATTAGAGCATAAAATCTACTACAAGCTCCATAGGAACTCAAAGATGAGGGCAAAACTGTGAGCCAAG
AAGCAGAGAAAGAAAATAGAACCAGTTATTCTTGATTTAGGGGACCTCAACCTTGGGTTCAGTCTCTGAGGACAAAGGGAAAGGTAGTTG
TTGGCCTGCCTCTCGCCTGCACGTCACTGCTGGACTAGCTGTCGCATGTGGCTGGGAGCTGCAAGGCCAGTGCTTGAGGGGCCCCAGCAG
TTCCACAGGTGGTGAAGCCTGAGTTGGCAGAGGAGGAGCCAGAAGAGAACTGCCCTTTCTGCACTGGTGGAAACTAGTTATTTATGCCAT
GTGGAGAGCCAGTGAGATAGATAGATAGTCTGTTTGTTTTGAGGACTTGGAAAGTTGTTCCTATGAAGCCTGGAGCTTGGATGGTTTTGA
GAGGTTAATGGTGCCTCCACACTCACTCTTCCCTAGTTCCAGGATTACTGTCCTAGCAGCTAACGGTTCTACTCTCTTCCCCAGAGTGTA
GACAGGCAGCAGGTCTCCCCACAGCTCTGAAAGGACCCTGGTGACAGCTACACCCTCAGCACCAGGAGCTGGCCTTCCTGATGAGGGAGG
CTTCCAGGAAACACAGAATCCACATGACCTTAAGATTATTTACAACTCAGTCATGGTGCTGCTGTCCTCCAGGCTTACTGGCCCCTCCTG
ACTGGCATCAGGGGCTTCCTCAGGTGGTGGAGAGAGTTTACTTTCAACAACTAGTTTATTCAAGAAAAGAACTTACTGATTCCTCTGTTC
CTAAAGCAAGAGTGGCAGGTGATCAGGGCTGGTGTAGCATCCGGTTCCTTTAGTGCAGCTAACTGCATTTGTCACTGATGACCAAGGAGG
AAATCACTAAGACATTTGAGAAGCAGTGGTATGAACGTTCTTGGACAAGCCACAGTTCTGAGCCTTAACCCTGTAGTTTGCACACAAGAA
CGAGCTCCACCTCCCCTTCTTCAGGAGGAATCTGTGCGGATAGATTGGCTGGACTTTTCAATGGTTCTGGGTTGCAGGTGGGCACTGTAT
GGCTGGGTATGGAGCGGACAGCCCCCAGGAGTCAGAGCCTCAGCCCGGCTGCCCTGGTGGAAGGTACAGGTGTTCAGCACCTTCAGAAAA
GGGCATAAAGTGGTGGGGGACAATTCTCAGTCCAGGAAAATGCATTGACCATTGCTGGCTATTTGCTTACCTAGTAAGAATTGGATTCAT
TTTTGACCAGATTATTCTTCTATGCTTTTTTGCAATAAATCAAATCCCACATATCTACAAGTGGTATGAAGTCCTGCACCCCCCAGGAGG
CCTGTCCAGGCATGTCTTCAGAGGCAGGGTGGGTTACACTCATTTACCTCCCCTCTCCCCACCAAATTATGACACAAACGAGTATGTTTC
CTCTCTAGAACCCTGTAATGCCTCCTCCCCCATCCCCAGAGCTCCTTACTGTAGGTCTTACCCTGGACAAGGATTTTTTCAAGTTGGAGG
CACAGAACATGAGCAATCTGACATTCCCACAGCCCCTCAAACATGCAAGGCTACTAAGGCAGGAGGAGTATAAATGATGGATATTGACCA
AGACCTGCTTGGACGGAGACCGCCATATTATCTGTTCTCTTCGTTCACAAAACAGCCTTCACTTGTCTCAGAATTTGATGGACACATACT

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000360679_chr17_35518964_-_4838nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCA
TGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTG
GGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCA
ACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACA
GGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCA
GGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCAT
TGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCA
TCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGC
TGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGC
TGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAA
AGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGAT
CTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAG
AAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGT
TCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCT
TCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGC
TGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATG
CTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTC
GGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGA
AGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGA
AGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCA
AGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAG
TGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAG
AGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCA
TCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAG
AGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGCCTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAG
ACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTATGCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCC
AGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGCCTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGA
AAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCCCTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAA
GCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCATGAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGG
AGGAAGCCTCAAGTCCATTGTTTATTACCCCGACTCTTAGCCCAGCACACAGTAGGCACTGGAGAGGAATGATTCCCAGTTTAACCACAC
TACGGTACCTTTTATGAAGAAAAATTAGAGCATAAAATCTACTACAAGCTCCATAGGAACTCAAAGATGAGGGCAAAACTGTGAGCCAAG
AAGCAGAGAAAGAAAATAGAACCAGTTATTCTTGATTTAGGGGACCTCAACCTTGGGTTCAGTCTCTGAGGACAAAGGGAAAGGTAGTTG
TTGGCCTGCCTCTCGCCTGCACGTCACTGCTGGACTAGCTGTCGCATGTGGCTGGGAGCTGCAAGGCCAGTGCTTGAGGGGCCCCAGCAG
TTCCACAGGTGGTGAAGCCTGAGTTGGCAGAGGAGGAGCCAGAAGAGAACTGCCCTTTCTGCACTGGTGGAAACTAGTTATTTATGCCAT
GTGGAGAGCCAGTGAGATAGATAGATAGTCTGTTTGTTTTGAGGACTTGGAAAGTTGTTCCTATGAAGCCTGGAGCTTGGATGGTTTTGA
GAGGTTAATGGTGCCTCCACACTCACTCTTCCCTAGTTCCAGGATTACTGTCCTAGCAGCTAACGGTTCTACTCTCTTCCCCAGAGTGTA
GACAGGCAGCAGGTCTCCCCACAGCTCTGAAAGGACCCTGGTGACAGCTACACCCTCAGCACCAGGAGCTGGCCTTCCTGATGAGGGAGG
CTTCCAGGAAACACAGAATCCACATGACCTTAAGATTATTTACAACTCAGTCATGGTGCTGCTGTCCTCCAGGCTTACTGGCCCCTCCTG
ACTGGCATCAGGGGCTTCCTCAGGTGGTGGAGAGAGTTTACTTTCAACAACTAGTTTATTCAAGAAAAGAACTTACTGATTCCTCTGTTC
CTAAAGCAAGAGTGGCAGGTGATCAGGGCTGGTGTAGCATCCGGTTCCTTTAGTGCAGCTAACTGCATTTGTCACTGATGACCAAGGAGG
AAATCACTAAGACATTTGAGAAGCAGTGGTATGAACGTTCTTGGACAAGCCACAGTTCTGAGCCTTAACCCTGTAGTTTGCACACAAGAA
CGAGCTCCACCTCCCCTTCTTCAGGAGGAATCTGTGCGGATAGATTGGCTGGACTTTTCAATGGTTCTGGGTTGCAGGTGGGCACTGTAT
GGCTGGGTATGGAGCGGACAGCCCCCAGGAGTCAGAGCCTCAGCCCGGCTGCCCTGGTGGAAGGTACAGGTGTTCAGCACCTTCAGAAAA
GGGCATAAAGTGGTGGGGGACAATTCTCAGTCCAGGAAAATGCATTGACCATTGCTGGCTATTTGCTTACCTAGTAAGAATTGGATTCAT
TTTTGACCAGATTATTCTTCTATGCTTTTTTGCAATAAATCAAATCCCACATATCTACAAGTGGTATGAAGTCCTGCACCCCCCAGGAGG
CCTGTCCAGGCATGTCTTCAGAGGCAGGGTGGGTTACACTCATTTACCTCCCCTCTCCCCACCAAATTATGACACAAACGAGTATGTTTC
CTCTCTAGAACCCTGTAATGCCTCCTCCCCCATCCCCAGAGCTCCTTACTGTAGGTCTTACCCTGGACAAGGATTTTTTCAAGTTGGAGG
CACAGAACATGAGCAATCTGACATTCCCACAGCCCCTCAAACATGCAAGGCTACTAAGGCAGGAGGAGTATAAATGATGGATATTGACCA
AGACCTGCTTGGACGGAGACCGCCATATTATCTGTTCTCTTCGTTCACAAAACAGCCTTCACTTGTCTCAGAATTTGATGGACACATACT

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000394406_chr17_35518964_-_4838nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCA
TGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTG
GGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCA
ACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACA
GGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCA
GGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCAT
TGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCA
TCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGC
TGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGC
TGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAA
AGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGAT
CTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAG
AAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGT
TCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCT
TCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGC
TGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATG
CTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTC
GGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGA
AGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGA
AGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCA
AGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAG
TGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAG
AGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCA
TCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAG
AGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGCCTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAG
ACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTATGCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCC
AGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGCCTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGA
AAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCCCTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAA
GCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCATGAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGG
AGGAAGCCTCAAGTCCATTGTTTATTACCCCGACTCTTAGCCCAGCACACAGTAGGCACTGGAGAGGAATGATTCCCAGTTTAACCACAC
TACGGTACCTTTTATGAAGAAAAATTAGAGCATAAAATCTACTACAAGCTCCATAGGAACTCAAAGATGAGGGCAAAACTGTGAGCCAAG
AAGCAGAGAAAGAAAATAGAACCAGTTATTCTTGATTTAGGGGACCTCAACCTTGGGTTCAGTCTCTGAGGACAAAGGGAAAGGTAGTTG
TTGGCCTGCCTCTCGCCTGCACGTCACTGCTGGACTAGCTGTCGCATGTGGCTGGGAGCTGCAAGGCCAGTGCTTGAGGGGCCCCAGCAG
TTCCACAGGTGGTGAAGCCTGAGTTGGCAGAGGAGGAGCCAGAAGAGAACTGCCCTTTCTGCACTGGTGGAAACTAGTTATTTATGCCAT
GTGGAGAGCCAGTGAGATAGATAGATAGTCTGTTTGTTTTGAGGACTTGGAAAGTTGTTCCTATGAAGCCTGGAGCTTGGATGGTTTTGA
GAGGTTAATGGTGCCTCCACACTCACTCTTCCCTAGTTCCAGGATTACTGTCCTAGCAGCTAACGGTTCTACTCTCTTCCCCAGAGTGTA
GACAGGCAGCAGGTCTCCCCACAGCTCTGAAAGGACCCTGGTGACAGCTACACCCTCAGCACCAGGAGCTGGCCTTCCTGATGAGGGAGG
CTTCCAGGAAACACAGAATCCACATGACCTTAAGATTATTTACAACTCAGTCATGGTGCTGCTGTCCTCCAGGCTTACTGGCCCCTCCTG
ACTGGCATCAGGGGCTTCCTCAGGTGGTGGAGAGAGTTTACTTTCAACAACTAGTTTATTCAAGAAAAGAACTTACTGATTCCTCTGTTC
CTAAAGCAAGAGTGGCAGGTGATCAGGGCTGGTGTAGCATCCGGTTCCTTTAGTGCAGCTAACTGCATTTGTCACTGATGACCAAGGAGG
AAATCACTAAGACATTTGAGAAGCAGTGGTATGAACGTTCTTGGACAAGCCACAGTTCTGAGCCTTAACCCTGTAGTTTGCACACAAGAA
CGAGCTCCACCTCCCCTTCTTCAGGAGGAATCTGTGCGGATAGATTGGCTGGACTTTTCAATGGTTCTGGGTTGCAGGTGGGCACTGTAT
GGCTGGGTATGGAGCGGACAGCCCCCAGGAGTCAGAGCCTCAGCCCGGCTGCCCTGGTGGAAGGTACAGGTGTTCAGCACCTTCAGAAAA
GGGCATAAAGTGGTGGGGGACAATTCTCAGTCCAGGAAAATGCATTGACCATTGCTGGCTATTTGCTTACCTAGTAAGAATTGGATTCAT
TTTTGACCAGATTATTCTTCTATGCTTTTTTGCAATAAATCAAATCCCACATATCTACAAGTGGTATGAAGTCCTGCACCCCCCAGGAGG
CCTGTCCAGGCATGTCTTCAGAGGCAGGGTGGGTTACACTCATTTACCTCCCCTCTCCCCACCAAATTATGACACAAACGAGTATGTTTC
CTCTCTAGAACCCTGTAATGCCTCCTCCCCCATCCCCAGAGCTCCTTACTGTAGGTCTTACCCTGGACAAGGATTTTTTCAAGTTGGAGG
CACAGAACATGAGCAATCTGACATTCCCACAGCCCCTCAAACATGCAAGGCTACTAAGGCAGGAGGAGTATAAATGATGGATATTGACCA
AGACCTGCTTGGACGGAGACCGCCATATTATCTGTTCTCTTCGTTCACAAAACAGCCTTCACTTGTCTCAGAATTTGATGGACACATACT

>In-frame_NF1_ENST00000358273_chr17_29422387_+_ACACA_ENST00000335166_chr17_35518964_-_3015nt
AATCTCTAGCTCGCTCGCGCTCCCTCTCCCCGGGCCGTGGAAAGGATCCCACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGAT
GGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCCCCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCC
TCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCCCCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTC
CACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCCCTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGC
CGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCA
TGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTG
GGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCA
ACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACA
GGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCA
GGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCAT
TGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCA
TCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGC
TGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGC
TGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAA
AGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGAT
CTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAG
AAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGT
TCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCT
TCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGC
TGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATG
CTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTC
GGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGA
AGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGA
AGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCA
AGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAG
TGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAG
AGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCA
TCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAG
AGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGCCTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAG
ACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTATGCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCC
AGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGCCTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGA
AAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCCCTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAA
GCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCATGAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGG

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000353139_chr17_35518964_-_4794nt
ACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGATGGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCC
CCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCCTCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCC
CCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTCCACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCC
CTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGCCGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGG
GTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGA
GATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTT
GCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCAT
GTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAAC
TCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAG
AACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATT
GGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAAC
AAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTG
TGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCA
AAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACC
CAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGA
GCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGAT
TCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGG
GAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCT
TACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTG
ATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAA
ATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAG
CTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAG
TTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTC
TACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAA
GCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAG
AAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGC
AGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATA
CGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAGAGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGC
CTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAGACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTAT
GCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCCAGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGC
CTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGAAAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCC
CTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAAGCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCAT
GAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGGAGGAAGCCTCAAGTCCATTGTTTATTACCCCGACTCTTAGCCCAGCACAC
AGTAGGCACTGGAGAGGAATGATTCCCAGTTTAACCACACTACGGTACCTTTTATGAAGAAAAATTAGAGCATAAAATCTACTACAAGCT
CCATAGGAACTCAAAGATGAGGGCAAAACTGTGAGCCAAGAAGCAGAGAAAGAAAATAGAACCAGTTATTCTTGATTTAGGGGACCTCAA
CCTTGGGTTCAGTCTCTGAGGACAAAGGGAAAGGTAGTTGTTGGCCTGCCTCTCGCCTGCACGTCACTGCTGGACTAGCTGTCGCATGTG
GCTGGGAGCTGCAAGGCCAGTGCTTGAGGGGCCCCAGCAGTTCCACAGGTGGTGAAGCCTGAGTTGGCAGAGGAGGAGCCAGAAGAGAAC
TGCCCTTTCTGCACTGGTGGAAACTAGTTATTTATGCCATGTGGAGAGCCAGTGAGATAGATAGATAGTCTGTTTGTTTTGAGGACTTGG
AAAGTTGTTCCTATGAAGCCTGGAGCTTGGATGGTTTTGAGAGGTTAATGGTGCCTCCACACTCACTCTTCCCTAGTTCCAGGATTACTG
TCCTAGCAGCTAACGGTTCTACTCTCTTCCCCAGAGTGTAGACAGGCAGCAGGTCTCCCCACAGCTCTGAAAGGACCCTGGTGACAGCTA
CACCCTCAGCACCAGGAGCTGGCCTTCCTGATGAGGGAGGCTTCCAGGAAACACAGAATCCACATGACCTTAAGATTATTTACAACTCAG
TCATGGTGCTGCTGTCCTCCAGGCTTACTGGCCCCTCCTGACTGGCATCAGGGGCTTCCTCAGGTGGTGGAGAGAGTTTACTTTCAACAA
CTAGTTTATTCAAGAAAAGAACTTACTGATTCCTCTGTTCCTAAAGCAAGAGTGGCAGGTGATCAGGGCTGGTGTAGCATCCGGTTCCTT
TAGTGCAGCTAACTGCATTTGTCACTGATGACCAAGGAGGAAATCACTAAGACATTTGAGAAGCAGTGGTATGAACGTTCTTGGACAAGC
CACAGTTCTGAGCCTTAACCCTGTAGTTTGCACACAAGAACGAGCTCCACCTCCCCTTCTTCAGGAGGAATCTGTGCGGATAGATTGGCT
GGACTTTTCAATGGTTCTGGGTTGCAGGTGGGCACTGTATGGCTGGGTATGGAGCGGACAGCCCCCAGGAGTCAGAGCCTCAGCCCGGCT
GCCCTGGTGGAAGGTACAGGTGTTCAGCACCTTCAGAAAAGGGCATAAAGTGGTGGGGGACAATTCTCAGTCCAGGAAAATGCATTGACC
ATTGCTGGCTATTTGCTTACCTAGTAAGAATTGGATTCATTTTTGACCAGATTATTCTTCTATGCTTTTTTGCAATAAATCAAATCCCAC
ATATCTACAAGTGGTATGAAGTCCTGCACCCCCCAGGAGGCCTGTCCAGGCATGTCTTCAGAGGCAGGGTGGGTTACACTCATTTACCTC
CCCTCTCCCCACCAAATTATGACACAAACGAGTATGTTTCCTCTCTAGAACCCTGTAATGCCTCCTCCCCCATCCCCAGAGCTCCTTACT
GTAGGTCTTACCCTGGACAAGGATTTTTTCAAGTTGGAGGCACAGAACATGAGCAATCTGACATTCCCACAGCCCCTCAAACATGCAAGG
CTACTAAGGCAGGAGGAGTATAAATGATGGATATTGACCAAGACCTGCTTGGACGGAGACCGCCATATTATCTGTTCTCTTCGTTCACAA
AACAGCCTTCACTTGTCTCAGAATTTGATGGACACATACTGTGATGAGCAGGAGCTTCAGATGCACTCTTTACACATTTTGTTGAAATAA

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000360679_chr17_35518964_-_4788nt
ACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGATGGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCC
CCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCCTCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCC
CCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTCCACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCC
CTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGCCGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGG
GTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGA
GATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTT
GCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCAT
GTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAAC
TCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAG
AACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATT
GGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAAC
AAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTG
TGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCA
AAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACC
CAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGA
GCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGAT
TCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGG
GAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCT
TACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTG
ATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAA
ATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAG
CTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAG
TTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTC
TACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAA
GCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAG
AAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGC
AGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATA
CGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAGAGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGC
CTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAGACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTAT
GCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCCAGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGC
CTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGAAAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCC
CTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAAGCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCAT
GAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGGAGGAAGCCTCAAGTCCATTGTTTATTACCCCGACTCTTAGCCCAGCACAC
AGTAGGCACTGGAGAGGAATGATTCCCAGTTTAACCACACTACGGTACCTTTTATGAAGAAAAATTAGAGCATAAAATCTACTACAAGCT
CCATAGGAACTCAAAGATGAGGGCAAAACTGTGAGCCAAGAAGCAGAGAAAGAAAATAGAACCAGTTATTCTTGATTTAGGGGACCTCAA
CCTTGGGTTCAGTCTCTGAGGACAAAGGGAAAGGTAGTTGTTGGCCTGCCTCTCGCCTGCACGTCACTGCTGGACTAGCTGTCGCATGTG
GCTGGGAGCTGCAAGGCCAGTGCTTGAGGGGCCCCAGCAGTTCCACAGGTGGTGAAGCCTGAGTTGGCAGAGGAGGAGCCAGAAGAGAAC
TGCCCTTTCTGCACTGGTGGAAACTAGTTATTTATGCCATGTGGAGAGCCAGTGAGATAGATAGATAGTCTGTTTGTTTTGAGGACTTGG
AAAGTTGTTCCTATGAAGCCTGGAGCTTGGATGGTTTTGAGAGGTTAATGGTGCCTCCACACTCACTCTTCCCTAGTTCCAGGATTACTG
TCCTAGCAGCTAACGGTTCTACTCTCTTCCCCAGAGTGTAGACAGGCAGCAGGTCTCCCCACAGCTCTGAAAGGACCCTGGTGACAGCTA
CACCCTCAGCACCAGGAGCTGGCCTTCCTGATGAGGGAGGCTTCCAGGAAACACAGAATCCACATGACCTTAAGATTATTTACAACTCAG
TCATGGTGCTGCTGTCCTCCAGGCTTACTGGCCCCTCCTGACTGGCATCAGGGGCTTCCTCAGGTGGTGGAGAGAGTTTACTTTCAACAA
CTAGTTTATTCAAGAAAAGAACTTACTGATTCCTCTGTTCCTAAAGCAAGAGTGGCAGGTGATCAGGGCTGGTGTAGCATCCGGTTCCTT
TAGTGCAGCTAACTGCATTTGTCACTGATGACCAAGGAGGAAATCACTAAGACATTTGAGAAGCAGTGGTATGAACGTTCTTGGACAAGC
CACAGTTCTGAGCCTTAACCCTGTAGTTTGCACACAAGAACGAGCTCCACCTCCCCTTCTTCAGGAGGAATCTGTGCGGATAGATTGGCT
GGACTTTTCAATGGTTCTGGGTTGCAGGTGGGCACTGTATGGCTGGGTATGGAGCGGACAGCCCCCAGGAGTCAGAGCCTCAGCCCGGCT
GCCCTGGTGGAAGGTACAGGTGTTCAGCACCTTCAGAAAAGGGCATAAAGTGGTGGGGGACAATTCTCAGTCCAGGAAAATGCATTGACC
ATTGCTGGCTATTTGCTTACCTAGTAAGAATTGGATTCATTTTTGACCAGATTATTCTTCTATGCTTTTTTGCAATAAATCAAATCCCAC
ATATCTACAAGTGGTATGAAGTCCTGCACCCCCCAGGAGGCCTGTCCAGGCATGTCTTCAGAGGCAGGGTGGGTTACACTCATTTACCTC
CCCTCTCCCCACCAAATTATGACACAAACGAGTATGTTTCCTCTCTAGAACCCTGTAATGCCTCCTCCCCCATCCCCAGAGCTCCTTACT
GTAGGTCTTACCCTGGACAAGGATTTTTTCAAGTTGGAGGCACAGAACATGAGCAATCTGACATTCCCACAGCCCCTCAAACATGCAAGG
CTACTAAGGCAGGAGGAGTATAAATGATGGATATTGACCAAGACCTGCTTGGACGGAGACCGCCATATTATCTGTTCTCTTCGTTCACAA
AACAGCCTTCACTTGTCTCAGAATTTGATGGACACATACTGTGATGAGCAGGAGCTTCAGATGCACTCTTTACACATTTTGTTGAAATAA

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000394406_chr17_35518964_-_4788nt
ACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGATGGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCC
CCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCCTCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCC
CCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTCCACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCC
CTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGCCGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGG
GTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGA
GATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTT
GCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCAT
GTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAAC
TCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAG
AACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATT
GGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAAC
AAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTG
TGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCA
AAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACC
CAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGA
GCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGAT
TCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGG
GAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCT
TACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTG
ATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAA
ATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAG
CTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAG
TTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTC
TACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAA
GCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAG
AAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGC
AGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATA
CGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAGAGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGC
CTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAGACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTAT
GCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCCAGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGC
CTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGAAAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCC
CTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAAGCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCAT
GAGCCGCAGCCACAGGCAGCAGAGGAGGGCTAAGGAGAGGAGGAAGCCTCAAGTCCATTGTTTATTACCCCGACTCTTAGCCCAGCACAC
AGTAGGCACTGGAGAGGAATGATTCCCAGTTTAACCACACTACGGTACCTTTTATGAAGAAAAATTAGAGCATAAAATCTACTACAAGCT
CCATAGGAACTCAAAGATGAGGGCAAAACTGTGAGCCAAGAAGCAGAGAAAGAAAATAGAACCAGTTATTCTTGATTTAGGGGACCTCAA
CCTTGGGTTCAGTCTCTGAGGACAAAGGGAAAGGTAGTTGTTGGCCTGCCTCTCGCCTGCACGTCACTGCTGGACTAGCTGTCGCATGTG
GCTGGGAGCTGCAAGGCCAGTGCTTGAGGGGCCCCAGCAGTTCCACAGGTGGTGAAGCCTGAGTTGGCAGAGGAGGAGCCAGAAGAGAAC
TGCCCTTTCTGCACTGGTGGAAACTAGTTATTTATGCCATGTGGAGAGCCAGTGAGATAGATAGATAGTCTGTTTGTTTTGAGGACTTGG
AAAGTTGTTCCTATGAAGCCTGGAGCTTGGATGGTTTTGAGAGGTTAATGGTGCCTCCACACTCACTCTTCCCTAGTTCCAGGATTACTG
TCCTAGCAGCTAACGGTTCTACTCTCTTCCCCAGAGTGTAGACAGGCAGCAGGTCTCCCCACAGCTCTGAAAGGACCCTGGTGACAGCTA
CACCCTCAGCACCAGGAGCTGGCCTTCCTGATGAGGGAGGCTTCCAGGAAACACAGAATCCACATGACCTTAAGATTATTTACAACTCAG
TCATGGTGCTGCTGTCCTCCAGGCTTACTGGCCCCTCCTGACTGGCATCAGGGGCTTCCTCAGGTGGTGGAGAGAGTTTACTTTCAACAA
CTAGTTTATTCAAGAAAAGAACTTACTGATTCCTCTGTTCCTAAAGCAAGAGTGGCAGGTGATCAGGGCTGGTGTAGCATCCGGTTCCTT
TAGTGCAGCTAACTGCATTTGTCACTGATGACCAAGGAGGAAATCACTAAGACATTTGAGAAGCAGTGGTATGAACGTTCTTGGACAAGC
CACAGTTCTGAGCCTTAACCCTGTAGTTTGCACACAAGAACGAGCTCCACCTCCCCTTCTTCAGGAGGAATCTGTGCGGATAGATTGGCT
GGACTTTTCAATGGTTCTGGGTTGCAGGTGGGCACTGTATGGCTGGGTATGGAGCGGACAGCCCCCAGGAGTCAGAGCCTCAGCCCGGCT
GCCCTGGTGGAAGGTACAGGTGTTCAGCACCTTCAGAAAAGGGCATAAAGTGGTGGGGGACAATTCTCAGTCCAGGAAAATGCATTGACC
ATTGCTGGCTATTTGCTTACCTAGTAAGAATTGGATTCATTTTTGACCAGATTATTCTTCTATGCTTTTTTGCAATAAATCAAATCCCAC
ATATCTACAAGTGGTATGAAGTCCTGCACCCCCCAGGAGGCCTGTCCAGGCATGTCTTCAGAGGCAGGGTGGGTTACACTCATTTACCTC
CCCTCTCCCCACCAAATTATGACACAAACGAGTATGTTTCCTCTCTAGAACCCTGTAATGCCTCCTCCCCCATCCCCAGAGCTCCTTACT
GTAGGTCTTACCCTGGACAAGGATTTTTTCAAGTTGGAGGCACAGAACATGAGCAATCTGACATTCCCACAGCCCCTCAAACATGCAAGG
CTACTAAGGCAGGAGGAGTATAAATGATGGATATTGACCAAGACCTGCTTGGACGGAGACCGCCATATTATCTGTTCTCTTCGTTCACAA
AACAGCCTTCACTTGTCTCAGAATTTGATGGACACATACTGTGATGAGCAGGAGCTTCAGATGCACTCTTTACACATTTTGTTGAAATAA

>In-frame_NF1_ENST00000431387_chr17_29422387_+_ACACA_ENST00000335166_chr17_35518964_-_2965nt
ACTTCCGGTGGGGTGTCATGGCGGCGTCTCGGACTGTGATGGCTGTGGGGAGACGGCGCTAGTGGGGAGAGCGACCAAGAGGCCCCCTCC
CCTCCCCGGGTCCCCTTCCCCTATCCCCCTCCCCCCAGCCTCCTTGCCAACGCCCCCTTTCCCTCTCCCCCTCCCGCTCGGCGCTGACCC
CCCATCCCCACCCCCGTGGGAACACTGGGAGCCTGCACTCCACAGACCCTCTCCTTGCCTCTTCCCTCACCTCAGCCTCCGCTCCCCGCC
CTCTTCCCGGCCCAGGGCGCCGGCCCACCCTTCCCTCCGCCGCCCCCCGGCCGCGGGGAGGACATGGCCGCGCACAGGCCGGTGGAATGG
GTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAGATTGGCATGGTAGCTTGGAAAATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGA
GATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTT
GCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCAT
GTGGCCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCTCTCAAC
TCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACAGATATTATTGGGAAAGAAGAGGGAATTGGACCCGAG
AACCTTCGAGGTTCTGGAATGATTGCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATT
GGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAAC
AAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGCACTGTG
TGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCA
AAGGATCCTATAGACAGAATCATCGAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACC
CAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGA
GCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAACCTGGAT
TCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCGTTTAAGACATATCAGGCCATCAAGGACTTCAACCGG
GAAGGGCTGCCTCTGATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTTGGTGCT
TACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTG
ATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAA
ATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAG
CTAAGCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCCGTGCAG
TTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGCGATATCCTGGATTGGAAAACATCCCGTACCTTCTTC
TACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAA
GCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAG
AAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAAATCCGC
AGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATA
CGGATCCTCTCCACAATGGATTCCCCTTCCACGTAGGAAGAGCTTCCTGCCTGTCCCTGCCCTGTCTCTGGAGAAAAGGGCTAGAGCTGC
CTTTTACAACTGTAACCACTGTAATGAGAAGGCACAGGAGACCCAGCACTGGAGTCAAATGGCATTTTACTTCCTCTCGTTTCAGGTTAT
GCATGACATCCTGGGATGTAAGATCACAGAATCCCCCTCCAGCCCACCAGTCACACCTACCCCATTCAGTATTTATTACCCTGGCCAGGC
CTAGTCCTCCACTCCCTGCACAGGACTGAGAAGGCAATGAAAGGTACAAACATGTACCATGAGGTCTTACTAACCAAAGTAGGGCTGCCC
CTCCTGTCCTGACAGCCCCTTGGCCTCCCAGCATGGGGAAGCGTGAGGAGTTGCCCAGCAGTGAGCAGCCCCCCTCACTCCTGGCCCCAT


Top

FusionGenePPI for NF1_ACACA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NF1HRAS, SMARCA4, POLR2A, TIRAP, SIRT7, VCP, NSFL1C, CAV1, YWHAB, FAF2, NXF1, CCDC8, HLA-DPA1, EFNB2, CD274, TNFSF13B, CA14, SLAMF1, VSIG4, TGOLN2, HTR6, NOSIP, KRAS, CLK1, CDC5L, APP, YWHAH, PML, TRAF6, PTEN, SDC2, EGFR, CD79B, P4HA3, SCN3B, VSIG1, SIGLECL1, EPHA1, FAM174A, KCTD3, KIF13B, ZBTB21, KSR1, CGN, GIGYF1, LRFN1, RTKN, MAST3, DENND1A, SH3PXD2A, SRGAP2, DENND4C, PPM1H, EIF4E2, SIPA1L1, LIMA1, RALGPS2, MAGI1, CBY1, TESK2, CDC25C, DCLK1, GIGYF2, HDAC4, LPIN3, ZNF638, CAMSAP2, NADK, MAPKAP1, SRSF12, RASAL2, SYDE1, KIAA1804, TIAM1, AGAP1, CDC25B, CDK16, SH3RF3, PHLDB2, PLEKHA7, KIF1C, OSBPL6, FAM110B, USP21, NAV1, TANC2, PTPN13, FAM53C, ANKRD34A, STARD13, PTPN14, GAB2, DENND4A, INPP5E, TOP1, TOP2A, TOP3A, NRASACACABRCA1, CHGB, PRKAA2, MLLT3, MLLT1, NPM1, AKR1B10, SIRT1, ARRB1, SIRT7, UBE2N, ATXN1, INPPL1, CBL, UBASH3B, PIK3R2, SHC1, AP2M1, ERCC6L, IKBKAP, CA9, VCP, FN1, IFIT1, FBXO6, CCT3, COPB1, DCAF6, EPB41L1, KIF5B, NUP50, PSMB7, SMEK1, EEF2K, STK25, PHKG2, ADRBK1, CSNK1A1, CSNK1E, PRKAA1, STK3, ILK, RPS6KA1, RIOK2, PRKAB1, PRKAG1, FUS, ENO1, MOV10, NXF1, MDM2, SUZ12, RNF2, BMI1, EGFR, SOCS6, SGCZ, C20orf195, PSG1, ARHGAP25, LIPH, IARS, PSMB2, PSMC6, PSMD2, NTRK1, PTEN, NDUFA4, C15orf48, COQ9, ZNF746, OAS2, LGALS3BP, C4orf26, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NF1_ACACA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneACACAQ13085DB00121BiotinAcetyl-CoA carboxylase 1small moleculeapproved|investigational|nutraceutical

Top

RelatedDiseases for NF1_ACACA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNF1C0027831Neurofibromatosis 134CTD_human;ORPHANET;UNIPROT
HgeneNF1C2931482Neurofibromatosis-Noonan syndrome5CTD_human;ORPHANET;UNIPROT
HgeneNF1C0349639Juvenile Myelomonocytic Leukemia3CTD_human;HPO;ORPHANET
HgeneNF1C0004114Astrocytoma2CTD_human;HPO
HgeneNF1C0023467Leukemia, Myelocytic, Acute2CTD_human
HgeneNF1C0025202melanoma2CTD_human
HgeneNF1C0206727Nerve Sheath Tumors2CTD_human
HgeneNF1C0001430Adenoma1CTD_human
HgeneNF1C0004352Autistic Disorder1CTD_human
HgeneNF1C0016057Fibrosarcoma1CTD_human
HgeneNF1C0017636Glioblastoma1CTD_human
HgeneNF1C0017638Glioma1CTD_human
HgeneNF1C0023186Learning Disorders1CTD_human
HgeneNF1C0023827liposarcoma1CTD_human
HgeneNF1C0027809Neurilemmoma1CTD_human
HgeneNF1C0027830neurofibroma1CTD_human
HgeneNF1C0027962Melanocytic nevus1CTD_human
HgeneNF1C0031511Pheochromocytoma1CTD_human
HgeneNF1C0162678Neurofibromatoses1CTD_human;HPO
HgeneNF1C1261473Sarcoma1CTD_human
HgeneNF1C1834235NEUROFIBROMATOSIS, FAMILIAL SPINAL1CTD_human;UNIPROT
HgeneNF1C3714756Intellectual Disability1CTD_human;HPO
TgeneACACAC0018801Heart failure1CTD_human
TgeneACACAC2239176Liver carcinoma1CTD_human