FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24065

FusionGeneSummary for NEU3_SNTG1

check button Fusion gene summary
Fusion gene informationFusion gene name: NEU3_SNTG1
Fusion gene ID: 24065
HgeneTgene
Gene symbol

NEU3

SNTG1

Gene ID

10825

54212

Gene nameneuraminidase 3syntrophin gamma 1
SynonymsSIAL3G1SYN|SYN4
Cytomap

11q13.4

8q11.21

Type of geneprotein-codingprotein-coding
Descriptionsialidase-3N-acetyl-alpha-neuraminidase 3ganglioside sialidasemembrane sialidasesialidase 3 (membrane sialidase)gamma-1-syntrophingamma1-syntrophinsyntrophin 4
Modification date2018052320180519
UniProtAcc

Q9UQ49

Q9NSN8

Ensembl transtripts involved in fusion geneENST00000294064, ENST00000531509, 
ENST00000544263, ENST00000529024, 
ENST00000532963, ENST00000531619, 
ENST00000545272, ENST00000526068, 
ENST00000534628, 
ENST00000518864, 
ENST00000522124, ENST00000517473, 
ENST00000276467, ENST00000520697, 
Fusion gene scores* DoF score3 X 3 X 1=96 X 5 X 4=120
# samples 46
** MAII scorelog2(4/9*10)=2.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NEU3 [Title/Abstract] AND SNTG1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNEU3

GO:0005975

carbohydrate metabolic process

12730204

HgeneNEU3

GO:0006689

ganglioside catabolic process

10861246

HgeneNEU3

GO:0009313

oligosaccharide catabolic process

10861246


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A201-01ANEU3chr11

74716670

+SNTG1chr8

51503439

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000294064ENST00000518864NEU3chr11

74716670

+SNTG1chr8

51503439

+
In-frameENST00000294064ENST00000522124NEU3chr11

74716670

+SNTG1chr8

51503439

+
In-frameENST00000294064ENST00000517473NEU3chr11

74716670

+SNTG1chr8

51503439

+
In-frameENST00000294064ENST00000276467NEU3chr11

74716670

+SNTG1chr8

51503439

+
5CDS-intronENST00000294064ENST00000520697NEU3chr11

74716670

+SNTG1chr8

51503439

+
Frame-shitENST00000531509ENST00000518864NEU3chr11

74716670

+SNTG1chr8

51503439

+
Frame-shitENST00000531509ENST00000522124NEU3chr11

74716670

+SNTG1chr8

51503439

+
Frame-shitENST00000531509ENST00000517473NEU3chr11

74716670

+SNTG1chr8

51503439

+
Frame-shitENST00000531509ENST00000276467NEU3chr11

74716670

+SNTG1chr8

51503439

+
5CDS-intronENST00000531509ENST00000520697NEU3chr11

74716670

+SNTG1chr8

51503439

+
Frame-shitENST00000544263ENST00000518864NEU3chr11

74716670

+SNTG1chr8

51503439

+
Frame-shitENST00000544263ENST00000522124NEU3chr11

74716670

+SNTG1chr8

51503439

+
Frame-shitENST00000544263ENST00000517473NEU3chr11

74716670

+SNTG1chr8

51503439

+
Frame-shitENST00000544263ENST00000276467NEU3chr11

74716670

+SNTG1chr8

51503439

+
5CDS-intronENST00000544263ENST00000520697NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-3CDSENST00000529024ENST00000518864NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-3CDSENST00000529024ENST00000522124NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-3CDSENST00000529024ENST00000517473NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-3CDSENST00000529024ENST00000276467NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-intronENST00000529024ENST00000520697NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-3CDSENST00000532963ENST00000518864NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-3CDSENST00000532963ENST00000522124NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-3CDSENST00000532963ENST00000517473NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-3CDSENST00000532963ENST00000276467NEU3chr11

74716670

+SNTG1chr8

51503439

+
3UTR-intronENST00000532963ENST00000520697NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000531619ENST00000518864NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000531619ENST00000522124NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000531619ENST00000517473NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000531619ENST00000276467NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-intronENST00000531619ENST00000520697NEU3chr11

74716670

+SNTG1chr8

51503439

+
In-frameENST00000545272ENST00000518864NEU3chr11

74716670

+SNTG1chr8

51503439

+
In-frameENST00000545272ENST00000522124NEU3chr11

74716670

+SNTG1chr8

51503439

+
In-frameENST00000545272ENST00000517473NEU3chr11

74716670

+SNTG1chr8

51503439

+
In-frameENST00000545272ENST00000276467NEU3chr11

74716670

+SNTG1chr8

51503439

+
5CDS-intronENST00000545272ENST00000520697NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000526068ENST00000518864NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000526068ENST00000522124NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000526068ENST00000517473NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000526068ENST00000276467NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-intronENST00000526068ENST00000520697NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000534628ENST00000518864NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000534628ENST00000522124NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000534628ENST00000517473NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-3CDSENST00000534628ENST00000276467NEU3chr11

74716670

+SNTG1chr8

51503439

+
intron-intronENST00000534628ENST00000520697NEU3chr11

74716670

+SNTG1chr8

51503439

+

Top

FusionProtFeatures for NEU3_SNTG1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NEU3

Q9UQ49

SNTG1

Q9NSN8

Plays a role in modulating the ganglioside content ofthe lipid bilayer at the level of membrane-bound sialylglycoconjugates. {ECO:0000269|PubMed:10861246,ECO:0000269|PubMed:20511247}. Adapter protein that binds to and probably organizes thesubcellular localization of a variety of proteins. May linkvarious receptors to the actin cytoskeleton and the dystrophinglycoprotein complex (By similarity). May participate inregulating the subcellular location of diacylglycerol kinase-zetato ensure that diacylglycerol is rapidly inactivated followingreceptor activation. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSNTG1chr11:74716670chr8:51503439ENST00000276467+916283_390270481DomainPH
TgeneSNTG1chr11:74716670chr8:51503439ENST00000517473+1017283_390270481DomainPH
TgeneSNTG1chr11:74716670chr8:51503439ENST00000518864+1220283_390270518DomainPH
TgeneSNTG1chr11:74716670chr8:51503439ENST00000522124+1119283_390270518DomainPH

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNEU3chr11:74716670chr8:51503439ENST00000544263+1424_27-57429MotifNote=FRIP motif
HgeneNEU3chr11:74716670chr8:51503439ENST00000544263+14129_140-57429RepeatNote=BNR 1
HgeneNEU3chr11:74716670chr8:51503439ENST00000544263+14203_214-57429RepeatNote=BNR 2
HgeneNEU3chr11:74716670chr8:51503439ENST00000544263+14254_265-57429RepeatNote=BNR 3
TgeneSNTG1chr11:74716670chr8:51503439ENST00000276467+91657_140270481DomainPDZ
TgeneSNTG1chr11:74716670chr8:51503439ENST00000517473+101757_140270481DomainPDZ
TgeneSNTG1chr11:74716670chr8:51503439ENST00000518864+122057_140270518DomainPDZ
TgeneSNTG1chr11:74716670chr8:51503439ENST00000522124+111957_140270518DomainPDZ


Top

FusionGeneSequence for NEU3_SNTG1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000518864_chr8_51503439_+_1112aa
MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLV
LRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEE
VIGSELKHWATFAVGPGHGIQLQSGRLVIPATTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGH
PVLTCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSES
WLLYSHPTSRKQRVDLGITLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTS
PGRNPSQFKSN_LA_DPISIDANGSYRQVNRSY_SLQIIKKLNILFPTFFHFSSSKEQNENFALATAVERALN_ELEDKDVVLALPLACF
WTLDVSPELSGPQVSICKMRVLVLRFLIFSSLGQA_CLHAS_SVSPGCIKDSDVKMETRGLTFSHDLPLIRV_GYKQVSWQEGRPDLTDL
FHF__QKTPHPFNNAQFCRLSILEELSKTEES_SLLPSTAL_FCLPSLPHPESIIF_GEQ_ESQCQ_YWIIVRIASGGITLMMG_SSFIR
VVPDGKRTWIRTLKHWTEFPTVFALKEFTSLWG_KSEKIQENKCSWWETL_MLGTMLG_W_LLM_FS_LHLQTAWSRLSKACPGFWVSLK
FVFLRILSWPSYSFTCEKIFTIRKISRPPDLRIRPICVGPWKSLLVK_RCLFV_IKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI
QCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAK

>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000522124_chr8_51503439_+_1112aa
MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLV
LRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEE
VIGSELKHWATFAVGPGHGIQLQSGRLVIPATTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGH
PVLTCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSES
WLLYSHPTSRKQRVDLGITLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTS
PGRNPSQFKSN_LA_DPISIDANGSYRQVNRSY_SLQIIKKLNILFPTFFHFSSSKEQNENFALATAVERALN_ELEDKDVVLALPLACF
WTLDVSPELSGPQVSICKMRVLVLRFLIFSSLGQA_CLHAS_SVSPGCIKDSDVKMETRGLTFSHDLPLIRV_GYKQVSWQEGRPDLTDL
FHF__QKTPHPFNNAQFCRLSILEELSKTEES_SLLPSTAL_FCLPSLPHPESIIF_GEQ_ESQCQ_YWIIVRIASGGITLMMG_SSFIR
VVPDGKRTWIRTLKHWTEFPTVFALKEFTSLWG_KSEKIQENKCSWWETL_MLGTMLG_W_LLM_FS_LHLQTAWSRLSKACPGFWVSLK
FVFLRILSWPSYSFTCEKIFTIRKISRPPDLRIRPICVGPWKSLLVK_RCLFV_IKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI
QCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAK

>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000517473_chr8_51503439_+_1075aa
MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLV
LRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEE
VIGSELKHWATFAVGPGHGIQLQSGRLVIPATTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGH
PVLTCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSES
WLLYSHPTSRKQRVDLGITLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTS
PGRNPSQFKSN_LA_DPISIDANGSYRQVNRSY_SLQIIKKLNILFPTFFHFSSSKEQNENFALATAVERALN_ELEDKDVVLALPLACF
WTLDVSPELSGPQVSICKMRVLVLRFLIFSSLGQA_CLHAS_SVSPGCIKDSDVKMETRGLTFSHDLPLIRV_GYKQVSWQEGRPDLTDL
FHF__QKTPHPFNNAQFCRLSILEELSKTEES_SLLPSTAL_FCLPSLPHPESIIF_GEQ_ESQCQ_YWIIVRIASGGITLMMG_SSFIR
VVPDGKRTWIRTLKHWTEFPTVFALKEFTSLWG_KSEKIQENKCSWWETL_MLGTMLG_W_LLM_FS_LHLQTAWSRLSKACPGFWVSLK
FVFLRILSWPSYSFTCEKIFTIRKISRPPDLRIRPICVGPWKSLLVK_RCLFV_IKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI

>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000276467_chr8_51503439_+_1075aa
MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLV
LRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEE
VIGSELKHWATFAVGPGHGIQLQSGRLVIPATTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGH
PVLTCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSES
WLLYSHPTSRKQRVDLGITLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTS
PGRNPSQFKSN_LA_DPISIDANGSYRQVNRSY_SLQIIKKLNILFPTFFHFSSSKEQNENFALATAVERALN_ELEDKDVVLALPLACF
WTLDVSPELSGPQVSICKMRVLVLRFLIFSSLGQA_CLHAS_SVSPGCIKDSDVKMETRGLTFSHDLPLIRV_GYKQVSWQEGRPDLTDL
FHF__QKTPHPFNNAQFCRLSILEELSKTEES_SLLPSTAL_FCLPSLPHPESIIF_GEQ_ESQCQ_YWIIVRIASGGITLMMG_SSFIR
VVPDGKRTWIRTLKHWTEFPTVFALKEFTSLWG_KSEKIQENKCSWWETL_MLGTMLG_W_LLM_FS_LHLQTAWSRLSKACPGFWVSLK
FVFLRILSWPSYSFTCEKIFTIRKISRPPDLRIRPICVGPWKSLLVK_RCLFV_IKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000518864_chr8_51503439_+_715aa
MEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHG
IQLQSGRLVIPATTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLTCSARTPNRCRAEALS
TDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIT
LNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN_LA_DPIS
IDANGSYRQVNRSY_SLQIIKKLNILFPTFFHFSSSKEQNENFALATAVERALN_ELEDKDVVLALPLACFWTLDVSPELSGPQVSICKM
RVLVLRFLIFSSLGQA_IKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCK
ILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWR

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000522124_chr8_51503439_+_715aa
MEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHG
IQLQSGRLVIPATTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLTCSARTPNRCRAEALS
TDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIT
LNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN_LA_DPIS
IDANGSYRQVNRSY_SLQIIKKLNILFPTFFHFSSSKEQNENFALATAVERALN_ELEDKDVVLALPLACFWTLDVSPELSGPQVSICKM
RVLVLRFLIFSSLGQA_IKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCK
ILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWR

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000517473_chr8_51503439_+_678aa
MEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHG
IQLQSGRLVIPATTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLTCSARTPNRCRAEALS
TDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIT
LNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN_LA_DPIS
IDANGSYRQVNRSY_SLQIIKKLNILFPTFFHFSSSKEQNENFALATAVERALN_ELEDKDVVLALPLACFWTLDVSPELSGPQVSICKM
RVLVLRFLIFSSLGQA_IKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCK
ILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTTACVLESHLMGLTIDFSTGFICFDAATKELEFS

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000276467_chr8_51503439_+_678aa
MEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHG
IQLQSGRLVIPATTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLTCSARTPNRCRAEALS
TDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIT
LNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN_LA_DPIS
IDANGSYRQVNRSY_SLQIIKKLNILFPTFFHFSSSKEQNENFALATAVERALN_ELEDKDVVLALPLACFWTLDVSPELSGPQVSICKM
RVLVLRFLIFSSLGQA_IKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCK
ILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTTACVLESHLMGLTIDFSTGFICFDAATKELEFS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000518864_chr8_51503439_+_3336nt
ATGAGACCTGCGGACCTGCCCCCGCGCCCCATGGAAGAATCCCCGGCGTCCAGCTCTGCCCCGACAGAGACGGAGGAGCCGGGGTCCAGT
GCAGAGGTCATGGAAGAAGTGACAACATGCTCCTTCAACAGCCCTCTGTTCCGGCAGGAAGATGACAGAGGGATTACCTACCGGATCCCA
GCCCTGCTCTACATACCCCCCACCCACACCTTCCTGGCCTTTGCAGAGAAGCGTTCTACGAGGAGAGATGAGGATGCTCTCCACCTGGTG
CTGAGGCGAGGGTTGAGGATTGGGCAGTTGGTACAGTGGGGGCCCCTGAAGCCACTGATGGAAGCCACACTACCGGGGCATCGGACCATG
AACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCACAGAGCGTCAACAGATT
GTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGGAGTGAGGTGAGGGACTTGACTGAGGAG
GTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACTGGTCATCCCT
GCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCTCATTCTCTGATGATCTACAGTGATGAC
CTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGGCCAC
CCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGACCATGGTGAAGGCTTTCAGAGACTGGCC
CTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGAC
TCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGGAGGAAGCTGGAACACCGTCAGAATCA
TGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGG
TCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAA
TGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGC
CCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGATGCAAATGGCAGTTACAGACAGGTTAAC
AGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCACTTTTCCTCCTCCAAAGAGCAAAATGAA
AATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTGGTCCTGGCTCTGCCACTGGCTTGCTTT
TGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTATTGGTTCTAAGATTTCTCATCTTCTCA
TCCCTAGGACAAGCATAGTGCCTGCATGCTTCATGATCAGTAAGTCCTGGCTGCATAAAGGACTCTGATGTCAAAATGGAAACCAGGGGA
CTTACCTTTTCACATGACTTACCCCTCATCCGAGTGTGAGGTTACAAGCAGGTGTCATGGCAGGAAGGAAGACCAGATCTGTATGATTTG
TTCCATTTTTAATAACAAAAATATCCACACCCTTTTAATAATGCTCAGTTCTGTAGGCTCTCTATCCTAGAGGAATTGAGCAAAACAGAA
GAATCATGAAGTCTCCTACCTTCTACAGCCTTGTAGTTCTGCTTACCTTCTCTTCCTCATCCAGAAAGCATCATTTTCTAGGGAGAACAA
TGAGAATCTCAATGCCAGTAGTACTGGATAATAGTGCGTATTGCTTCTGGTGGCATTACCCTGATGATGGGCTGAAGTTCATTTATTAGG
GTGGTTCCTGATGGGAAAAGGACATGGATTAGGACTTTAAAACACTGGACAGAATTTCCCACAGTCTTTGCCCTCAAGGAGTTCACCAGT
TTATGGGGCTAGAAGAGCGAGAAAATTCAAGAAAATAAATGTAGCTGGTGGGAGACTTTGTAGATGTTGGGCTATATGTTGGGGTGATGG
TAGCTCCTGATGTAATTTTCTTAGTTGCATCTTCAATATGCCTGGAGTCGTCTGTCCAAGGCTTGTCCAGGCTTCTGGGTTTCTCTCAAG
TTTGTTTTTCTCAGGATATTGTCCTGGCCCAGCTACTCCTTTACCTGTGAGAAGATCTTCACCATTAGGAAGATCTCTAGACCCCCAGAT
CTCAGAATCAGGCCTATTTGTGTAGGCCCATGGAAATCACTACTTGTGAAGTAGAGATGCCTTTTTGTCTAAATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA

>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000522124_chr8_51503439_+_3336nt
ATGAGACCTGCGGACCTGCCCCCGCGCCCCATGGAAGAATCCCCGGCGTCCAGCTCTGCCCCGACAGAGACGGAGGAGCCGGGGTCCAGT
GCAGAGGTCATGGAAGAAGTGACAACATGCTCCTTCAACAGCCCTCTGTTCCGGCAGGAAGATGACAGAGGGATTACCTACCGGATCCCA
GCCCTGCTCTACATACCCCCCACCCACACCTTCCTGGCCTTTGCAGAGAAGCGTTCTACGAGGAGAGATGAGGATGCTCTCCACCTGGTG
CTGAGGCGAGGGTTGAGGATTGGGCAGTTGGTACAGTGGGGGCCCCTGAAGCCACTGATGGAAGCCACACTACCGGGGCATCGGACCATG
AACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCACAGAGCGTCAACAGATT
GTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGGAGTGAGGTGAGGGACTTGACTGAGGAG
GTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACTGGTCATCCCT
GCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCTCATTCTCTGATGATCTACAGTGATGAC
CTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGGCCAC
CCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGACCATGGTGAAGGCTTTCAGAGACTGGCC
CTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGAC
TCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGGAGGAAGCTGGAACACCGTCAGAATCA
TGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGG
TCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAA
TGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGC
CCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGATGCAAATGGCAGTTACAGACAGGTTAAC
AGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCACTTTTCCTCCTCCAAAGAGCAAAATGAA
AATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTGGTCCTGGCTCTGCCACTGGCTTGCTTT
TGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTATTGGTTCTAAGATTTCTCATCTTCTCA
TCCCTAGGACAAGCATAGTGCCTGCATGCTTCATGATCAGTAAGTCCTGGCTGCATAAAGGACTCTGATGTCAAAATGGAAACCAGGGGA
CTTACCTTTTCACATGACTTACCCCTCATCCGAGTGTGAGGTTACAAGCAGGTGTCATGGCAGGAAGGAAGACCAGATCTGTATGATTTG
TTCCATTTTTAATAACAAAAATATCCACACCCTTTTAATAATGCTCAGTTCTGTAGGCTCTCTATCCTAGAGGAATTGAGCAAAACAGAA
GAATCATGAAGTCTCCTACCTTCTACAGCCTTGTAGTTCTGCTTACCTTCTCTTCCTCATCCAGAAAGCATCATTTTCTAGGGAGAACAA
TGAGAATCTCAATGCCAGTAGTACTGGATAATAGTGCGTATTGCTTCTGGTGGCATTACCCTGATGATGGGCTGAAGTTCATTTATTAGG
GTGGTTCCTGATGGGAAAAGGACATGGATTAGGACTTTAAAACACTGGACAGAATTTCCCACAGTCTTTGCCCTCAAGGAGTTCACCAGT
TTATGGGGCTAGAAGAGCGAGAAAATTCAAGAAAATAAATGTAGCTGGTGGGAGACTTTGTAGATGTTGGGCTATATGTTGGGGTGATGG
TAGCTCCTGATGTAATTTTCTTAGTTGCATCTTCAATATGCCTGGAGTCGTCTGTCCAAGGCTTGTCCAGGCTTCTGGGTTTCTCTCAAG
TTTGTTTTTCTCAGGATATTGTCCTGGCCCAGCTACTCCTTTACCTGTGAGAAGATCTTCACCATTAGGAAGATCTCTAGACCCCCAGAT
CTCAGAATCAGGCCTATTTGTGTAGGCCCATGGAAATCACTACTTGTGAAGTAGAGATGCCTTTTTGTCTAAATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA

>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000517473_chr8_51503439_+_3225nt
ATGAGACCTGCGGACCTGCCCCCGCGCCCCATGGAAGAATCCCCGGCGTCCAGCTCTGCCCCGACAGAGACGGAGGAGCCGGGGTCCAGT
GCAGAGGTCATGGAAGAAGTGACAACATGCTCCTTCAACAGCCCTCTGTTCCGGCAGGAAGATGACAGAGGGATTACCTACCGGATCCCA
GCCCTGCTCTACATACCCCCCACCCACACCTTCCTGGCCTTTGCAGAGAAGCGTTCTACGAGGAGAGATGAGGATGCTCTCCACCTGGTG
CTGAGGCGAGGGTTGAGGATTGGGCAGTTGGTACAGTGGGGGCCCCTGAAGCCACTGATGGAAGCCACACTACCGGGGCATCGGACCATG
AACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCACAGAGCGTCAACAGATT
GTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGGAGTGAGGTGAGGGACTTGACTGAGGAG
GTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACTGGTCATCCCT
GCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCTCATTCTCTGATGATCTACAGTGATGAC
CTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGGCCAC
CCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGACCATGGTGAAGGCTTTCAGAGACTGGCC
CTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGAC
TCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGGAGGAAGCTGGAACACCGTCAGAATCA
TGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGG
TCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAA
TGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGC
CCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGATGCAAATGGCAGTTACAGACAGGTTAAC
AGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCACTTTTCCTCCTCCAAAGAGCAAAATGAA
AATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTGGTCCTGGCTCTGCCACTGGCTTGCTTT
TGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTATTGGTTCTAAGATTTCTCATCTTCTCA
TCCCTAGGACAAGCATAGTGCCTGCATGCTTCATGATCAGTAAGTCCTGGCTGCATAAAGGACTCTGATGTCAAAATGGAAACCAGGGGA
CTTACCTTTTCACATGACTTACCCCTCATCCGAGTGTGAGGTTACAAGCAGGTGTCATGGCAGGAAGGAAGACCAGATCTGTATGATTTG
TTCCATTTTTAATAACAAAAATATCCACACCCTTTTAATAATGCTCAGTTCTGTAGGCTCTCTATCCTAGAGGAATTGAGCAAAACAGAA
GAATCATGAAGTCTCCTACCTTCTACAGCCTTGTAGTTCTGCTTACCTTCTCTTCCTCATCCAGAAAGCATCATTTTCTAGGGAGAACAA
TGAGAATCTCAATGCCAGTAGTACTGGATAATAGTGCGTATTGCTTCTGGTGGCATTACCCTGATGATGGGCTGAAGTTCATTTATTAGG
GTGGTTCCTGATGGGAAAAGGACATGGATTAGGACTTTAAAACACTGGACAGAATTTCCCACAGTCTTTGCCCTCAAGGAGTTCACCAGT
TTATGGGGCTAGAAGAGCGAGAAAATTCAAGAAAATAAATGTAGCTGGTGGGAGACTTTGTAGATGTTGGGCTATATGTTGGGGTGATGG
TAGCTCCTGATGTAATTTTCTTAGTTGCATCTTCAATATGCCTGGAGTCGTCTGTCCAAGGCTTGTCCAGGCTTCTGGGTTTCTCTCAAG
TTTGTTTTTCTCAGGATATTGTCCTGGCCCAGCTACTCCTTTACCTGTGAGAAGATCTTCACCATTAGGAAGATCTCTAGACCCCCAGAT
CTCAGAATCAGGCCTATTTGTGTAGGCCCATGGAAATCACTACTTGTGAAGTAGAGATGCCTTTTTGTCTAAATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA

>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000276467_chr8_51503439_+_3225nt
ATGAGACCTGCGGACCTGCCCCCGCGCCCCATGGAAGAATCCCCGGCGTCCAGCTCTGCCCCGACAGAGACGGAGGAGCCGGGGTCCAGT
GCAGAGGTCATGGAAGAAGTGACAACATGCTCCTTCAACAGCCCTCTGTTCCGGCAGGAAGATGACAGAGGGATTACCTACCGGATCCCA
GCCCTGCTCTACATACCCCCCACCCACACCTTCCTGGCCTTTGCAGAGAAGCGTTCTACGAGGAGAGATGAGGATGCTCTCCACCTGGTG
CTGAGGCGAGGGTTGAGGATTGGGCAGTTGGTACAGTGGGGGCCCCTGAAGCCACTGATGGAAGCCACACTACCGGGGCATCGGACCATG
AACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCACAGAGCGTCAACAGATT
GTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGGAGTGAGGTGAGGGACTTGACTGAGGAG
GTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACTGGTCATCCCT
GCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCTCATTCTCTGATGATCTACAGTGATGAC
CTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGGCCAC
CCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGACCATGGTGAAGGCTTTCAGAGACTGGCC
CTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGAC
TCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGGAGGAAGCTGGAACACCGTCAGAATCA
TGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGG
TCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAA
TGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGC
CCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGATGCAAATGGCAGTTACAGACAGGTTAAC
AGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCACTTTTCCTCCTCCAAAGAGCAAAATGAA
AATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTGGTCCTGGCTCTGCCACTGGCTTGCTTT
TGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTATTGGTTCTAAGATTTCTCATCTTCTCA
TCCCTAGGACAAGCATAGTGCCTGCATGCTTCATGATCAGTAAGTCCTGGCTGCATAAAGGACTCTGATGTCAAAATGGAAACCAGGGGA
CTTACCTTTTCACATGACTTACCCCTCATCCGAGTGTGAGGTTACAAGCAGGTGTCATGGCAGGAAGGAAGACCAGATCTGTATGATTTG
TTCCATTTTTAATAACAAAAATATCCACACCCTTTTAATAATGCTCAGTTCTGTAGGCTCTCTATCCTAGAGGAATTGAGCAAAACAGAA
GAATCATGAAGTCTCCTACCTTCTACAGCCTTGTAGTTCTGCTTACCTTCTCTTCCTCATCCAGAAAGCATCATTTTCTAGGGAGAACAA
TGAGAATCTCAATGCCAGTAGTACTGGATAATAGTGCGTATTGCTTCTGGTGGCATTACCCTGATGATGGGCTGAAGTTCATTTATTAGG
GTGGTTCCTGATGGGAAAAGGACATGGATTAGGACTTTAAAACACTGGACAGAATTTCCCACAGTCTTTGCCCTCAAGGAGTTCACCAGT
TTATGGGGCTAGAAGAGCGAGAAAATTCAAGAAAATAAATGTAGCTGGTGGGAGACTTTGTAGATGTTGGGCTATATGTTGGGGTGATGG
TAGCTCCTGATGTAATTTTCTTAGTTGCATCTTCAATATGCCTGGAGTCGTCTGTCCAAGGCTTGTCCAGGCTTCTGGGTTTCTCTCAAG
TTTGTTTTTCTCAGGATATTGTCCTGGCCCAGCTACTCCTTTACCTGTGAGAAGATCTTCACCATTAGGAAGATCTCTAGACCCCCAGAT
CTCAGAATCAGGCCTATTTGTGTAGGCCCATGGAAATCACTACTTGTGAAGTAGAGATGCCTTTTTGTCTAAATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000518864_chr8_51503439_+_2145nt
ATGGAAGCCACACTACCGGGGCATCGGACCATGAACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGT
GTGCGGGGCCATGTCACAGAGCGTCAACAGATTGTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGT
TCATGGAGTGAGGTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGC
ATCCAGCTGCAGTCAGGGAGACTGGTCATCCCTGCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACC
AGGCCTCATTCTCTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGT
GAAGTGGCAGAGGTGACTGGGAGGGCTGGCCACCCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGC
ACTGACCATGGTGAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTC
CGGCCCCTGGAGATCCCACATAGGTGCCAGGACTCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGG
CTGGAGGAGGAAGCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTAT
CTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTG
GAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAG
ATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCC
ATAGATGCAAATGGCAGTTACAGACAGGTTAACAGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTT
TTTCACTTTTCCTCCTCCAAAGAGCAAAATGAAAATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAG
GATGTGGTCCTGGCTCTGCCACTGGCTTGCTTTTGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATG
AGAGTATTGGTTCTAAGATTTCTCATCTTCTCATCCCTAGGACAAGCATAGATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAG
ATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCA
TGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAG
ATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAG
CTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGT
GTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGG
TATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAA
GCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000522124_chr8_51503439_+_2145nt
ATGGAAGCCACACTACCGGGGCATCGGACCATGAACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGT
GTGCGGGGCCATGTCACAGAGCGTCAACAGATTGTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGT
TCATGGAGTGAGGTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGC
ATCCAGCTGCAGTCAGGGAGACTGGTCATCCCTGCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACC
AGGCCTCATTCTCTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGT
GAAGTGGCAGAGGTGACTGGGAGGGCTGGCCACCCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGC
ACTGACCATGGTGAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTC
CGGCCCCTGGAGATCCCACATAGGTGCCAGGACTCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGG
CTGGAGGAGGAAGCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTAT
CTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTG
GAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAG
ATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCC
ATAGATGCAAATGGCAGTTACAGACAGGTTAACAGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTT
TTTCACTTTTCCTCCTCCAAAGAGCAAAATGAAAATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAG
GATGTGGTCCTGGCTCTGCCACTGGCTTGCTTTTGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATG
AGAGTATTGGTTCTAAGATTTCTCATCTTCTCATCCCTAGGACAAGCATAGATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAG
ATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCA
TGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAG
ATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAG
CTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGT
GTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGG
TATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAA
GCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000517473_chr8_51503439_+_2034nt
ATGGAAGCCACACTACCGGGGCATCGGACCATGAACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGT
GTGCGGGGCCATGTCACAGAGCGTCAACAGATTGTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGT
TCATGGAGTGAGGTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGC
ATCCAGCTGCAGTCAGGGAGACTGGTCATCCCTGCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACC
AGGCCTCATTCTCTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGT
GAAGTGGCAGAGGTGACTGGGAGGGCTGGCCACCCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGC
ACTGACCATGGTGAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTC
CGGCCCCTGGAGATCCCACATAGGTGCCAGGACTCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGG
CTGGAGGAGGAAGCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTAT
CTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTG
GAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAG
ATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCC
ATAGATGCAAATGGCAGTTACAGACAGGTTAACAGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTT
TTTCACTTTTCCTCCTCCAAAGAGCAAAATGAAAATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAG
GATGTGGTCCTGGCTCTGCCACTGGCTTGCTTTTGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATG
AGAGTATTGGTTCTAAGATTTCTCATCTTCTCATCCCTAGGACAAGCATAGATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAG
ATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCA
TGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAG
ATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAG
CTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGT
GTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCT
AATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACT

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000276467_chr8_51503439_+_2034nt
ATGGAAGCCACACTACCGGGGCATCGGACCATGAACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGT
GTGCGGGGCCATGTCACAGAGCGTCAACAGATTGTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGT
TCATGGAGTGAGGTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGC
ATCCAGCTGCAGTCAGGGAGACTGGTCATCCCTGCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACC
AGGCCTCATTCTCTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGT
GAAGTGGCAGAGGTGACTGGGAGGGCTGGCCACCCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGC
ACTGACCATGGTGAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTC
CGGCCCCTGGAGATCCCACATAGGTGCCAGGACTCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGG
CTGGAGGAGGAAGCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTAT
CTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTG
GAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAG
ATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCC
ATAGATGCAAATGGCAGTTACAGACAGGTTAACAGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTT
TTTCACTTTTCCTCCTCCAAAGAGCAAAATGAAAATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAG
GATGTGGTCCTGGCTCTGCCACTGGCTTGCTTTTGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATG
AGAGTATTGGTTCTAAGATTTCTCATCTTCTCATCCCTAGGACAAGCATAGATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAG
ATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCA
TGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAG
ATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAG
CTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGT
GTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCT
AATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000518864_chr8_51503439_+_3273nt
AAGCAGAATGTGATTTGCTTGAAGATATGAGAGGTCATGGAAGAAGTGACAACATGCTCCTTCAACAGCCCTCTGTTCCGGCAGGAAGAT
GACAGAGGGATTACCTACCGGATCCCAGCCCTGCTCTACATACCCCCCACCCACACCTTCCTGGCCTTTGCAGAGAAGCGTTCTACGAGG
AGAGATGAGGATGCTCTCCACCTGGTGCTGAGGCGAGGGTTGAGGATTGGGCAGTTGGTACAGTGGGGGCCCCTGAAGCCACTGATGGAA
GCCACACTACCGGGGCATCGGACCATGAACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGG
GGCCATGTCACAGAGCGTCAACAGATTGTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGG
AGTGAGGTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAG
CTGCAGTCAGGGAGACTGGTCATCCCTGCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCT
CATTCTCTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTG
GCAGAGGTGACTGGGAGGGCTGGCCACCCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGAC
CATGGTGAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCC
CTGGAGATCCCACATAGGTGCCAGGACTCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAG
GAGGAAGCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAAC
CAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAG
GAGGGCTTGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTG
AGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGAT
GCAAATGGCAGTTACAGACAGGTTAACAGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCAC
TTTTCCTCCTCCAAAGAGCAAAATGAAAATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTG
GTCCTGGCTCTGCCACTGGCTTGCTTTTGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTA
TTGGTTCTAAGATTTCTCATCTTCTCATCCCTAGGACAAGCATAGTGCCTGCATGCTTCATGATCAGTAAGTCCTGGCTGCATAAAGGAC
TCTGATGTCAAAATGGAAACCAGGGGACTTACCTTTTCACATGACTTACCCCTCATCCGAGTGTGAGGTTACAAGCAGGTGTCATGGCAG
GAAGGAAGACCAGATCTGTATGATTTGTTCCATTTTTAATAACAAAAATATCCACACCCTTTTAATAATGCTCAGTTCTGTAGGCTCTCT
ATCCTAGAGGAATTGAGCAAAACAGAAGAATCATGAAGTCTCCTACCTTCTACAGCCTTGTAGTTCTGCTTACCTTCTCTTCCTCATCCA
GAAAGCATCATTTTCTAGGGAGAACAATGAGAATCTCAATGCCAGTAGTACTGGATAATAGTGCGTATTGCTTCTGGTGGCATTACCCTG
ATGATGGGCTGAAGTTCATTTATTAGGGTGGTTCCTGATGGGAAAAGGACATGGATTAGGACTTTAAAACACTGGACAGAATTTCCCACA
GTCTTTGCCCTCAAGGAGTTCACCAGTTTATGGGGCTAGAAGAGCGAGAAAATTCAAGAAAATAAATGTAGCTGGTGGGAGACTTTGTAG
ATGTTGGGCTATATGTTGGGGTGATGGTAGCTCCTGATGTAATTTTCTTAGTTGCATCTTCAATATGCCTGGAGTCGTCTGTCCAAGGCT
TGTCCAGGCTTCTGGGTTTCTCTCAAGTTTGTTTTTCTCAGGATATTGTCCTGGCCCAGCTACTCCTTTACCTGTGAGAAGATCTTCACC
ATTAGGAAGATCTCTAGACCCCCAGATCTCAGAATCAGGCCTATTTGTGTAGGCCCATGGAAATCACTACTTGTGAAGTAGAGATGCCTT
TTTGTCTAAATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCC
CTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGAC
TGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGC
TTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACA
GCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGC
ACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAG
AGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCAC
TGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCT

>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000522124_chr8_51503439_+_4562nt
AAGCAGAATGTGATTTGCTTGAAGATATGAGAGGTCATGGAAGAAGTGACAACATGCTCCTTCAACAGCCCTCTGTTCCGGCAGGAAGAT
GACAGAGGGATTACCTACCGGATCCCAGCCCTGCTCTACATACCCCCCACCCACACCTTCCTGGCCTTTGCAGAGAAGCGTTCTACGAGG
AGAGATGAGGATGCTCTCCACCTGGTGCTGAGGCGAGGGTTGAGGATTGGGCAGTTGGTACAGTGGGGGCCCCTGAAGCCACTGATGGAA
GCCACACTACCGGGGCATCGGACCATGAACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGG
GGCCATGTCACAGAGCGTCAACAGATTGTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGG
AGTGAGGTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAG
CTGCAGTCAGGGAGACTGGTCATCCCTGCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCT
CATTCTCTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTG
GCAGAGGTGACTGGGAGGGCTGGCCACCCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGAC
CATGGTGAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCC
CTGGAGATCCCACATAGGTGCCAGGACTCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAG
GAGGAAGCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAAC
CAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAG
GAGGGCTTGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTG
AGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGAT
GCAAATGGCAGTTACAGACAGGTTAACAGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCAC
TTTTCCTCCTCCAAAGAGCAAAATGAAAATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTG
GTCCTGGCTCTGCCACTGGCTTGCTTTTGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTA
TTGGTTCTAAGATTTCTCATCTTCTCATCCCTAGGACAAGCATAGTGCCTGCATGCTTCATGATCAGTAAGTCCTGGCTGCATAAAGGAC
TCTGATGTCAAAATGGAAACCAGGGGACTTACCTTTTCACATGACTTACCCCTCATCCGAGTGTGAGGTTACAAGCAGGTGTCATGGCAG
GAAGGAAGACCAGATCTGTATGATTTGTTCCATTTTTAATAACAAAAATATCCACACCCTTTTAATAATGCTCAGTTCTGTAGGCTCTCT
ATCCTAGAGGAATTGAGCAAAACAGAAGAATCATGAAGTCTCCTACCTTCTACAGCCTTGTAGTTCTGCTTACCTTCTCTTCCTCATCCA
GAAAGCATCATTTTCTAGGGAGAACAATGAGAATCTCAATGCCAGTAGTACTGGATAATAGTGCGTATTGCTTCTGGTGGCATTACCCTG
ATGATGGGCTGAAGTTCATTTATTAGGGTGGTTCCTGATGGGAAAAGGACATGGATTAGGACTTTAAAACACTGGACAGAATTTCCCACA
GTCTTTGCCCTCAAGGAGTTCACCAGTTTATGGGGCTAGAAGAGCGAGAAAATTCAAGAAAATAAATGTAGCTGGTGGGAGACTTTGTAG
ATGTTGGGCTATATGTTGGGGTGATGGTAGCTCCTGATGTAATTTTCTTAGTTGCATCTTCAATATGCCTGGAGTCGTCTGTCCAAGGCT
TGTCCAGGCTTCTGGGTTTCTCTCAAGTTTGTTTTTCTCAGGATATTGTCCTGGCCCAGCTACTCCTTTACCTGTGAGAAGATCTTCACC
ATTAGGAAGATCTCTAGACCCCCAGATCTCAGAATCAGGCCTATTTGTGTAGGCCCATGGAAATCACTACTTGTGAAGTAGAGATGCCTT
TTTGTCTAAATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCC
CTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGAC
TGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGC
TTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACA
GCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGC
ACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAG
AGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCAC
TGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCT
GCTACCACGAGCAAAGCAAAGTATACAACTTGACATACTGAACTCTTCATTGACACACCCCATGACTGTATAAGCAGGACACATTTACTC
ATCATTTTAGACCCTAGAGAAACCATAACATCACCAAGTCGACAGTGGAGGCAAATCAAAATTTCGGCAGAAAAAGAAGGTCATGTGGAA
CCTCAAAAACACTTCTATTCTGGATGACATCTGTGAAATATACTACATGAACAGAACAGCTTGTTCTCACTCAGTTGCTTTGTACCAGTA
AGTGTATTGCTTTCACCAAAAGTGGAGACAAAAGAATAAATTATTTGAAGAAGTATGTAAATAACATAAAAATAGTAAGCTACCTATGAA
TAAAAATACTTATTAAATGATTACTTCTGTATTTTAGATTATTTTGTATGACTAGTACATGTTGGGCAGAGTCATAGGAAAACAAATGCC
CTATCTTGTATTATGAGGGACATAAAAGAGTTAAAAACCATAAATCAGCAAGGAGCATGCAAAAAAATCTCATCAAAGAAGGATGCACTT
TAATTTGCTGATGTAAATTTGCCCTTGTGTTCTCATCCCATGATTTGACACTGGCATTCCAATTGTTTTTATCTTATTGTAAATATTCCG
AAGAACTTCCAAAGGATAATTACATTGACCCATGATAGATACAATGTGAAATGGACTATTCTCCCTTGGATCACTGTTATTGAAATGTCT
TATTAGCTGCCAAAGTCAATCAAATATGCCAACAGTGTATTAATTTAATTATGAGTGATGGAAAATTTCATGAACCTCTCATTTCTTCCT
TGGTTTGAAAGAGATTTGTATTTTACCTAATAAGATTTATTATCAAATTAAAGTTTCATAAATTTTCAGTGAACCCAAAACCTTTTGTAG
AGAAAATAATATAAACAAATATGGTGTGAGAAACAATTCTTTGTAATCCGAAGTCTACTAGTTAATCATGAACTAAAATGTCCCCCGAAA
ACAGTCCCAAAGCTATTATAGATGTTAATTAAATGACATTTTTTCATTTTAGTACTATTTTATGAGAAACAAAGGTGATATTTAAAGATA
AAAGTTAAAATTCTTTAACCTCCCTTGTCATGGAAAGTGATTAAGTAATGCCAACTATGCAGGTTGTTTTAGGTATTTTGTCCTAAGAAT
GTAAATGTGAAAGGCTGGGAAATTTGAAAGCCTTAGAGGTGTGCAATTTACTCAGATTCCAGGTATTATTCAACTAGTTGTATAACATGG

>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000517473_chr8_51503439_+_3200nt
AAGCAGAATGTGATTTGCTTGAAGATATGAGAGGTCATGGAAGAAGTGACAACATGCTCCTTCAACAGCCCTCTGTTCCGGCAGGAAGAT
GACAGAGGGATTACCTACCGGATCCCAGCCCTGCTCTACATACCCCCCACCCACACCTTCCTGGCCTTTGCAGAGAAGCGTTCTACGAGG
AGAGATGAGGATGCTCTCCACCTGGTGCTGAGGCGAGGGTTGAGGATTGGGCAGTTGGTACAGTGGGGGCCCCTGAAGCCACTGATGGAA
GCCACACTACCGGGGCATCGGACCATGAACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGG
GGCCATGTCACAGAGCGTCAACAGATTGTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGG
AGTGAGGTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAG
CTGCAGTCAGGGAGACTGGTCATCCCTGCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCT
CATTCTCTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTG
GCAGAGGTGACTGGGAGGGCTGGCCACCCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGAC
CATGGTGAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCC
CTGGAGATCCCACATAGGTGCCAGGACTCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAG
GAGGAAGCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAAC
CAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAG
GAGGGCTTGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTG
AGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGAT
GCAAATGGCAGTTACAGACAGGTTAACAGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCAC
TTTTCCTCCTCCAAAGAGCAAAATGAAAATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTG
GTCCTGGCTCTGCCACTGGCTTGCTTTTGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTA
TTGGTTCTAAGATTTCTCATCTTCTCATCCCTAGGACAAGCATAGTGCCTGCATGCTTCATGATCAGTAAGTCCTGGCTGCATAAAGGAC
TCTGATGTCAAAATGGAAACCAGGGGACTTACCTTTTCACATGACTTACCCCTCATCCGAGTGTGAGGTTACAAGCAGGTGTCATGGCAG
GAAGGAAGACCAGATCTGTATGATTTGTTCCATTTTTAATAACAAAAATATCCACACCCTTTTAATAATGCTCAGTTCTGTAGGCTCTCT
ATCCTAGAGGAATTGAGCAAAACAGAAGAATCATGAAGTCTCCTACCTTCTACAGCCTTGTAGTTCTGCTTACCTTCTCTTCCTCATCCA
GAAAGCATCATTTTCTAGGGAGAACAATGAGAATCTCAATGCCAGTAGTACTGGATAATAGTGCGTATTGCTTCTGGTGGCATTACCCTG
ATGATGGGCTGAAGTTCATTTATTAGGGTGGTTCCTGATGGGAAAAGGACATGGATTAGGACTTTAAAACACTGGACAGAATTTCCCACA
GTCTTTGCCCTCAAGGAGTTCACCAGTTTATGGGGCTAGAAGAGCGAGAAAATTCAAGAAAATAAATGTAGCTGGTGGGAGACTTTGTAG
ATGTTGGGCTATATGTTGGGGTGATGGTAGCTCCTGATGTAATTTTCTTAGTTGCATCTTCAATATGCCTGGAGTCGTCTGTCCAAGGCT
TGTCCAGGCTTCTGGGTTTCTCTCAAGTTTGTTTTTCTCAGGATATTGTCCTGGCCCAGCTACTCCTTTACCTGTGAGAAGATCTTCACC
ATTAGGAAGATCTCTAGACCCCCAGATCTCAGAATCAGGCCTATTTGTGTAGGCCCATGGAAATCACTACTTGTGAAGTAGAGATGCCTT
TTTGTCTAAATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCC
CTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGAC
TGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGC
TTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACA
GCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGC
ACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCT
GCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAG

>In-frame_NEU3_ENST00000294064_chr11_74716670_+_SNTG1_ENST00000276467_chr8_51503439_+_3198nt
AAGCAGAATGTGATTTGCTTGAAGATATGAGAGGTCATGGAAGAAGTGACAACATGCTCCTTCAACAGCCCTCTGTTCCGGCAGGAAGAT
GACAGAGGGATTACCTACCGGATCCCAGCCCTGCTCTACATACCCCCCACCCACACCTTCCTGGCCTTTGCAGAGAAGCGTTCTACGAGG
AGAGATGAGGATGCTCTCCACCTGGTGCTGAGGCGAGGGTTGAGGATTGGGCAGTTGGTACAGTGGGGGCCCCTGAAGCCACTGATGGAA
GCCACACTACCGGGGCATCGGACCATGAACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGG
GGCCATGTCACAGAGCGTCAACAGATTGTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGG
AGTGAGGTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAG
CTGCAGTCAGGGAGACTGGTCATCCCTGCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCT
CATTCTCTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTG
GCAGAGGTGACTGGGAGGGCTGGCCACCCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGAC
CATGGTGAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCC
CTGGAGATCCCACATAGGTGCCAGGACTCTAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAG
GAGGAAGCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAAC
CAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAG
GAGGGCTTGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTG
AGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGAT
GCAAATGGCAGTTACAGACAGGTTAACAGAAGCTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCAC
TTTTCCTCCTCCAAAGAGCAAAATGAAAATTTTGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTG
GTCCTGGCTCTGCCACTGGCTTGCTTTTGGACCTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTA
TTGGTTCTAAGATTTCTCATCTTCTCATCCCTAGGACAAGCATAGTGCCTGCATGCTTCATGATCAGTAAGTCCTGGCTGCATAAAGGAC
TCTGATGTCAAAATGGAAACCAGGGGACTTACCTTTTCACATGACTTACCCCTCATCCGAGTGTGAGGTTACAAGCAGGTGTCATGGCAG
GAAGGAAGACCAGATCTGTATGATTTGTTCCATTTTTAATAACAAAAATATCCACACCCTTTTAATAATGCTCAGTTCTGTAGGCTCTCT
ATCCTAGAGGAATTGAGCAAAACAGAAGAATCATGAAGTCTCCTACCTTCTACAGCCTTGTAGTTCTGCTTACCTTCTCTTCCTCATCCA
GAAAGCATCATTTTCTAGGGAGAACAATGAGAATCTCAATGCCAGTAGTACTGGATAATAGTGCGTATTGCTTCTGGTGGCATTACCCTG
ATGATGGGCTGAAGTTCATTTATTAGGGTGGTTCCTGATGGGAAAAGGACATGGATTAGGACTTTAAAACACTGGACAGAATTTCCCACA
GTCTTTGCCCTCAAGGAGTTCACCAGTTTATGGGGCTAGAAGAGCGAGAAAATTCAAGAAAATAAATGTAGCTGGTGGGAGACTTTGTAG
ATGTTGGGCTATATGTTGGGGTGATGGTAGCTCCTGATGTAATTTTCTTAGTTGCATCTTCAATATGCCTGGAGTCGTCTGTCCAAGGCT
TGTCCAGGCTTCTGGGTTTCTCTCAAGTTTGTTTTTCTCAGGATATTGTCCTGGCCCAGCTACTCCTTTACCTGTGAGAAGATCTTCACC
ATTAGGAAGATCTCTAGACCCCCAGATCTCAGAATCAGGCCTATTTGTGTAGGCCCATGGAAATCACTACTTGTGAAGTAGAGATGCCTT
TTTGTCTAAATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCC
CTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGAC
TGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGC
TTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACA
GCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGC
ACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCT
GCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAG

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000518864_chr8_51503439_+_2197nt
AAGCAGAATGTGATTTGCTTGAAGATATGAGTGGGGGCCCCTGAAGCCACTGATGGAAGCCACACTACCGGGGCATCGGACCATGAACCC
CTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCACAGAGCGTCAACAGATTGTGTC
AGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGGAGTGAGGTGAGGGACTTGACTGAGGAGGTCAT
TGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACTGGTCATCCCTGCGTA
TACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCTCATTCTCTGATGATCTACAGTGATGACCTAGG
GGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGGCCACCCTGT
GCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGACCATGGTGAAGGCTTTCAGAGACTGGCCCTGAG
TCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGACTCTAG
CAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGGAGGAAGCTGGAACACCGTCAGAATCATGGCT
CTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCG
CCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAATGTGG
GACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGG
TAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGATGCAAATGGCAGTTACAGACAGGTTAACAGAAG
CTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCACTTTTCCTCCTCCAAAGAGCAAAATGAAAATTT
TGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTGGTCCTGGCTCTGCCACTGGCTTGCTTTTGGAC
CTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTATTGGTTCTAAGATTTCTCATCTTCTCATCCCT
AGGACAAGCATAGATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGA
CCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTG
GGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACA
GTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCA
GACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTT
CAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGG
CAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCT
TCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAG

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000522124_chr8_51503439_+_3486nt
AAGCAGAATGTGATTTGCTTGAAGATATGAGTGGGGGCCCCTGAAGCCACTGATGGAAGCCACACTACCGGGGCATCGGACCATGAACCC
CTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCACAGAGCGTCAACAGATTGTGTC
AGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGGAGTGAGGTGAGGGACTTGACTGAGGAGGTCAT
TGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACTGGTCATCCCTGCGTA
TACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCTCATTCTCTGATGATCTACAGTGATGACCTAGG
GGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGGCCACCCTGT
GCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGACCATGGTGAAGGCTTTCAGAGACTGGCCCTGAG
TCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGACTCTAG
CAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGGAGGAAGCTGGAACACCGTCAGAATCATGGCT
CTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCG
CCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAATGTGG
GACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGG
TAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGATGCAAATGGCAGTTACAGACAGGTTAACAGAAG
CTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCACTTTTCCTCCTCCAAAGAGCAAAATGAAAATTT
TGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTGGTCCTGGCTCTGCCACTGGCTTGCTTTTGGAC
CTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTATTGGTTCTAAGATTTCTCATCTTCTCATCCCT
AGGACAAGCATAGATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGA
CCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTG
GGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACA
GTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCA
GACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTT
CAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGG
CAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCT
TCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAG
CTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGACATACTGAACTCTTCATTGACACACCCCATGACTGTATAAGCAGGACACATTT
ACTCATCATTTTAGACCCTAGAGAAACCATAACATCACCAAGTCGACAGTGGAGGCAAATCAAAATTTCGGCAGAAAAAGAAGGTCATGT
GGAACCTCAAAAACACTTCTATTCTGGATGACATCTGTGAAATATACTACATGAACAGAACAGCTTGTTCTCACTCAGTTGCTTTGTACC
AGTAAGTGTATTGCTTTCACCAAAAGTGGAGACAAAAGAATAAATTATTTGAAGAAGTATGTAAATAACATAAAAATAGTAAGCTACCTA
TGAATAAAAATACTTATTAAATGATTACTTCTGTATTTTAGATTATTTTGTATGACTAGTACATGTTGGGCAGAGTCATAGGAAAACAAA
TGCCCTATCTTGTATTATGAGGGACATAAAAGAGTTAAAAACCATAAATCAGCAAGGAGCATGCAAAAAAATCTCATCAAAGAAGGATGC
ACTTTAATTTGCTGATGTAAATTTGCCCTTGTGTTCTCATCCCATGATTTGACACTGGCATTCCAATTGTTTTTATCTTATTGTAAATAT
TCCGAAGAACTTCCAAAGGATAATTACATTGACCCATGATAGATACAATGTGAAATGGACTATTCTCCCTTGGATCACTGTTATTGAAAT
GTCTTATTAGCTGCCAAAGTCAATCAAATATGCCAACAGTGTATTAATTTAATTATGAGTGATGGAAAATTTCATGAACCTCTCATTTCT
TCCTTGGTTTGAAAGAGATTTGTATTTTACCTAATAAGATTTATTATCAAATTAAAGTTTCATAAATTTTCAGTGAACCCAAAACCTTTT
GTAGAGAAAATAATATAAACAAATATGGTGTGAGAAACAATTCTTTGTAATCCGAAGTCTACTAGTTAATCATGAACTAAAATGTCCCCC
GAAAACAGTCCCAAAGCTATTATAGATGTTAATTAAATGACATTTTTTCATTTTAGTACTATTTTATGAGAAACAAAGGTGATATTTAAA
GATAAAAGTTAAAATTCTTTAACCTCCCTTGTCATGGAAAGTGATTAAGTAATGCCAACTATGCAGGTTGTTTTAGGTATTTTGTCCTAA
GAATGTAAATGTGAAAGGCTGGGAAATTTGAAAGCCTTAGAGGTGTGCAATTTACTCAGATTCCAGGTATTATTCAACTAGTTGTATAAC

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000517473_chr8_51503439_+_2124nt
AAGCAGAATGTGATTTGCTTGAAGATATGAGTGGGGGCCCCTGAAGCCACTGATGGAAGCCACACTACCGGGGCATCGGACCATGAACCC
CTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCACAGAGCGTCAACAGATTGTGTC
AGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGGAGTGAGGTGAGGGACTTGACTGAGGAGGTCAT
TGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACTGGTCATCCCTGCGTA
TACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCTCATTCTCTGATGATCTACAGTGATGACCTAGG
GGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGGCCACCCTGT
GCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGACCATGGTGAAGGCTTTCAGAGACTGGCCCTGAG
TCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGACTCTAG
CAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGGAGGAAGCTGGAACACCGTCAGAATCATGGCT
CTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCG
CCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAATGTGG
GACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGG
TAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGATGCAAATGGCAGTTACAGACAGGTTAACAGAAG
CTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCACTTTTCCTCCTCCAAAGAGCAAAATGAAAATTT
TGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTGGTCCTGGCTCTGCCACTGGCTTGCTTTTGGAC
CTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTATTGGTTCTAAGATTTCTCATCTTCTCATCCCT
AGGACAAGCATAGATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGA
CCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTG
GGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACA
GTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCA
GACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTT
CAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTT
TGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGC

>In-frame_NEU3_ENST00000545272_chr11_74716670_+_SNTG1_ENST00000276467_chr8_51503439_+_2122nt
AAGCAGAATGTGATTTGCTTGAAGATATGAGTGGGGGCCCCTGAAGCCACTGATGGAAGCCACACTACCGGGGCATCGGACCATGAACCC
CTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCACAGAGCGTCAACAGATTGTGTC
AGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGGAGTGAGGTGAGGGACTTGACTGAGGAGGTCAT
TGGCTCAGAGCTGAAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACTGGTCATCCCTGCGTA
TACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCTCATTCTCTGATGATCTACAGTGATGACCTAGG
GGTCACATGGCACCATGGTAGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGGCCACCCTGT
GCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGACCATGGTGAAGGCTTTCAGAGACTGGCCCTGAG
TCGACAGCTCTGTGAGCCCCCACATGGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGACTCTAG
CAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGGAGGAAGCTGGAACACCGTCAGAATCATGGCT
CTTGTACTCACACCCAACCAGTAGGAAACAGAGGGTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCG
CCCCTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGCTTGTTTGGGTGTTTGTTTGAATGTGG
GACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGG
TAGGAACCCAAGCCAATTCAAAAGCAATTAATTGGCTTAGGACCCAATTTCCATAGATGCAAATGGCAGTTACAGACAGGTTAACAGAAG
CTACTGAAGTCTACAGATAATCAAAAAACTTAATATTCTGTTCCCTACCTTTTTTCACTTTTCCTCCTCCAAAGAGCAAAATGAAAATTT
TGCCTTAGCTACTGCAGTGGAAAGAGCACTGAACTAGGAGTTGGAAGACAAGGATGTGGTCCTGGCTCTGCCACTGGCTTGCTTTTGGAC
CTTGGATGTGTCACCTGAACTCTCTGGACCTCAGGTTTCCATCTGTAAAATGAGAGTATTGGTTCTAAGATTTCTCATCTTCTCATCCCT
AGGACAAGCATAGATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGA
CCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTG
GGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACA
GTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCA
GACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTT
CAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTT
TGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGC


Top

FusionGenePPI for NEU3_SNTG1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NEU3GRB2, CAV1, KLK11, KLK5, PLA2G10, ALOX5SNTG1SNAP23, STXBP3, VPS45, UBC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NEU3_SNTG1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NEU3_SNTG1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource