FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24006

FusionGeneSummary for NEK3_GXYLT2

check button Fusion gene summary
Fusion gene informationFusion gene name: NEK3_GXYLT2
Fusion gene ID: 24006
HgeneTgene
Gene symbol

NEK3

GXYLT2

Gene ID

4752

727936

Gene nameNIMA related kinase 3glucoside xylosyltransferase 2
SynonymsHSPK36GLT8D4
Cytomap

13q14.3

3p13

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase Nek3HSPK 36NIMA (never in mitosis gene a)-related kinase 3glycogen synthase A kinasehydroxyalkyl-protein kinasenever in mitosis A-related kinase 3nimA-related protein kinase 3phosphorylase B kinase kinaseglucoside xylosyltransferase 2glycosyltransferase 8 domain containing 4glycosyltransferase 8 domain-containing protein 4
Modification date2018051920180519
UniProtAcc

P51956

A0PJZ3

Ensembl transtripts involved in fusion geneENST00000378101, ENST00000339406, 
ENST00000452082, ENST00000400357, 
ENST00000389617, 
Fusion gene scores* DoF score1 X 1 X 1=15 X 3 X 4=60
# samples 15
** MAII scorelog2(1/1*10)=3.32192809488736log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NEK3 [Title/Abstract] AND GXYLT2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneGXYLT2

GO:0016266

O-glycan processing

19940119


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EB-A44R-06ANEK3chr13

52722550

-GXYLT2chr3

73006380

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000378101ENST00000389617NEK3chr13

52722550

-GXYLT2chr3

73006380

+
In-frameENST00000339406ENST00000389617NEK3chr13

52722550

-GXYLT2chr3

73006380

+
In-frameENST00000452082ENST00000389617NEK3chr13

52722550

-GXYLT2chr3

73006380

+
In-frameENST00000400357ENST00000389617NEK3chr13

52722550

-GXYLT2chr3

73006380

+

Top

FusionProtFeatures for NEK3_GXYLT2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NEK3

P51956

GXYLT2

A0PJZ3

Protein kinase which influences neuronal morphogenesisand polarity through effects on microtubules. Regulatesmicrotubule acetylation in neurons. Contributes to prolactin-mediated phosphorylation of PXN and VAV2. Implicated in prolactin-mediated cytoskeletal reorganization and motility of breast cancercells through mechanisms involving RAC1 activation andphosphorylation of PXN and VAV2. {ECO:0000269|PubMed:15618286,ECO:0000269|PubMed:17297458}. Glycosyltransferase which elongates the O-linked glucoseattached to EGF-like repeats in the extracellular domain of Notchproteins by catalyzing the addition of xylose.{ECO:0000269|PubMed:19940119}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNEK3chr13:52722550chr3:73006380ENST00000400357-71410_18201490Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNEK3chr13:52722550chr3:73006380ENST00000400357-7144_257201490DomainProtein kinase
TgeneGXYLT2chr13:52722550chr3:73006380ENST00000389617+3768_98284444Compositional biasNote=Arg-rich
TgeneGXYLT2chr13:52722550chr3:73006380ENST00000389617+371_4284444Topological domainCytoplasmic
TgeneGXYLT2chr13:52722550chr3:73006380ENST00000389617+3726_443284444Topological domainLumenal
TgeneGXYLT2chr13:52722550chr3:73006380ENST00000389617+375_25284444TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for NEK3_GXYLT2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NEK3_ENST00000378101_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_361aa
MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFEAEGHLTIVMEYCDGGDLMQK
IKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTTVGTPTTVPPEIWENLPTN
NKSDIWSLGCILTELCTLKHPNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFTFNPECLTVFPCQWNYRPDHCMYGSNCREAEH
EGVSVLHGNRGVYHDDKQPTFRALTEAIRDFPFQDNLFQSMTYPLQLKFLETVHTLCGRIPQVFLKQIEKTMKRATEKHVIIHVGPNQMH

>In-frame_NEK3_ENST00000339406_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_361aa
MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFEAEGHLTIVMEYCDGGDLMQK
IKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTTVGTPTTVPPEIWENLPTN
NKSDIWSLGCILTELCTLKHPNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFTFNPECLTVFPCQWNYRPDHCMYGSNCREAEH
EGVSVLHGNRGVYHDDKQPTFRALTEAIRDFPFQDNLFQSMTYPLQLKFLETVHTLCGRIPQVFLKQIEKTMKRATEKHVIIHVGPNQMH

>In-frame_NEK3_ENST00000452082_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_382aa
MQFGRAHGDCVSGAQLCGCPSMDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESF
EAEGHLTIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFA
CTTVGTPTTVPPEIWENLPTNNKSDIWSLGCILTELCTLKHPNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFTFNPECLTVFP
CQWNYRPDHCMYGSNCREAEHEGVSVLHGNRGVYHDDKQPTFRALTEAIRDFPFQDNLFQSMTYPLQLKFLETVHTLCGRIPQVFLKQIE

>In-frame_NEK3_ENST00000400357_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_361aa
MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFEAEGHLTIVMEYCDGGDLMQK
IKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTTVGTPTTVPPEIWENLPTN
NKSDIWSLGCILTELCTLKHPNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFTFNPECLTVFPCQWNYRPDHCMYGSNCREAEH
EGVSVLHGNRGVYHDDKQPTFRALTEAIRDFPFQDNLFQSMTYPLQLKFLETVHTLCGRIPQVFLKQIEKTMKRATEKHVIIHVGPNQMH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NEK3_ENST00000378101_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_1083nt
ATGGATGACTACATGGTCCTGAGAATGATTGGGGAGGGCTCCTTCGGCAGAGCTCTTTTGGTTCAGCATGAAAGCAGTAATCAGATGTTT
GCCATGAAAGAAATAAGGCTTCCCAAGTCTTTCTCTAATACACAGAATTCTAGGAAGGAGGCTGTTCTTTTAGCCAAAATGAAACACCCT
AATATTGTTGCCTTCAAAGAATCATTTGAAGCTGAAGGACACTTGTATATTGTGATGGAATACTGTGATGGAGGGGATCTAATGCAAAAG
ATTAAACAGCAGAAAGGAAAGTTATTTCCTGAAGACATGATACTTAATTGGTTTACCCAAATGTGCCTTGGAGTAAATCACATTCACAAG
AAACGTGTGCTACACAGAGATATCAAGTCCAAGAATATCTTCCTCACTCAGAATGGAAAAGTGAAATTGGGAGACTTTGGATCTGCCCGT
CTTCTCTCCAATCCGATGGCATTTGCTTGTACCTATGTGGGAACTCCTTATTATGTGCCTCCAGAAATTTGGGAAAACCTGCCTTATAAC
AATAAAAGTGACATCTGGTCCTTGGGTTGCATCCTGTATGAACTCTGTACCCTTAAGCATCCAAACAGCATGATTCCAACAGGCCTGGCT
TGGGAGGACATGTTGTACCCTCTGTACCAGAAGTACAAGAATGCCATCACGTGGGGAGACCAGGATTTATTAAATATTATTTTTTATTTC
AACCCAGAGTGTCTCTATGTATTCCCCTGCCAGTGGAACTACCGTCCCGATCACTGCATGTACGGAAGCAACTGCAGAGAGGCTGAGCAT
GAAGGTGTGTCTGTTCTGCATGGAAACCGAGGCGTCTACCATGACGATAAGCAACCAACGTTCAGAGCACTCTATGAAGCAATACGGGAT
TTTCCCTTTCAAGACAATCTCTTTCAATCCATGTATTACCCCCTTCAGCTGAAGTTTTTGGAGACTGTGCACACTTTATGTGGACGAATC
CCGCAAGTTTTTCTGAAGCAAATTGAGAAAACAATGAAAAGGGCTTATGAGAAACACGTCATCATCCATGTTGGCCCCAACCAGATGCAC

>In-frame_NEK3_ENST00000339406_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_1083nt
ATGGATGACTACATGGTCCTGAGAATGATTGGGGAGGGCTCCTTCGGCAGAGCTCTTTTGGTTCAGCATGAAAGCAGTAATCAGATGTTT
GCCATGAAAGAAATAAGGCTTCCCAAGTCTTTCTCTAATACACAGAATTCTAGGAAGGAGGCTGTTCTTTTAGCCAAAATGAAACACCCT
AATATTGTTGCCTTCAAAGAATCATTTGAAGCTGAAGGACACTTGTATATTGTGATGGAATACTGTGATGGAGGGGATCTAATGCAAAAG
ATTAAACAGCAGAAAGGAAAGTTATTTCCTGAAGACATGATACTTAATTGGTTTACCCAAATGTGCCTTGGAGTAAATCACATTCACAAG
AAACGTGTGCTACACAGAGATATCAAGTCCAAGAATATCTTCCTCACTCAGAATGGAAAAGTGAAATTGGGAGACTTTGGATCTGCCCGT
CTTCTCTCCAATCCGATGGCATTTGCTTGTACCTATGTGGGAACTCCTTATTATGTGCCTCCAGAAATTTGGGAAAACCTGCCTTATAAC
AATAAAAGTGACATCTGGTCCTTGGGTTGCATCCTGTATGAACTCTGTACCCTTAAGCATCCAAACAGCATGATTCCAACAGGCCTGGCT
TGGGAGGACATGTTGTACCCTCTGTACCAGAAGTACAAGAATGCCATCACGTGGGGAGACCAGGATTTATTAAATATTATTTTTTATTTC
AACCCAGAGTGTCTCTATGTATTCCCCTGCCAGTGGAACTACCGTCCCGATCACTGCATGTACGGAAGCAACTGCAGAGAGGCTGAGCAT
GAAGGTGTGTCTGTTCTGCATGGAAACCGAGGCGTCTACCATGACGATAAGCAACCAACGTTCAGAGCACTCTATGAAGCAATACGGGAT
TTTCCCTTTCAAGACAATCTCTTTCAATCCATGTATTACCCCCTTCAGCTGAAGTTTTTGGAGACTGTGCACACTTTATGTGGACGAATC
CCGCAAGTTTTTCTGAAGCAAATTGAGAAAACAATGAAAAGGGCTTATGAGAAACACGTCATCATCCATGTTGGCCCCAACCAGATGCAC

>In-frame_NEK3_ENST00000452082_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_1146nt
ATGCAGTTTGGGAGAGCCCATGGTGACTGCGTGAGTGGAGCCCAGCTGTGTGGATGCCCCAGCATGGATGACTACATGGTCCTGAGAATG
ATTGGGGAGGGCTCCTTCGGCAGAGCTCTTTTGGTTCAGCATGAAAGCAGTAATCAGATGTTTGCCATGAAAGAAATAAGGCTTCCCAAG
TCTTTCTCTAATACACAGAATTCTAGGAAGGAGGCTGTTCTTTTAGCCAAAATGAAACACCCTAATATTGTTGCCTTCAAAGAATCATTT
GAAGCTGAAGGACACTTGTATATTGTGATGGAATACTGTGATGGAGGGGATCTAATGCAAAAGATTAAACAGCAGAAAGGAAAGTTATTT
CCTGAAGACATGATACTTAATTGGTTTACCCAAATGTGCCTTGGAGTAAATCACATTCACAAGAAACGTGTGCTACACAGAGATATCAAG
TCCAAGAATATCTTCCTCACTCAGAATGGAAAAGTGAAATTGGGAGACTTTGGATCTGCCCGTCTTCTCTCCAATCCGATGGCATTTGCT
TGTACCTATGTGGGAACTCCTTATTATGTGCCTCCAGAAATTTGGGAAAACCTGCCTTATAACAATAAAAGTGACATCTGGTCCTTGGGT
TGCATCCTGTATGAACTCTGTACCCTTAAGCATCCAAACAGCATGATTCCAACAGGCCTGGCTTGGGAGGACATGTTGTACCCTCTGTAC
CAGAAGTACAAGAATGCCATCACGTGGGGAGACCAGGATTTATTAAATATTATTTTTTATTTCAACCCAGAGTGTCTCTATGTATTCCCC
TGCCAGTGGAACTACCGTCCCGATCACTGCATGTACGGAAGCAACTGCAGAGAGGCTGAGCATGAAGGTGTGTCTGTTCTGCATGGAAAC
CGAGGCGTCTACCATGACGATAAGCAACCAACGTTCAGAGCACTCTATGAAGCAATACGGGATTTTCCCTTTCAAGACAATCTCTTTCAA
TCCATGTATTACCCCCTTCAGCTGAAGTTTTTGGAGACTGTGCACACTTTATGTGGACGAATCCCGCAAGTTTTTCTGAAGCAAATTGAG

>In-frame_NEK3_ENST00000400357_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_1083nt
ATGGATGACTACATGGTCCTGAGAATGATTGGGGAGGGCTCCTTCGGCAGAGCTCTTTTGGTTCAGCATGAAAGCAGTAATCAGATGTTT
GCCATGAAAGAAATAAGGCTTCCCAAGTCTTTCTCTAATACACAGAATTCTAGGAAGGAGGCTGTTCTTTTAGCCAAAATGAAACACCCT
AATATTGTTGCCTTCAAAGAATCATTTGAAGCTGAAGGACACTTGTATATTGTGATGGAATACTGTGATGGAGGGGATCTAATGCAAAAG
ATTAAACAGCAGAAAGGAAAGTTATTTCCTGAAGACATGATACTTAATTGGTTTACCCAAATGTGCCTTGGAGTAAATCACATTCACAAG
AAACGTGTGCTACACAGAGATATCAAGTCCAAGAATATCTTCCTCACTCAGAATGGAAAAGTGAAATTGGGAGACTTTGGATCTGCCCGT
CTTCTCTCCAATCCGATGGCATTTGCTTGTACCTATGTGGGAACTCCTTATTATGTGCCTCCAGAAATTTGGGAAAACCTGCCTTATAAC
AATAAAAGTGACATCTGGTCCTTGGGTTGCATCCTGTATGAACTCTGTACCCTTAAGCATCCAAACAGCATGATTCCAACAGGCCTGGCT
TGGGAGGACATGTTGTACCCTCTGTACCAGAAGTACAAGAATGCCATCACGTGGGGAGACCAGGATTTATTAAATATTATTTTTTATTTC
AACCCAGAGTGTCTCTATGTATTCCCCTGCCAGTGGAACTACCGTCCCGATCACTGCATGTACGGAAGCAACTGCAGAGAGGCTGAGCAT
GAAGGTGTGTCTGTTCTGCATGGAAACCGAGGCGTCTACCATGACGATAAGCAACCAACGTTCAGAGCACTCTATGAAGCAATACGGGAT
TTTCCCTTTCAAGACAATCTCTTTCAATCCATGTATTACCCCCTTCAGCTGAAGTTTTTGGAGACTGTGCACACTTTATGTGGACGAATC
CCGCAAGTTTTTCTGAAGCAAATTGAGAAAACAATGAAAAGGGCTTATGAGAAACACGTCATCATCCATGTTGGCCCCAACCAGATGCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NEK3_ENST00000378101_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_3085nt
CGCCGCCTTGGGGTCTGGGCGCGCGGTGCCGTGGGGGTCAGCAGGGCGGAGCGGCTTTTCCAGGAGAAAGGGCCCTCACGGGTGAGCGGG
GCGACTGGGCTCCCCCGCGGTGCAGTTGCCCCGCGGGCGCCGGCCCCGGCTCAACGGATTCTTCTCGCTCGCTGCCCGGAAAGAACCATT
TGGGAGAGCCCATGGTGACTGCGTGAGTGGAGCCCAGCTGTGTGGATGCCCCAGCATGGATGACTACATGGTCCTGAGAATGATTGGGGA
GGGCTCCTTCGGCAGAGCTCTTTTGGTTCAGCATGAAAGCAGTAATCAGATGTTTGCCATGAAAGAAATAAGGCTTCCCAAGTCTTTCTC
TAATACACAGAATTCTAGGAAGGAGGCTGTTCTTTTAGCCAAAATGAAACACCCTAATATTGTTGCCTTCAAAGAATCATTTGAAGCTGA
AGGACACTTGTATATTGTGATGGAATACTGTGATGGAGGGGATCTAATGCAAAAGATTAAACAGCAGAAAGGAAAGTTATTTCCTGAAGA
CATGATACTTAATTGGTTTACCCAAATGTGCCTTGGAGTAAATCACATTCACAAGAAACGTGTGCTACACAGAGATATCAAGTCCAAGAA
TATCTTCCTCACTCAGAATGGAAAAGTGAAATTGGGAGACTTTGGATCTGCCCGTCTTCTCTCCAATCCGATGGCATTTGCTTGTACCTA
TGTGGGAACTCCTTATTATGTGCCTCCAGAAATTTGGGAAAACCTGCCTTATAACAATAAAAGTGACATCTGGTCCTTGGGTTGCATCCT
GTATGAACTCTGTACCCTTAAGCATCCAAACAGCATGATTCCAACAGGCCTGGCTTGGGAGGACATGTTGTACCCTCTGTACCAGAAGTA
CAAGAATGCCATCACGTGGGGAGACCAGGATTTATTAAATATTATTTTTTATTTCAACCCAGAGTGTCTCTATGTATTCCCCTGCCAGTG
GAACTACCGTCCCGATCACTGCATGTACGGAAGCAACTGCAGAGAGGCTGAGCATGAAGGTGTGTCTGTTCTGCATGGAAACCGAGGCGT
CTACCATGACGATAAGCAACCAACGTTCAGAGCACTCTATGAAGCAATACGGGATTTTCCCTTTCAAGACAATCTCTTTCAATCCATGTA
TTACCCCCTTCAGCTGAAGTTTTTGGAGACTGTGCACACTTTATGTGGACGAATCCCGCAAGTTTTTCTGAAGCAAATTGAGAAAACAAT
GAAAAGGGCTTATGAGAAACACGTCATCATCCATGTTGGCCCCAACCAGATGCACTGAATATTTTGTCTTGTTGCAAGTCAATTAGGTGT
CTTGTGACCAAGGAAATACTAATCTCTAAGCTGCCTGGGTCTTTTTGTGTGAATATTTAATGGTGCTCCATGACTGTTGAGTTTTAAAAA
CCTCGTTAAATTTTGCCAAATCAGTTGCCCCCAAAAGGGAATATGCTTTTCCTTATTTTTTTTTCTAAAATGCTATTTATCTCTAAGGAA
AAAAAAAAAAGACTATTACTCATTTAACATTGTTTAAGCAGGTTGAGCTAGCTGTGAAAATAGCTTTTGTGAGCCTTCTAATTCCTAAAC
GTCTGAGACCATTTCAGTGGCACCTGAGGTGTTATATTGATCTAGCATTCCTGAGACTCTTTCTATGCAACTGACTCCCCCACACCCGTG
TTATAAAAGTAATACACACTTTTGAAACAGAGAGACACACTTGTAGAGCATATGGGTCAAGGGCTCAACATCAAGATTAGATTAGCCATA
ATCCTATTGACCAGTGGAAAAGATTGTTTCCATTTTAAAGCAGTTCCTTACAACCTTTTTTCTCTACTTTTGCATTTTCCACTCTAACAC
ACATCTAAAACAGGTAATCTCAGTAAAAGCTGGCCTTTTTGCTGAGATTTTTATGTGGGAGACTAAAATATTAGATGAGATGATTATGTG
TACAGAATTTTATTTAAAATACATCTGAGAGAATCATTCAGATACTTGGGTAGTGTTAAAGGATGAAGCATGTATCTGGGGGTATTTCTT
CTTTTTCTTTCTTTCTTTTTTTTTTTTTTTTTTTTTTTGAGACGGAATCTCACTCTGTAGCCCAGGCTAGAATGCAGTGGCAGGATCTCG
GCTCACTGCAGCTTCCACCTCCTGGGTTCAAGTGATTCTCATGCCTCAGCCTCCCCAGTAGCTGGGATTACAAGTGTGTGCCACCACACC
CGGCTAATTTTTGTATTTTTAGTAGAGACACGGTTTTACCATGTTGGCCAGGCTGGTCTTGATCTCCAGACCTCAAGTGATCTGCCTGCC
TCAGCCTCCCAAAGTGCTGGGATTACAAGTGTGAGCCACTGCACTCAGCCAATCTGGGAGTATTTCTAAAGAAAAAAATTACTTTGATTT
GTGGAGGACTAAATCATAATACATTTCTATGCAACAATAGCTTCTGAGAGGAAATTCAGGAATGTTTGTGTTTACCACAGACAAAAACAT
TTGATCTGTTAATCATCAGTAGCTGTGGTCATCTCTCTTTCTTAAACTCTTGGGCAATGGGTGGAAATCAGAGACCAACTTCAAATTTAA
TGTGTAAAAAACAAATAGTTCAGCTGCTTCTATTGGTAAGAAAATTCAACTTCCTACCAGCCTTAGAAAGGTCTCTTTAAACAATTTCTT
TCCCCCTAGGGTTACCTAGCTGGTCCATACAGGTTTTATCACCTCACTGCAAGGAGGAAGTTGAATATTCTGTTCCCCACGGGGATCTGG
CTTAATCCCTAGTTGCTCATATAGTTGGTATCAGCATAGCAATATTTTGCATAATGCTTTATTTTTCTCAAATGACTATTGCATAGATGA
TCTTGATATTTGCAACAGCCTAGTGGATTTGGTAGGGTCCTGAATCATCTCTATAAGGCAAACAAGGAAATTGTAACACAAAGAAATAAA
CATATTGAATATAATTGCTATTCTGTAAGACATACAGTCTGTGTAAGATGTATCTTATTTACAGAGACATTTTTGAAAATTAAAATATTA

>In-frame_NEK3_ENST00000339406_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_3226nt
CACATAGCTAGTAAGTTCTAGCTAGCACTGAGTGCTGTGCCCGTGAAATTTATCTACATAGGCTTTCACTTAACCTGCAGACAGAACTCA
GTTAGTCGGGGACAATTTCCCTCAATGTTAACAGCACTGTTCCACCGCAACGTGGAACAACAGCTTTAAAACGTGCTCTTCGTAGGCCCG
GCTACTCCAAGAACAGTGCCTCCCGCCAGACCCAGGCGGCTTCCTTCACCCGCAACCCGAGAGACGACCCGCCGGGCCCGCCCCGCGGAA
GCCGCCGGTTGCCAGGCCAAGGAGTGGACTAGGGTCGCCGGGGAAGCGGTTTGGGAGAGCCCATGGTGACTGCGTGAGTGGAGCCCAGCT
GTGTGGATGCCCCAGCATGGATGACTACATGGTCCTGAGAATGATTGGGGAGGGCTCCTTCGGCAGAGCTCTTTTGGTTCAGCATGAAAG
CAGTAATCAGATGTTTGCCATGAAAGAAATAAGGCTTCCCAAGTCTTTCTCTAATACACAGAATTCTAGGAAGGAGGCTGTTCTTTTAGC
CAAAATGAAACACCCTAATATTGTTGCCTTCAAAGAATCATTTGAAGCTGAAGGACACTTGTATATTGTGATGGAATACTGTGATGGAGG
GGATCTAATGCAAAAGATTAAACAGCAGAAAGGAAAGTTATTTCCTGAAGACATGATACTTAATTGGTTTACCCAAATGTGCCTTGGAGT
AAATCACATTCACAAGAAACGTGTGCTACACAGAGATATCAAGTCCAAGAATATCTTCCTCACTCAGAATGGAAAAGTGAAATTGGGAGA
CTTTGGATCTGCCCGTCTTCTCTCCAATCCGATGGCATTTGCTTGTACCTATGTGGGAACTCCTTATTATGTGCCTCCAGAAATTTGGGA
AAACCTGCCTTATAACAATAAAAGTGACATCTGGTCCTTGGGTTGCATCCTGTATGAACTCTGTACCCTTAAGCATCCAAACAGCATGAT
TCCAACAGGCCTGGCTTGGGAGGACATGTTGTACCCTCTGTACCAGAAGTACAAGAATGCCATCACGTGGGGAGACCAGGATTTATTAAA
TATTATTTTTTATTTCAACCCAGAGTGTCTCTATGTATTCCCCTGCCAGTGGAACTACCGTCCCGATCACTGCATGTACGGAAGCAACTG
CAGAGAGGCTGAGCATGAAGGTGTGTCTGTTCTGCATGGAAACCGAGGCGTCTACCATGACGATAAGCAACCAACGTTCAGAGCACTCTA
TGAAGCAATACGGGATTTTCCCTTTCAAGACAATCTCTTTCAATCCATGTATTACCCCCTTCAGCTGAAGTTTTTGGAGACTGTGCACAC
TTTATGTGGACGAATCCCGCAAGTTTTTCTGAAGCAAATTGAGAAAACAATGAAAAGGGCTTATGAGAAACACGTCATCATCCATGTTGG
CCCCAACCAGATGCACTGAATATTTTGTCTTGTTGCAAGTCAATTAGGTGTCTTGTGACCAAGGAAATACTAATCTCTAAGCTGCCTGGG
TCTTTTTGTGTGAATATTTAATGGTGCTCCATGACTGTTGAGTTTTAAAAACCTCGTTAAATTTTGCCAAATCAGTTGCCCCCAAAAGGG
AATATGCTTTTCCTTATTTTTTTTTCTAAAATGCTATTTATCTCTAAGGAAAAAAAAAAAAGACTATTACTCATTTAACATTGTTTAAGC
AGGTTGAGCTAGCTGTGAAAATAGCTTTTGTGAGCCTTCTAATTCCTAAACGTCTGAGACCATTTCAGTGGCACCTGAGGTGTTATATTG
ATCTAGCATTCCTGAGACTCTTTCTATGCAACTGACTCCCCCACACCCGTGTTATAAAAGTAATACACACTTTTGAAACAGAGAGACACA
CTTGTAGAGCATATGGGTCAAGGGCTCAACATCAAGATTAGATTAGCCATAATCCTATTGACCAGTGGAAAAGATTGTTTCCATTTTAAA
GCAGTTCCTTACAACCTTTTTTCTCTACTTTTGCATTTTCCACTCTAACACACATCTAAAACAGGTAATCTCAGTAAAAGCTGGCCTTTT
TGCTGAGATTTTTATGTGGGAGACTAAAATATTAGATGAGATGATTATGTGTACAGAATTTTATTTAAAATACATCTGAGAGAATCATTC
AGATACTTGGGTAGTGTTAAAGGATGAAGCATGTATCTGGGGGTATTTCTTCTTTTTCTTTCTTTCTTTTTTTTTTTTTTTTTTTTTTTG
AGACGGAATCTCACTCTGTAGCCCAGGCTAGAATGCAGTGGCAGGATCTCGGCTCACTGCAGCTTCCACCTCCTGGGTTCAAGTGATTCT
CATGCCTCAGCCTCCCCAGTAGCTGGGATTACAAGTGTGTGCCACCACACCCGGCTAATTTTTGTATTTTTAGTAGAGACACGGTTTTAC
CATGTTGGCCAGGCTGGTCTTGATCTCCAGACCTCAAGTGATCTGCCTGCCTCAGCCTCCCAAAGTGCTGGGATTACAAGTGTGAGCCAC
TGCACTCAGCCAATCTGGGAGTATTTCTAAAGAAAAAAATTACTTTGATTTGTGGAGGACTAAATCATAATACATTTCTATGCAACAATA
GCTTCTGAGAGGAAATTCAGGAATGTTTGTGTTTACCACAGACAAAAACATTTGATCTGTTAATCATCAGTAGCTGTGGTCATCTCTCTT
TCTTAAACTCTTGGGCAATGGGTGGAAATCAGAGACCAACTTCAAATTTAATGTGTAAAAAACAAATAGTTCAGCTGCTTCTATTGGTAA
GAAAATTCAACTTCCTACCAGCCTTAGAAAGGTCTCTTTAAACAATTTCTTTCCCCCTAGGGTTACCTAGCTGGTCCATACAGGTTTTAT
CACCTCACTGCAAGGAGGAAGTTGAATATTCTGTTCCCCACGGGGATCTGGCTTAATCCCTAGTTGCTCATATAGTTGGTATCAGCATAG
CAATATTTTGCATAATGCTTTATTTTTCTCAAATGACTATTGCATAGATGATCTTGATATTTGCAACAGCCTAGTGGATTTGGTAGGGTC
CTGAATCATCTCTATAAGGCAAACAAGGAAATTGTAACACAAAGAAATAAACATATTGAATATAATTGCTATTCTGTAAGACATACAGTC

>In-frame_NEK3_ENST00000452082_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_4144nt
ATTGTGCCTTTCCTCTCTCAGGGAGTGCCAAGAAACCATCTGGTTCATGCCAGAAACTTGGGAGTCAACCTTGCCCCCTTCTCTGCTTGC
CCCCCATAAATCTGCCACCACAAATCCTGTCAACTGTTCTTACATCTTTCCTTCCCATTTTTTCTGACCCCATTGCCTCCACTCTATTCC
ATTTCATTATTTTCCTGCCTTTTCTATTGTTGGAGCCTCCTAACTGGCCTGTGTCTCTGAGCTGGCCTTCCTGCCCCTCCTCCACTGGTC
CATTTAATCTGCAATCTGAGTGAATGTTTTTTCTAATATGCAAATATGATTATATTGCCTTCTTGGTTAAAATGCTTCAGCAGCTTGTTA
CATTCTTCTTTCAATTTCTTGAACTGAATGTAATTTCTTTAGCTCTTAAATATGCAATTTCCTCTTCCTTGATTACTCTTTTCCTCCTCT
TTGTCTAGCCAAGTTTCATTCATCCTTCAGGCTTCAGCTTAAATAGCCTACATTTGTTGAGGTTTATGGTTATCTCTGCATGGGATGTCC
ACGTTGGCAGGGACTATGAGAGATTTTTCAGATTATAACATCTGACTCAGAGTTGGTGCTCAGTGTCTGCCTGTTGTATGTAGTATAGGG
GAGGAAAAACATTTTTTCTCTGCCCTCTTAGGTTCAGTAGCTGGGCCCTGCAAAATAAACTGATGAAAGATAGATTAACAGGAAAAAAGG
TTTATGCATAAATGTAAAGAAGTGGTTAGACCAGGGGGCTCATATGCCATTTTAACAAAGAGTGATAAATTATAGAGAAGTAACTAGACA
AAAGTAGGGGAATGCTTCTTGGGTAAATTGTAGGAAGGTAAATATATGGCGGAAGCTAACATAAGATAAGGGTTATTCAGTAAAGTTTGT
TATGTGGACTCAAGTTGGTGCCTTCCCCATTGGTAAGAGTTGCTCTCCTCTTCCTGGTACTGGAAAGGAAGACACATTTACAAATGGATA
TTTATTACCTGTACATAGGAAAATTTATGCCCTGCATTTATACAAAAAAGGGAGGGCAAAGAGCAAATTGGTTTCAGCTCAAAACAATTC
TTACATGAAAGTGGCATATTTTGGGGTAGCATACACTGATCCTCTTCAAAAGGAATAATTTGCTTTTCTCTTATCATGGTTATGAGAGCT
ACTTTGAATTAATTTTTGCTTTTTGAAAGTACATTTAATTCTCAAATGTTTCTGCTTTTGAATGCAGTTTGGGAGAGCCCATGGTGACTG
CGTGAGTGGAGCCCAGCTGTGTGGATGCCCCAGCATGGATGACTACATGGTCCTGAGAATGATTGGGGAGGGCTCCTTCGGCAGAGCTCT
TTTGGTTCAGCATGAAAGCAGTAATCAGATGTTTGCCATGAAAGAAATAAGGCTTCCCAAGTCTTTCTCTAATACACAGAATTCTAGGAA
GGAGGCTGTTCTTTTAGCCAAAATGAAACACCCTAATATTGTTGCCTTCAAAGAATCATTTGAAGCTGAAGGACACTTGTATATTGTGAT
GGAATACTGTGATGGAGGGGATCTAATGCAAAAGATTAAACAGCAGAAAGGAAAGTTATTTCCTGAAGACATGATACTTAATTGGTTTAC
CCAAATGTGCCTTGGAGTAAATCACATTCACAAGAAACGTGTGCTACACAGAGATATCAAGTCCAAGAATATCTTCCTCACTCAGAATGG
AAAAGTGAAATTGGGAGACTTTGGATCTGCCCGTCTTCTCTCCAATCCGATGGCATTTGCTTGTACCTATGTGGGAACTCCTTATTATGT
GCCTCCAGAAATTTGGGAAAACCTGCCTTATAACAATAAAAGTGACATCTGGTCCTTGGGTTGCATCCTGTATGAACTCTGTACCCTTAA
GCATCCAAACAGCATGATTCCAACAGGCCTGGCTTGGGAGGACATGTTGTACCCTCTGTACCAGAAGTACAAGAATGCCATCACGTGGGG
AGACCAGGATTTATTAAATATTATTTTTTATTTCAACCCAGAGTGTCTCTATGTATTCCCCTGCCAGTGGAACTACCGTCCCGATCACTG
CATGTACGGAAGCAACTGCAGAGAGGCTGAGCATGAAGGTGTGTCTGTTCTGCATGGAAACCGAGGCGTCTACCATGACGATAAGCAACC
AACGTTCAGAGCACTCTATGAAGCAATACGGGATTTTCCCTTTCAAGACAATCTCTTTCAATCCATGTATTACCCCCTTCAGCTGAAGTT
TTTGGAGACTGTGCACACTTTATGTGGACGAATCCCGCAAGTTTTTCTGAAGCAAATTGAGAAAACAATGAAAAGGGCTTATGAGAAACA
CGTCATCATCCATGTTGGCCCCAACCAGATGCACTGAATATTTTGTCTTGTTGCAAGTCAATTAGGTGTCTTGTGACCAAGGAAATACTA
ATCTCTAAGCTGCCTGGGTCTTTTTGTGTGAATATTTAATGGTGCTCCATGACTGTTGAGTTTTAAAAACCTCGTTAAATTTTGCCAAAT
CAGTTGCCCCCAAAAGGGAATATGCTTTTCCTTATTTTTTTTTCTAAAATGCTATTTATCTCTAAGGAAAAAAAAAAAAGACTATTACTC
ATTTAACATTGTTTAAGCAGGTTGAGCTAGCTGTGAAAATAGCTTTTGTGAGCCTTCTAATTCCTAAACGTCTGAGACCATTTCAGTGGC
ACCTGAGGTGTTATATTGATCTAGCATTCCTGAGACTCTTTCTATGCAACTGACTCCCCCACACCCGTGTTATAAAAGTAATACACACTT
TTGAAACAGAGAGACACACTTGTAGAGCATATGGGTCAAGGGCTCAACATCAAGATTAGATTAGCCATAATCCTATTGACCAGTGGAAAA
GATTGTTTCCATTTTAAAGCAGTTCCTTACAACCTTTTTTCTCTACTTTTGCATTTTCCACTCTAACACACATCTAAAACAGGTAATCTC
AGTAAAAGCTGGCCTTTTTGCTGAGATTTTTATGTGGGAGACTAAAATATTAGATGAGATGATTATGTGTACAGAATTTTATTTAAAATA
CATCTGAGAGAATCATTCAGATACTTGGGTAGTGTTAAAGGATGAAGCATGTATCTGGGGGTATTTCTTCTTTTTCTTTCTTTCTTTTTT
TTTTTTTTTTTTTTTTTGAGACGGAATCTCACTCTGTAGCCCAGGCTAGAATGCAGTGGCAGGATCTCGGCTCACTGCAGCTTCCACCTC
CTGGGTTCAAGTGATTCTCATGCCTCAGCCTCCCCAGTAGCTGGGATTACAAGTGTGTGCCACCACACCCGGCTAATTTTTGTATTTTTA
GTAGAGACACGGTTTTACCATGTTGGCCAGGCTGGTCTTGATCTCCAGACCTCAAGTGATCTGCCTGCCTCAGCCTCCCAAAGTGCTGGG
ATTACAAGTGTGAGCCACTGCACTCAGCCAATCTGGGAGTATTTCTAAAGAAAAAAATTACTTTGATTTGTGGAGGACTAAATCATAATA
CATTTCTATGCAACAATAGCTTCTGAGAGGAAATTCAGGAATGTTTGTGTTTACCACAGACAAAAACATTTGATCTGTTAATCATCAGTA
GCTGTGGTCATCTCTCTTTCTTAAACTCTTGGGCAATGGGTGGAAATCAGAGACCAACTTCAAATTTAATGTGTAAAAAACAAATAGTTC
AGCTGCTTCTATTGGTAAGAAAATTCAACTTCCTACCAGCCTTAGAAAGGTCTCTTTAAACAATTTCTTTCCCCCTAGGGTTACCTAGCT
GGTCCATACAGGTTTTATCACCTCACTGCAAGGAGGAAGTTGAATATTCTGTTCCCCACGGGGATCTGGCTTAATCCCTAGTTGCTCATA
TAGTTGGTATCAGCATAGCAATATTTTGCATAATGCTTTATTTTTCTCAAATGACTATTGCATAGATGATCTTGATATTTGCAACAGCCT
AGTGGATTTGGTAGGGTCCTGAATCATCTCTATAAGGCAAACAAGGAAATTGTAACACAAAGAAATAAACATATTGAATATAATTGCTAT
TCTGTAAGACATACAGTCTGTGTAAGATGTATCTTATTTACAGAGACATTTTTGAAAATTAAAATATTAAATACTTTTTGTTATATAGAG

>In-frame_NEK3_ENST00000400357_chr13_52722550_-_GXYLT2_ENST00000389617_chr3_73006380_+_4144nt
ATTGTGCCTTTCCTCTCTCAGGGAGTGCCAAGAAACCATCTGGTTCATGCCAGAAACTTGGGAGTCAACCTTGCCCCCTTCTCTGCTTGC
CCCCCATAAATCTGCCACCACAAATCCTGTCAACTGTTCTTACATCTTTCCTTCCCATTTTTTCTGACCCCATTGCCTCCACTCTATTCC
ATTTCATTATTTTCCTGCCTTTTCTATTGTTGGAGCCTCCTAACTGGCCTGTGTCTCTGAGCTGGCCTTCCTGCCCCTCCTCCACTGGTC
CATTTAATCTGCAATCTGAGTGAATGTTTTTTCTAATATGCAAATATGATTATATTGCCTTCTTGGTTAAAATGCTTCAGCAGCTTGTTA
CATTCTTCTTTCAATTTCTTGAACTGAATGTAATTTCTTTAGCTCTTAAATATGCAATTTCCTCTTCCTTGATTACTCTTTTCCTCCTCT
TTGTCTAGCCAAGTTTCATTCATCCTTCAGGCTTCAGCTTAAATAGCCTACATTTGTTGAGGTTTATGGTTATCTCTGCATGGGATGTCC
ACGTTGGCAGGGACTATGAGAGATTTTTCAGATTATAACATCTGACTCAGAGTTGGTGCTCAGTGTCTGCCTGTTGTATGTAGTATAGGG
GAGGAAAAACATTTTTTCTCTGCCCTCTTAGGTTCAGTAGCTGGGCCCTGCAAAATAAACTGATGAAAGATAGATTAACAGGAAAAAAGG
TTTATGCATAAATGTAAAGAAGTGGTTAGACCAGGGGGCTCATATGCCATTTTAACAAAGAGTGATAAATTATAGAGAAGTAACTAGACA
AAAGTAGGGGAATGCTTCTTGGGTAAATTGTAGGAAGGTAAATATATGGCGGAAGCTAACATAAGATAAGGGTTATTCAGTAAAGTTTGT
TATGTGGACTCAAGTTGGTGCCTTCCCCATTGGTAAGAGTTGCTCTCCTCTTCCTGGTACTGGAAAGGAAGACACATTTACAAATGGATA
TTTATTACCTGTACATAGGAAAATTTATGCCCTGCATTTATACAAAAAAGGGAGGGCAAAGAGCAAATTGGTTTCAGCTCAAAACAATTC
TTACATGAAAGTGGCATATTTTGGGGTAGCATACACTGATCCTCTTCAAAAGGAATAATTTGCTTTTCTCTTATCATGGTTATGAGAGCT
ACTTTGAATTAATTTTTGCTTTTTGAAAGTACATTTAATTCTCAAATGTTTCTGCTTTTGAATGCAGTTTGGGAGAGCCCATGGTGACTG
CGTGAGTGGAGCCCAGCTGTGTGGATGCCCCAGCATGGATGACTACATGGTCCTGAGAATGATTGGGGAGGGCTCCTTCGGCAGAGCTCT
TTTGGTTCAGCATGAAAGCAGTAATCAGATGTTTGCCATGAAAGAAATAAGGCTTCCCAAGTCTTTCTCTAATACACAGAATTCTAGGAA
GGAGGCTGTTCTTTTAGCCAAAATGAAACACCCTAATATTGTTGCCTTCAAAGAATCATTTGAAGCTGAAGGACACTTGTATATTGTGAT
GGAATACTGTGATGGAGGGGATCTAATGCAAAAGATTAAACAGCAGAAAGGAAAGTTATTTCCTGAAGACATGATACTTAATTGGTTTAC
CCAAATGTGCCTTGGAGTAAATCACATTCACAAGAAACGTGTGCTACACAGAGATATCAAGTCCAAGAATATCTTCCTCACTCAGAATGG
AAAAGTGAAATTGGGAGACTTTGGATCTGCCCGTCTTCTCTCCAATCCGATGGCATTTGCTTGTACCTATGTGGGAACTCCTTATTATGT
GCCTCCAGAAATTTGGGAAAACCTGCCTTATAACAATAAAAGTGACATCTGGTCCTTGGGTTGCATCCTGTATGAACTCTGTACCCTTAA
GCATCCAAACAGCATGATTCCAACAGGCCTGGCTTGGGAGGACATGTTGTACCCTCTGTACCAGAAGTACAAGAATGCCATCACGTGGGG
AGACCAGGATTTATTAAATATTATTTTTTATTTCAACCCAGAGTGTCTCTATGTATTCCCCTGCCAGTGGAACTACCGTCCCGATCACTG
CATGTACGGAAGCAACTGCAGAGAGGCTGAGCATGAAGGTGTGTCTGTTCTGCATGGAAACCGAGGCGTCTACCATGACGATAAGCAACC
AACGTTCAGAGCACTCTATGAAGCAATACGGGATTTTCCCTTTCAAGACAATCTCTTTCAATCCATGTATTACCCCCTTCAGCTGAAGTT
TTTGGAGACTGTGCACACTTTATGTGGACGAATCCCGCAAGTTTTTCTGAAGCAAATTGAGAAAACAATGAAAAGGGCTTATGAGAAACA
CGTCATCATCCATGTTGGCCCCAACCAGATGCACTGAATATTTTGTCTTGTTGCAAGTCAATTAGGTGTCTTGTGACCAAGGAAATACTA
ATCTCTAAGCTGCCTGGGTCTTTTTGTGTGAATATTTAATGGTGCTCCATGACTGTTGAGTTTTAAAAACCTCGTTAAATTTTGCCAAAT
CAGTTGCCCCCAAAAGGGAATATGCTTTTCCTTATTTTTTTTTCTAAAATGCTATTTATCTCTAAGGAAAAAAAAAAAAGACTATTACTC
ATTTAACATTGTTTAAGCAGGTTGAGCTAGCTGTGAAAATAGCTTTTGTGAGCCTTCTAATTCCTAAACGTCTGAGACCATTTCAGTGGC
ACCTGAGGTGTTATATTGATCTAGCATTCCTGAGACTCTTTCTATGCAACTGACTCCCCCACACCCGTGTTATAAAAGTAATACACACTT
TTGAAACAGAGAGACACACTTGTAGAGCATATGGGTCAAGGGCTCAACATCAAGATTAGATTAGCCATAATCCTATTGACCAGTGGAAAA
GATTGTTTCCATTTTAAAGCAGTTCCTTACAACCTTTTTTCTCTACTTTTGCATTTTCCACTCTAACACACATCTAAAACAGGTAATCTC
AGTAAAAGCTGGCCTTTTTGCTGAGATTTTTATGTGGGAGACTAAAATATTAGATGAGATGATTATGTGTACAGAATTTTATTTAAAATA
CATCTGAGAGAATCATTCAGATACTTGGGTAGTGTTAAAGGATGAAGCATGTATCTGGGGGTATTTCTTCTTTTTCTTTCTTTCTTTTTT
TTTTTTTTTTTTTTTTTGAGACGGAATCTCACTCTGTAGCCCAGGCTAGAATGCAGTGGCAGGATCTCGGCTCACTGCAGCTTCCACCTC
CTGGGTTCAAGTGATTCTCATGCCTCAGCCTCCCCAGTAGCTGGGATTACAAGTGTGTGCCACCACACCCGGCTAATTTTTGTATTTTTA
GTAGAGACACGGTTTTACCATGTTGGCCAGGCTGGTCTTGATCTCCAGACCTCAAGTGATCTGCCTGCCTCAGCCTCCCAAAGTGCTGGG
ATTACAAGTGTGAGCCACTGCACTCAGCCAATCTGGGAGTATTTCTAAAGAAAAAAATTACTTTGATTTGTGGAGGACTAAATCATAATA
CATTTCTATGCAACAATAGCTTCTGAGAGGAAATTCAGGAATGTTTGTGTTTACCACAGACAAAAACATTTGATCTGTTAATCATCAGTA
GCTGTGGTCATCTCTCTTTCTTAAACTCTTGGGCAATGGGTGGAAATCAGAGACCAACTTCAAATTTAATGTGTAAAAAACAAATAGTTC
AGCTGCTTCTATTGGTAAGAAAATTCAACTTCCTACCAGCCTTAGAAAGGTCTCTTTAAACAATTTCTTTCCCCCTAGGGTTACCTAGCT
GGTCCATACAGGTTTTATCACCTCACTGCAAGGAGGAAGTTGAATATTCTGTTCCCCACGGGGATCTGGCTTAATCCCTAGTTGCTCATA
TAGTTGGTATCAGCATAGCAATATTTTGCATAATGCTTTATTTTTCTCAAATGACTATTGCATAGATGATCTTGATATTTGCAACAGCCT
AGTGGATTTGGTAGGGTCCTGAATCATCTCTATAAGGCAAACAAGGAAATTGTAACACAAAGAAATAAACATATTGAATATAATTGCTAT
TCTGTAAGACATACAGTCTGTGTAAGATGTATCTTATTTACAGAGACATTTTTGAAAATTAAAATATTAAATACTTTTTGTTATATAGAG


Top

FusionGenePPI for NEK3_GXYLT2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NEK3HDAC6, NMNAT1, BPGM, CDCA8, VSIG4, CDK13, TNFSF8, CPNE2GXYLT2FBL, SRPK2, MGAT4C, CD70, NEUROG3, HLA-DPA1, SCGB2A2, KCNC4, KLRG2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneNEK3chr13:52722550chr3:73006380ENST00000400357-7141_285201490VAV2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NEK3_GXYLT2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NEK3_GXYLT2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource