FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23964

FusionGeneSummary for NEDD4L_TLN2

check button Fusion gene summary
Fusion gene informationFusion gene name: NEDD4L_TLN2
Fusion gene ID: 23964
HgeneTgene
Gene symbol

NEDD4L

TLN2

Gene ID

23327

83660

Gene nameneural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligasetalin 2
SynonymsNEDD4-2|NEDD4.2|PVNH7|RSP5|hNEDD4-2ILWEQ
Cytomap

18q21.31

15q22.2

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase NEDD4-likeHECT-type E3 ubiquitin transferase NED4Lubiquitin-protein ligase Rsp5talin-2
Modification date2018052320180519
UniProtAcc

Q96PU5

Q9Y4G6

Ensembl transtripts involved in fusion geneENST00000356462, ENST00000400345, 
ENST00000589054, ENST00000256832, 
ENST00000382850, ENST00000256830, 
ENST00000588516, ENST00000456986, 
ENST00000435432, ENST00000357895, 
ENST00000586263, ENST00000456173, 
ENST00000431212, 
ENST00000561311, 
ENST00000306829, ENST00000559908, 
ENST00000472902, 
Fusion gene scores* DoF score18 X 11 X 9=17826 X 6 X 6=216
# samples 206
** MAII scorelog2(20/1782*10)=-3.1554254317472
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/216*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NEDD4L [Title/Abstract] AND TLN2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNEDD4L

GO:0003254

regulation of membrane depolarization

15217910

HgeneNEDD4L

GO:0006511

ubiquitin-dependent protein catabolic process

21463633

HgeneNEDD4L

GO:0010038

response to metal ion

11244092

HgeneNEDD4L

GO:0016567

protein ubiquitination

15217910|25631046

HgeneNEDD4L

GO:0034765

regulation of ion transmembrane transport

17289006

HgeneNEDD4L

GO:0042391

regulation of membrane potential

17289006

HgeneNEDD4L

GO:0043161

proteasome-mediated ubiquitin-dependent protein catabolic process

21463633

HgeneNEDD4L

GO:0060306

regulation of membrane repolarization

21463633

HgeneNEDD4L

GO:0070936

protein K48-linked ubiquitination

21463633

HgeneNEDD4L

GO:1901016

regulation of potassium ion transmembrane transporter activity

17289006

HgeneNEDD4L

GO:1901017

negative regulation of potassium ion transmembrane transporter activity

21463633

HgeneNEDD4L

GO:1901380

negative regulation of potassium ion transmembrane transport

21463633

HgeneNEDD4L

GO:1902306

negative regulation of sodium ion transmembrane transport

15217910

HgeneNEDD4L

GO:1903861

positive regulation of dendrite extension

23999003

HgeneNEDD4L

GO:2000009

negative regulation of protein localization to cell surface

21463633

HgeneNEDD4L

GO:2000650

negative regulation of sodium ion transmembrane transporter activity

15217910


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A8-A06P-01ANEDD4Lchr18

55711940

+TLN2chr15

63063163

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000356462ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
In-frameENST00000356462ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000356462ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000356462ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
In-frameENST00000400345ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
In-frameENST00000400345ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000400345ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000400345ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
In-frameENST00000589054ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
In-frameENST00000589054ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000589054ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000589054ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5UTR-3CDSENST00000256832ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5UTR-3CDSENST00000256832ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5UTR-intronENST00000256832ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5UTR-intronENST00000256832ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
In-frameENST00000382850ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
In-frameENST00000382850ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000382850ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000382850ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
In-frameENST00000256830ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
In-frameENST00000256830ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000256830ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
5CDS-intronENST00000256830ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000588516ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000588516ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000588516ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000588516ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000456986ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000456986ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000456986ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000456986ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000435432ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000435432ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000435432ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000435432ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000357895ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000357895ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000357895ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000357895ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000586263ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000586263ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000586263ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000586263ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000456173ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000456173ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000456173ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000456173ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000431212ENST00000561311NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-3CDSENST00000431212ENST00000306829NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000431212ENST00000559908NEDD4Lchr18

55711940

+TLN2chr15

63063163

+
intron-intronENST00000431212ENST00000472902NEDD4Lchr18

55711940

+TLN2chr15

63063163

+

Top

FusionProtFeatures for NEDD4L_TLN2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NEDD4L

Q96PU5

TLN2

Q9Y4G6

As a major component of focal adhesion plaques thatlinks integrin to the actin cytoskeleton, may play an importantrole in cell adhesion. Recruits PIP5K1C to focal adhesion plaquesand strongly activates its kinase activity (By similarity).{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTLN2chr18:55711940chr15:63063163ENST00000306829+37562294_253317322543DomainI/LWEQ
TgeneTLN2chr18:55711940chr15:63063163ENST00000561311+39582294_253317322543DomainI/LWEQ

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000256830+128193_22616872DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000256830+128385_41816872DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000256830+128497_53016872DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000256830+128548_58116872DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000256830+128640_97416872DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000256830+1287_10916872DomainC2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000356462+129193_22616912DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000356462+129385_41816912DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000356462+129497_53016912DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000356462+129548_58116912DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000356462+129640_97416912DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000356462+1297_10916912DomainC2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000357895+131193_226-68968DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000357895+131385_418-68968DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000357895+131497_530-68968DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000357895+131548_581-68968DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000357895+131640_974-68968DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000357895+1317_109-68968DomainC2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000382850+130193_22616956DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000382850+130385_41816956DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000382850+130497_53016956DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000382850+130548_58116956DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000382850+130640_97416956DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000382850+1307_10916956DomainC2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000400345+131193_22616976DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000400345+131385_41816976DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000400345+131497_53016976DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000400345+131548_58116976DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000400345+131640_97416976DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000400345+1317_10916976DomainC2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000431212+130193_226-155855DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000431212+130385_418-155855DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000431212+130497_530-155855DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000431212+130548_581-155855DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000431212+130640_974-155855DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000431212+1307_109-155855DomainC2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000435432+131193_226-210835DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000435432+131385_418-210835DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000435432+131497_530-210835DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000435432+131548_581-210835DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000435432+131640_974-210835DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000435432+1317_109-210835DomainC2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456173+129193_226-195835DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456173+129385_418-195835DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456173+129497_530-195835DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456173+129548_581-195835DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456173+129640_974-195835DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456173+1297_109-195835DomainC2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456986+131193_226-200855DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456986+131385_418-200855DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456986+131497_530-200855DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456986+131548_581-200855DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456986+131640_974-200855DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000456986+1317_109-200855DomainC2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000586263+130193_226-67948DomainWW 1
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000586263+130385_418-67948DomainWW 2
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000586263+130497_530-67948DomainWW 3
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000586263+130548_581-67948DomainWW 4
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000586263+130640_974-67948DomainHECT
HgeneNEDD4Lchr18:55711940chr15:63063163ENST00000586263+1307_109-67948DomainC2
TgeneTLN2chr18:55711940chr15:63063163ENST00000306829+3756861_119317322543Compositional biasNote=Ala-rich
TgeneTLN2chr18:55711940chr15:63063163ENST00000561311+3958861_119317322543Compositional biasNote=Ala-rich
TgeneTLN2chr18:55711940chr15:63063163ENST00000306829+375688_40617322543DomainFERM
TgeneTLN2chr18:55711940chr15:63063163ENST00000561311+395888_40617322543DomainFERM


Top

FusionGeneSequence for NEDD4L_TLN2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NEDD4L_ENST00000356462_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR

>In-frame_NEDD4L_ENST00000356462_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR

>In-frame_NEDD4L_ENST00000400345_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR

>In-frame_NEDD4L_ENST00000400345_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR

>In-frame_NEDD4L_ENST00000589054_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR

>In-frame_NEDD4L_ENST00000589054_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR

>In-frame_NEDD4L_ENST00000382850_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR

>In-frame_NEDD4L_ENST00000382850_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR

>In-frame_NEDD4L_ENST00000256830_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR

>In-frame_NEDD4L_ENST00000256830_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_827aa
MATGLGEPVYGLSEDEVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKE
AVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGH
LAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAV
SGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPE
TQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDV
PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVL
VILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQI
LEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAST
AQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NEDD4L_ENST00000356462_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC

>In-frame_NEDD4L_ENST00000356462_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC

>In-frame_NEDD4L_ENST00000400345_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC

>In-frame_NEDD4L_ENST00000400345_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC

>In-frame_NEDD4L_ENST00000589054_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC

>In-frame_NEDD4L_ENST00000589054_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC

>In-frame_NEDD4L_ENST00000382850_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC

>In-frame_NEDD4L_ENST00000382850_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC

>In-frame_NEDD4L_ENST00000256830_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC

>In-frame_NEDD4L_ENST00000256830_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_2481nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NEDD4L_ENST00000356462_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_6796nt
GCGCCGCCGCCGCGCGCAGTGAGAGGCGCCGGGGCTGCCGCCCGGTGCTCGGCGCGCTCTCGGGAGCCGCCCGCCCGCTGGTCCCGCAGC
CTTCCGGGAGGAAGCGGTGCCGGCAGCGTCCAGGGCGCGCTCTCGGGCACCCTCACCTGCCGGCGCCCGGCCGCTTACCCGGCAGGGCGT
GCGCAGGGTAGGGTGCGGGACCGGGGGGACCTGGAGGCAGAGGGGAGAACCGGCCGTCCGCGCCGCAGCACAGCCGCTGGGAGCGCCTCA
GACCCCGCGCGGGGCGCCGGCTCCATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGC
TATTTTGAGCCCTTGATCTTAGCCGCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAG
ACTCTCGCAGAGTCTGCCTTGCAGATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACA
GAGGCCGCCCAGTTGATGAAGGAAGCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATG
GTGGACGCCATTGCAGAAGCCATGAGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTG
GTTAAATACTCCAAAGCCATTGCGGTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCA
CAAATGACCAGTGACTATGGGCACCTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGC
ACTCGTGTGCAGGACCTGGGCCACGGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAG
AGGGAGCTGATCGAATGCGCCCGTGCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCA
TGCATTACAGCCGCCACCGCTGTGTCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAG
AACAGTGAGACCTTCGCAGACCACAGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCT
GCGTCCACTCCTGACAAGCTGGCCCAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCC
AGCCTGGGCTCCGACGACCCCGAGACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCT
ACCAAGGGAGCTGCCAGCAAGCCAGTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCG
CTCCTCAAGACTGTAAAGGCAGTGGAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTT
ACGGTGTTCCAGTCAAAAGACGTACCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCC
AAAGCCGTGGCAGCTGGGAACTCATGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACG
GCTTGCAAGCAAGCATCCTTCCACCCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTAC
TTGGACCTCCTGGAGCACGTCTTGGTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCC
GGCGCTGTGACAGAGCTCATCCAGGCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACA
GAGTTACTGGGGGCTGCAGCATCCATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAG
ACCCTGGACTTTGAGGAACAGATCTTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAG
AGGGAGCTGGTGGCCCAAGGAAAGGTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCC
CGGATGGTGGCGGCTGCGACCAGCAGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCT
GCCAAGCAGGTCGCCGCTTCCACGGCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAG
GCGGCAGGAAATGCTGTGAAAAGAGCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTT
GTAGTGAAAACCAAGTTTGTGGGGGGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCA
AGGAAAAAACTGGCCCAAATCCGCCAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGA
TGGCGAGCCCCAGGGGATGGCCCTGGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTC
CCGGGTGAGCCTGGAGCCCTGCGTGCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGT
CCTACCCACAACTCCTCTGCCGCCTCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAG
AAAAGTCAGTATTATGTTGTTCTCAGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGAT
AGGGAAAAAAATCATTGACGTCATAGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGA
AACACAAACCCGTGTGGACTCCGGGAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCG
CCCCTGTTTGCACGCTTTCTTGCCTCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGA
TTATTTTGTTCCTCCGTAGTCCAAAGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCC
TTACCCTGCAGAGGCTGTTTCAGCTCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTT
AGCGTCCAGGGTGGGGATTCTGCTGGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGG
TCACAAGCCCGGATTGGAAAGGATCTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAA
AATCTAAATGCATCCTAAAATCAATGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGG
ATGTCACACTTCCAGAATTTCATATTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACC
CTTAATCTGCACCTTTAGCCAAGGCAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAG
AATTCATAGTGGGGAAGGTAAAAGTTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTC
TCTCTCTCTCTCTGGTGTGCTATCATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGG
TCCTCCGAAGATGTCACCTTTCGACCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGA
CAGCTTCCCATATTTATAAGTTACTTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGT
AAAGGAAAAGCAAGTGAGAGTATGTGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCT
GTTGGGGAAAAGCTGGCACACTCTTGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGG
AGGGGCACACGTGCTTCCAGAGACACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTG
GGGATCCCCTCTGTGGCCCAGCCCACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCC
ATCCTGAAAACCCAGGACCAAGGCAGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATAC
CAGAAAAGCCTCCAGAGACAAACCAAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCT
ATATAAATACTCACCTTTCTGGAGTCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCT
CATCTGTCCTTTCCTCATCCACCCTGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAA
GGGCCATGCCTTGTCTGGATGTTATTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAA
ATAACACAGGCATGAGTTCATTTGGGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGG
AGCATAGAAGTGTATCTCTGTGAAGAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCC
TTGGGCTGATTTTTGTGCCAGAAATTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAA
TTTAGATTTTACTTGGGCCTTTCAGGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGC
CAGTGTCCAGCCAGCTGTGGCCCTGGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCC
AGGTCGGCTGCAGAGGCAGCTGCCCAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTA
TCAGGGAAAACCCTTCGAGCTTCTTCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGT
TCCTAATTTATCAAAAAATTATAACCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCA
TCAAGGAACCAGACACAGGTCAAAAGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGT
TTCCTCCCTGGCAGATAGTCCCCAGAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGAT
CTCAGCACAGACTATCAGCATGTTCCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTT
ACCAACCCAAGAAATTTGGAGACATTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCC
AGTAGTGGCTCTGGTCCTATCTCTCCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAA
ATGTCCTCAGTCTGTTGCTCCATCTTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGG
TTGATTCTTTTAAATGCTACAAACAAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGC
CCTCCAGGGAGCATCAGTGTACCTGAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTC
ACCAACCTTCAAGATCCAGAAGAAAACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATA

>In-frame_NEDD4L_ENST00000356462_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_6796nt
GCGCCGCCGCCGCGCGCAGTGAGAGGCGCCGGGGCTGCCGCCCGGTGCTCGGCGCGCTCTCGGGAGCCGCCCGCCCGCTGGTCCCGCAGC
CTTCCGGGAGGAAGCGGTGCCGGCAGCGTCCAGGGCGCGCTCTCGGGCACCCTCACCTGCCGGCGCCCGGCCGCTTACCCGGCAGGGCGT
GCGCAGGGTAGGGTGCGGGACCGGGGGGACCTGGAGGCAGAGGGGAGAACCGGCCGTCCGCGCCGCAGCACAGCCGCTGGGAGCGCCTCA
GACCCCGCGCGGGGCGCCGGCTCCATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGC
TATTTTGAGCCCTTGATCTTAGCCGCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAG
ACTCTCGCAGAGTCTGCCTTGCAGATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACA
GAGGCCGCCCAGTTGATGAAGGAAGCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATG
GTGGACGCCATTGCAGAAGCCATGAGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTG
GTTAAATACTCCAAAGCCATTGCGGTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCA
CAAATGACCAGTGACTATGGGCACCTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGC
ACTCGTGTGCAGGACCTGGGCCACGGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAG
AGGGAGCTGATCGAATGCGCCCGTGCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCA
TGCATTACAGCCGCCACCGCTGTGTCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAG
AACAGTGAGACCTTCGCAGACCACAGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCT
GCGTCCACTCCTGACAAGCTGGCCCAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCC
AGCCTGGGCTCCGACGACCCCGAGACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCT
ACCAAGGGAGCTGCCAGCAAGCCAGTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCG
CTCCTCAAGACTGTAAAGGCAGTGGAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTT
ACGGTGTTCCAGTCAAAAGACGTACCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCC
AAAGCCGTGGCAGCTGGGAACTCATGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACG
GCTTGCAAGCAAGCATCCTTCCACCCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTAC
TTGGACCTCCTGGAGCACGTCTTGGTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCC
GGCGCTGTGACAGAGCTCATCCAGGCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACA
GAGTTACTGGGGGCTGCAGCATCCATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAG
ACCCTGGACTTTGAGGAACAGATCTTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAG
AGGGAGCTGGTGGCCCAAGGAAAGGTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCC
CGGATGGTGGCGGCTGCGACCAGCAGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCT
GCCAAGCAGGTCGCCGCTTCCACGGCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAG
GCGGCAGGAAATGCTGTGAAAAGAGCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTT
GTAGTGAAAACCAAGTTTGTGGGGGGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCA
AGGAAAAAACTGGCCCAAATCCGCCAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGA
TGGCGAGCCCCAGGGGATGGCCCTGGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTC
CCGGGTGAGCCTGGAGCCCTGCGTGCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGT
CCTACCCACAACTCCTCTGCCGCCTCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAG
AAAAGTCAGTATTATGTTGTTCTCAGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGAT
AGGGAAAAAAATCATTGACGTCATAGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGA
AACACAAACCCGTGTGGACTCCGGGAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCG
CCCCTGTTTGCACGCTTTCTTGCCTCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGA
TTATTTTGTTCCTCCGTAGTCCAAAGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCC
TTACCCTGCAGAGGCTGTTTCAGCTCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTT
AGCGTCCAGGGTGGGGATTCTGCTGGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGG
TCACAAGCCCGGATTGGAAAGGATCTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAA
AATCTAAATGCATCCTAAAATCAATGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGG
ATGTCACACTTCCAGAATTTCATATTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACC
CTTAATCTGCACCTTTAGCCAAGGCAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAG
AATTCATAGTGGGGAAGGTAAAAGTTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTC
TCTCTCTCTCTCTGGTGTGCTATCATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGG
TCCTCCGAAGATGTCACCTTTCGACCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGA
CAGCTTCCCATATTTATAAGTTACTTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGT
AAAGGAAAAGCAAGTGAGAGTATGTGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCT
GTTGGGGAAAAGCTGGCACACTCTTGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGG
AGGGGCACACGTGCTTCCAGAGACACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTG
GGGATCCCCTCTGTGGCCCAGCCCACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCC
ATCCTGAAAACCCAGGACCAAGGCAGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATAC
CAGAAAAGCCTCCAGAGACAAACCAAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCT
ATATAAATACTCACCTTTCTGGAGTCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCT
CATCTGTCCTTTCCTCATCCACCCTGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAA
GGGCCATGCCTTGTCTGGATGTTATTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAA
ATAACACAGGCATGAGTTCATTTGGGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGG
AGCATAGAAGTGTATCTCTGTGAAGAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCC
TTGGGCTGATTTTTGTGCCAGAAATTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAA
TTTAGATTTTACTTGGGCCTTTCAGGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGC
CAGTGTCCAGCCAGCTGTGGCCCTGGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCC
AGGTCGGCTGCAGAGGCAGCTGCCCAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTA
TCAGGGAAAACCCTTCGAGCTTCTTCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGT
TCCTAATTTATCAAAAAATTATAACCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCA
TCAAGGAACCAGACACAGGTCAAAAGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGT
TTCCTCCCTGGCAGATAGTCCCCAGAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGAT
CTCAGCACAGACTATCAGCATGTTCCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTT
ACCAACCCAAGAAATTTGGAGACATTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCC
AGTAGTGGCTCTGGTCCTATCTCTCCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAA
ATGTCCTCAGTCTGTTGCTCCATCTTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGG
TTGATTCTTTTAAATGCTACAAACAAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGC
CCTCCAGGGAGCATCAGTGTACCTGAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTC
ACCAACCTTCAAGATCCAGAAGAAAACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATA

>In-frame_NEDD4L_ENST00000400345_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_6785nt
GCGCGCAGTGAGAGGCGCCGGGGCTGCCGCCCGGTGCTCGGCGCGCTCTCGGGAGCCGCCCGCCCGCTGGTCCCGCAGCCTTCCGGGAGG
AAGCGGTGCCGGCAGCGTCCAGGGCGCGCTCTCGGGCACCCTCACCTGCCGGCGCCCGGCCGCTTACCCGGCAGGGCGTGCGCAGGGTAG
GGTGCGGGACCGGGGGGACCTGGAGGCAGAGGGGAGAACCGGCCGTCCGCGCCGCAGCACAGCCGCTGGGAGCGCCTCAGACCCCGCGCG
GGGCGCCGGCTCCATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCC
CTTGATCTTAGCCGCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGA
GTCTGCCTTGCAGATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCA
GTTGATGAAGGAAGCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCAT
TGCAGAAGCCATGAGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTC
CAAAGCCATTGCGGTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAG
TGACTATGGGCACCTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCA
GGACCTGGGCCACGGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGAT
CGAATGCGCCCGTGCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGC
CGCCACCGCTGTGTCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGAC
CTTCGCAGACCACAGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCC
TGACAAGCTGGCCCAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTC
CGACGACCCCGAGACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGC
TGCCAGCAAGCCAGTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGAC
TGTAAAGGCAGTGGAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCA
GTCAAAAGACGTACCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGC
AGCTGGGAACTCATGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCA
AGCATCCTTCCACCCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCT
GGAGCACGTCTTGGTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGAC
AGAGCTCATCCAGGCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGG
GGCTGCAGCATCCATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTT
TGAGGAACAGATCTTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGT
GGCCCAAGGAAAGGTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGC
GGCTGCGACCAGCAGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGT
CGCCGCTTCCACGGCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAA
TGCTGTGAAAAGAGCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAAC
CAAGTTTGTGGGGGGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACT
GGCCCAAATCCGCCAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGATGGCGAGCCCC
AGGGGATGGCCCTGGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTCCCGGGTGAGCC
TGGAGCCCTGCGTGCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGTCCTACCCACAA
CTCCTCTGCCGCCTCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAGAAAAGTCAGTA
TTATGTTGTTCTCAGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGATAGGGAAAAAAA
TCATTGACGTCATAGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGAAACACAAACCC
GTGTGGACTCCGGGAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCGCCCCTGTTTGC
ACGCTTTCTTGCCTCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGATTATTTTGTTC
CTCCGTAGTCCAAAGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCCTTACCCTGCAG
AGGCTGTTTCAGCTCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTTAGCGTCCAGGG
TGGGGATTCTGCTGGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGGTCACAAGCCCG
GATTGGAAAGGATCTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAAAATCTAAATGC
ATCCTAAAATCAATGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGGATGTCACACTT
CCAGAATTTCATATTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACCCTTAATCTGCA
CCTTTAGCCAAGGCAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAGAATTCATAGTG
GGGAAGGTAAAAGTTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTCTCTCTCTCTCT
CTGGTGTGCTATCATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGGTCCTCCGAAGA
TGTCACCTTTCGACCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGACAGCTTCCCAT
ATTTATAAGTTACTTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGTAAAGGAAAAGC
AAGTGAGAGTATGTGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCTGTTGGGGAAAA
GCTGGCACACTCTTGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGGAGGGGCACACG
TGCTTCCAGAGACACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTGGGGATCCCCTC
TGTGGCCCAGCCCACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCCATCCTGAAAAC
CCAGGACCAAGGCAGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATACCAGAAAAGCCT
CCAGAGACAAACCAAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCTATATAAATACT
CACCTTTCTGGAGTCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCTCATCTGTCCTT
TCCTCATCCACCCTGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAAGGGCCATGCCT
TGTCTGGATGTTATTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAAATAACACAGGC
ATGAGTTCATTTGGGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGGAGCATAGAAGT
GTATCTCTGTGAAGAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCCTTGGGCTGATT
TTTGTGCCAGAAATTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAATTTAGATTTTA
CTTGGGCCTTTCAGGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGCCAGTGTCCAGC
CAGCTGTGGCCCTGGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCCAGGTCGGCTGC
AGAGGCAGCTGCCCAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTATCAGGGAAAAC
CCTTCGAGCTTCTTCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGTTCCTAATTTAT
CAAAAAATTATAACCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCATCAAGGAACCA
GACACAGGTCAAAAGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGTTTCCTCCCTGG
CAGATAGTCCCCAGAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGATCTCAGCACAGA
CTATCAGCATGTTCCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTTACCAACCCAAG
AAATTTGGAGACATTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCCAGTAGTGGCTC
TGGTCCTATCTCTCCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAAATGTCCTCAGT
CTGTTGCTCCATCTTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGGTTGATTCTTTT
AAATGCTACAAACAAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGCCCTCCAGGGAG
CATCAGTGTACCTGAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTCACCAACCTTCA
AGATCCAGAAGAAAACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATAAGTTATTTTTT

>In-frame_NEDD4L_ENST00000400345_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_6785nt
GCGCGCAGTGAGAGGCGCCGGGGCTGCCGCCCGGTGCTCGGCGCGCTCTCGGGAGCCGCCCGCCCGCTGGTCCCGCAGCCTTCCGGGAGG
AAGCGGTGCCGGCAGCGTCCAGGGCGCGCTCTCGGGCACCCTCACCTGCCGGCGCCCGGCCGCTTACCCGGCAGGGCGTGCGCAGGGTAG
GGTGCGGGACCGGGGGGACCTGGAGGCAGAGGGGAGAACCGGCCGTCCGCGCCGCAGCACAGCCGCTGGGAGCGCCTCAGACCCCGCGCG
GGGCGCCGGCTCCATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCC
CTTGATCTTAGCCGCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGA
GTCTGCCTTGCAGATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCA
GTTGATGAAGGAAGCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCAT
TGCAGAAGCCATGAGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTC
CAAAGCCATTGCGGTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAG
TGACTATGGGCACCTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCA
GGACCTGGGCCACGGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGAT
CGAATGCGCCCGTGCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGC
CGCCACCGCTGTGTCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGAC
CTTCGCAGACCACAGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCC
TGACAAGCTGGCCCAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTC
CGACGACCCCGAGACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGC
TGCCAGCAAGCCAGTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGAC
TGTAAAGGCAGTGGAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCA
GTCAAAAGACGTACCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGC
AGCTGGGAACTCATGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCA
AGCATCCTTCCACCCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCT
GGAGCACGTCTTGGTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGAC
AGAGCTCATCCAGGCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGG
GGCTGCAGCATCCATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTT
TGAGGAACAGATCTTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGT
GGCCCAAGGAAAGGTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGC
GGCTGCGACCAGCAGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGT
CGCCGCTTCCACGGCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAA
TGCTGTGAAAAGAGCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAAC
CAAGTTTGTGGGGGGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACT
GGCCCAAATCCGCCAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGATGGCGAGCCCC
AGGGGATGGCCCTGGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTCCCGGGTGAGCC
TGGAGCCCTGCGTGCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGTCCTACCCACAA
CTCCTCTGCCGCCTCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAGAAAAGTCAGTA
TTATGTTGTTCTCAGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGATAGGGAAAAAAA
TCATTGACGTCATAGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGAAACACAAACCC
GTGTGGACTCCGGGAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCGCCCCTGTTTGC
ACGCTTTCTTGCCTCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGATTATTTTGTTC
CTCCGTAGTCCAAAGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCCTTACCCTGCAG
AGGCTGTTTCAGCTCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTTAGCGTCCAGGG
TGGGGATTCTGCTGGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGGTCACAAGCCCG
GATTGGAAAGGATCTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAAAATCTAAATGC
ATCCTAAAATCAATGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGGATGTCACACTT
CCAGAATTTCATATTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACCCTTAATCTGCA
CCTTTAGCCAAGGCAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAGAATTCATAGTG
GGGAAGGTAAAAGTTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTCTCTCTCTCTCT
CTGGTGTGCTATCATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGGTCCTCCGAAGA
TGTCACCTTTCGACCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGACAGCTTCCCAT
ATTTATAAGTTACTTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGTAAAGGAAAAGC
AAGTGAGAGTATGTGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCTGTTGGGGAAAA
GCTGGCACACTCTTGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGGAGGGGCACACG
TGCTTCCAGAGACACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTGGGGATCCCCTC
TGTGGCCCAGCCCACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCCATCCTGAAAAC
CCAGGACCAAGGCAGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATACCAGAAAAGCCT
CCAGAGACAAACCAAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCTATATAAATACT
CACCTTTCTGGAGTCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCTCATCTGTCCTT
TCCTCATCCACCCTGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAAGGGCCATGCCT
TGTCTGGATGTTATTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAAATAACACAGGC
ATGAGTTCATTTGGGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGGAGCATAGAAGT
GTATCTCTGTGAAGAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCCTTGGGCTGATT
TTTGTGCCAGAAATTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAATTTAGATTTTA
CTTGGGCCTTTCAGGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGCCAGTGTCCAGC
CAGCTGTGGCCCTGGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCCAGGTCGGCTGC
AGAGGCAGCTGCCCAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTATCAGGGAAAAC
CCTTCGAGCTTCTTCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGTTCCTAATTTAT
CAAAAAATTATAACCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCATCAAGGAACCA
GACACAGGTCAAAAGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGTTTCCTCCCTGG
CAGATAGTCCCCAGAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGATCTCAGCACAGA
CTATCAGCATGTTCCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTTACCAACCCAAG
AAATTTGGAGACATTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCCAGTAGTGGCTC
TGGTCCTATCTCTCCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAAATGTCCTCAGT
CTGTTGCTCCATCTTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGGTTGATTCTTTT
AAATGCTACAAACAAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGCCCTCCAGGGAG
CATCAGTGTACCTGAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTCACCAACCTTCA
AGATCCAGAAGAAAACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATAAGTTATTTTTT

>In-frame_NEDD4L_ENST00000589054_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_6779nt
AGTGAGAGGCGCCGGGGCTGCCGCCCGGTGCTCGGCGCGCTCTCGGGAGCCGCCCGCCCGCTGGTCCCGCAGCCTTCCGGGAGGAAGCGG
TGCCGGCAGCGTCCAGGGCGCGCTCTCGGGCACCCTCACCTGCCGGCGCCCGGCCGCTTACCCGGCAGGGCGTGCGCAGGGTAGGGTGCG
GGACCGGGGGGACCTGGAGGCAGAGGGGAGAACCGGCCGTCCGCGCCGCAGCACAGCCGCTGGGAGCGCCTCAGACCCCGCGCGGGGCGC
CGGCTCCATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGAT
CTTAGCCGCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGC
CTTGCAGATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGAT
GAAGGAAGCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGA
AGCCATGAGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGC
CATTGCGGTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTA
TGGGCACCTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCT
GGGCCACGGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATG
CGCCCGTGCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCAC
CGCTGTGTCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGC
AGACCACAGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAA
GCTGGCCCAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGA
CCCCGAGACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAG
CAAGCCAGTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAA
GGCAGTGGAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAA
AGACGTACCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGG
GAACTCATGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATC
CTTCCACCCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCA
CGTCTTGGTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCT
CATCCAGGCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGC
AGCATCCATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGA
ACAGATCTTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCA
AGGAAAGGTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGC
GACCAGCAGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGC
TTCCACGGCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGT
GAAAAGAGCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTT
TGTGGGGGGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCA
AATCCGCCAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGATGGCGAGCCCCAGGGGA
TGGCCCTGGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTCCCGGGTGAGCCTGGAGC
CCTGCGTGCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGTCCTACCCACAACTCCTC
TGCCGCCTCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAGAAAAGTCAGTATTATGT
TGTTCTCAGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGATAGGGAAAAAAATCATTG
ACGTCATAGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGAAACACAAACCCGTGTGG
ACTCCGGGAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCGCCCCTGTTTGCACGCTT
TCTTGCCTCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGATTATTTTGTTCCTCCGT
AGTCCAAAGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCCTTACCCTGCAGAGGCTG
TTTCAGCTCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTTAGCGTCCAGGGTGGGGA
TTCTGCTGGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGGTCACAAGCCCGGATTGG
AAAGGATCTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAAAATCTAAATGCATCCTA
AAATCAATGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGGATGTCACACTTCCAGAA
TTTCATATTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACCCTTAATCTGCACCTTTA
GCCAAGGCAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAGAATTCATAGTGGGGAAG
GTAAAAGTTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTCTCTCTCTCTCTCTGGTG
TGCTATCATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGGTCCTCCGAAGATGTCAC
CTTTCGACCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGACAGCTTCCCATATTTAT
AAGTTACTTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGTAAAGGAAAAGCAAGTGA
GAGTATGTGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCTGTTGGGGAAAAGCTGGC
ACACTCTTGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGGAGGGGCACACGTGCTTC
CAGAGACACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTGGGGATCCCCTCTGTGGC
CCAGCCCACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCCATCCTGAAAACCCAGGA
CCAAGGCAGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATACCAGAAAAGCCTCCAGAG
ACAAACCAAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCTATATAAATACTCACCTT
TCTGGAGTCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCTCATCTGTCCTTTCCTCA
TCCACCCTGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAAGGGCCATGCCTTGTCTG
GATGTTATTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAAATAACACAGGCATGAGT
TCATTTGGGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGGAGCATAGAAGTGTATCT
CTGTGAAGAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCCTTGGGCTGATTTTTGTG
CCAGAAATTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAATTTAGATTTTACTTGGG
CCTTTCAGGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGCCAGTGTCCAGCCAGCTG
TGGCCCTGGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCCAGGTCGGCTGCAGAGGC
AGCTGCCCAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTATCAGGGAAAACCCTTCG
AGCTTCTTCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGTTCCTAATTTATCAAAAA
ATTATAACCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCATCAAGGAACCAGACACA
GGTCAAAAGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGTTTCCTCCCTGGCAGATA
GTCCCCAGAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGATCTCAGCACAGACTATCA
GCATGTTCCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTTACCAACCCAAGAAATTT
GGAGACATTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCCAGTAGTGGCTCTGGTCC
TATCTCTCCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAAATGTCCTCAGTCTGTTG
CTCCATCTTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGGTTGATTCTTTTAAATGC
TACAAACAAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGCCCTCCAGGGAGCATCAG
TGTACCTGAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTCACCAACCTTCAAGATCC
AGAAGAAAACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATAAGTTATTTTTTTTTATT

>In-frame_NEDD4L_ENST00000589054_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_6779nt
AGTGAGAGGCGCCGGGGCTGCCGCCCGGTGCTCGGCGCGCTCTCGGGAGCCGCCCGCCCGCTGGTCCCGCAGCCTTCCGGGAGGAAGCGG
TGCCGGCAGCGTCCAGGGCGCGCTCTCGGGCACCCTCACCTGCCGGCGCCCGGCCGCTTACCCGGCAGGGCGTGCGCAGGGTAGGGTGCG
GGACCGGGGGGACCTGGAGGCAGAGGGGAGAACCGGCCGTCCGCGCCGCAGCACAGCCGCTGGGAGCGCCTCAGACCCCGCGCGGGGCGC
CGGCTCCATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGAT
CTTAGCCGCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGC
CTTGCAGATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGAT
GAAGGAAGCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGA
AGCCATGAGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGC
CATTGCGGTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTA
TGGGCACCTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCT
GGGCCACGGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATG
CGCCCGTGCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCAC
CGCTGTGTCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGC
AGACCACAGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAA
GCTGGCCCAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGA
CCCCGAGACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAG
CAAGCCAGTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAA
GGCAGTGGAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAA
AGACGTACCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGG
GAACTCATGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATC
CTTCCACCCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCA
CGTCTTGGTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCT
CATCCAGGCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGC
AGCATCCATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGA
ACAGATCTTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCA
AGGAAAGGTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGC
GACCAGCAGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGC
TTCCACGGCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGT
GAAAAGAGCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTT
TGTGGGGGGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCA
AATCCGCCAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGATGGCGAGCCCCAGGGGA
TGGCCCTGGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTCCCGGGTGAGCCTGGAGC
CCTGCGTGCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGTCCTACCCACAACTCCTC
TGCCGCCTCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAGAAAAGTCAGTATTATGT
TGTTCTCAGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGATAGGGAAAAAAATCATTG
ACGTCATAGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGAAACACAAACCCGTGTGG
ACTCCGGGAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCGCCCCTGTTTGCACGCTT
TCTTGCCTCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGATTATTTTGTTCCTCCGT
AGTCCAAAGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCCTTACCCTGCAGAGGCTG
TTTCAGCTCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTTAGCGTCCAGGGTGGGGA
TTCTGCTGGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGGTCACAAGCCCGGATTGG
AAAGGATCTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAAAATCTAAATGCATCCTA
AAATCAATGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGGATGTCACACTTCCAGAA
TTTCATATTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACCCTTAATCTGCACCTTTA
GCCAAGGCAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAGAATTCATAGTGGGGAAG
GTAAAAGTTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTCTCTCTCTCTCTCTGGTG
TGCTATCATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGGTCCTCCGAAGATGTCAC
CTTTCGACCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGACAGCTTCCCATATTTAT
AAGTTACTTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGTAAAGGAAAAGCAAGTGA
GAGTATGTGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCTGTTGGGGAAAAGCTGGC
ACACTCTTGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGGAGGGGCACACGTGCTTC
CAGAGACACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTGGGGATCCCCTCTGTGGC
CCAGCCCACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCCATCCTGAAAACCCAGGA
CCAAGGCAGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATACCAGAAAAGCCTCCAGAG
ACAAACCAAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCTATATAAATACTCACCTT
TCTGGAGTCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCTCATCTGTCCTTTCCTCA
TCCACCCTGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAAGGGCCATGCCTTGTCTG
GATGTTATTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAAATAACACAGGCATGAGT
TCATTTGGGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGGAGCATAGAAGTGTATCT
CTGTGAAGAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCCTTGGGCTGATTTTTGTG
CCAGAAATTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAATTTAGATTTTACTTGGG
CCTTTCAGGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGCCAGTGTCCAGCCAGCTG
TGGCCCTGGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCCAGGTCGGCTGCAGAGGC
AGCTGCCCAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTATCAGGGAAAACCCTTCG
AGCTTCTTCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGTTCCTAATTTATCAAAAA
ATTATAACCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCATCAAGGAACCAGACACA
GGTCAAAAGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGTTTCCTCCCTGGCAGATA
GTCCCCAGAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGATCTCAGCACAGACTATCA
GCATGTTCCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTTACCAACCCAAGAAATTT
GGAGACATTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCCAGTAGTGGCTCTGGTCC
TATCTCTCCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAAATGTCCTCAGTCTGTTG
CTCCATCTTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGGTTGATTCTTTTAAATGC
TACAAACAAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGCCCTCCAGGGAGCATCAG
TGTACCTGAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTCACCAACCTTCAAGATCC
AGAAGAAAACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATAAGTTATTTTTTTTTATT

>In-frame_NEDD4L_ENST00000382850_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_6615nt
CGCAGGGTAGGGTGCGGGACCGGGGGGACCTGGAGGCAGAGGGGAGAACCGGCCGTCCGCGCCGCAGCACAGCCGCTGGGAGCGCCTCAG
ACCCCGCGCGGGGCGCCGGCTCCATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCT
ATTTTGAGCCCTTGATCTTAGCCGCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGA
CTCTCGCAGAGTCTGCCTTGCAGATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAG
AGGCCGCCCAGTTGATGAAGGAAGCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGG
TGGACGCCATTGCAGAAGCCATGAGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGG
TTAAATACTCCAAAGCCATTGCGGTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCAC
AAATGACCAGTGACTATGGGCACCTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCA
CTCGTGTGCAGGACCTGGGCCACGGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGA
GGGAGCTGATCGAATGCGCCCGTGCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCAT
GCATTACAGCCGCCACCGCTGTGTCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGA
ACAGTGAGACCTTCGCAGACCACAGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTG
CGTCCACTCCTGACAAGCTGGCCCAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCA
GCCTGGGCTCCGACGACCCCGAGACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTA
CCAAGGGAGCTGCCAGCAAGCCAGTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGC
TCCTCAAGACTGTAAAGGCAGTGGAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTA
CGGTGTTCCAGTCAAAAGACGTACCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCA
AAGCCGTGGCAGCTGGGAACTCATGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGG
CTTGCAAGCAAGCATCCTTCCACCCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACT
TGGACCTCCTGGAGCACGTCTTGGTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCG
GCGCTGTGACAGAGCTCATCCAGGCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAG
AGTTACTGGGGGCTGCAGCATCCATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGA
CCCTGGACTTTGAGGAACAGATCTTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGA
GGGAGCTGGTGGCCCAAGGAAAGGTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCC
GGATGGTGGCGGCTGCGACCAGCAGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTG
CCAAGCAGGTCGCCGCTTCCACGGCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGG
CGGCAGGAAATGCTGTGAAAAGAGCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTG
TAGTGAAAACCAAGTTTGTGGGGGGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAA
GGAAAAAACTGGCCCAAATCCGCCAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGAT
GGCGAGCCCCAGGGGATGGCCCTGGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTCC
CGGGTGAGCCTGGAGCCCTGCGTGCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGTC
CTACCCACAACTCCTCTGCCGCCTCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAGA
AAAGTCAGTATTATGTTGTTCTCAGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGATA
GGGAAAAAAATCATTGACGTCATAGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGAA
ACACAAACCCGTGTGGACTCCGGGAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCGC
CCCTGTTTGCACGCTTTCTTGCCTCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGAT
TATTTTGTTCCTCCGTAGTCCAAAGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCCT
TACCCTGCAGAGGCTGTTTCAGCTCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTTA
GCGTCCAGGGTGGGGATTCTGCTGGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGGT
CACAAGCCCGGATTGGAAAGGATCTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAAA
ATCTAAATGCATCCTAAAATCAATGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGGA
TGTCACACTTCCAGAATTTCATATTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACCC
TTAATCTGCACCTTTAGCCAAGGCAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAGA
ATTCATAGTGGGGAAGGTAAAAGTTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTCT
CTCTCTCTCTCTGGTGTGCTATCATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGGT
CCTCCGAAGATGTCACCTTTCGACCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGAC
AGCTTCCCATATTTATAAGTTACTTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGTA
AAGGAAAAGCAAGTGAGAGTATGTGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCTG
TTGGGGAAAAGCTGGCACACTCTTGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGGA
GGGGCACACGTGCTTCCAGAGACACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTGG
GGATCCCCTCTGTGGCCCAGCCCACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCCA
TCCTGAAAACCCAGGACCAAGGCAGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATACC
AGAAAAGCCTCCAGAGACAAACCAAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCTA
TATAAATACTCACCTTTCTGGAGTCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCTC
ATCTGTCCTTTCCTCATCCACCCTGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAAG
GGCCATGCCTTGTCTGGATGTTATTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAAA
TAACACAGGCATGAGTTCATTTGGGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGGA
GCATAGAAGTGTATCTCTGTGAAGAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCCT
TGGGCTGATTTTTGTGCCAGAAATTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAAT
TTAGATTTTACTTGGGCCTTTCAGGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGCC
AGTGTCCAGCCAGCTGTGGCCCTGGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCCA
GGTCGGCTGCAGAGGCAGCTGCCCAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTAT
CAGGGAAAACCCTTCGAGCTTCTTCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGTT
CCTAATTTATCAAAAAATTATAACCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCAT
CAAGGAACCAGACACAGGTCAAAAGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGTT
TCCTCCCTGGCAGATAGTCCCCAGAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGATC
TCAGCACAGACTATCAGCATGTTCCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTTA
CCAACCCAAGAAATTTGGAGACATTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCCA
GTAGTGGCTCTGGTCCTATCTCTCCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAAA
TGTCCTCAGTCTGTTGCTCCATCTTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGGT
TGATTCTTTTAAATGCTACAAACAAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGCC
CTCCAGGGAGCATCAGTGTACCTGAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTCA
CCAACCTTCAAGATCCAGAAGAAAACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATAA

>In-frame_NEDD4L_ENST00000382850_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_6615nt
CGCAGGGTAGGGTGCGGGACCGGGGGGACCTGGAGGCAGAGGGGAGAACCGGCCGTCCGCGCCGCAGCACAGCCGCTGGGAGCGCCTCAG
ACCCCGCGCGGGGCGCCGGCTCCATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCT
ATTTTGAGCCCTTGATCTTAGCCGCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGA
CTCTCGCAGAGTCTGCCTTGCAGATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAG
AGGCCGCCCAGTTGATGAAGGAAGCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGG
TGGACGCCATTGCAGAAGCCATGAGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGG
TTAAATACTCCAAAGCCATTGCGGTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCAC
AAATGACCAGTGACTATGGGCACCTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCA
CTCGTGTGCAGGACCTGGGCCACGGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGA
GGGAGCTGATCGAATGCGCCCGTGCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCAT
GCATTACAGCCGCCACCGCTGTGTCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGA
ACAGTGAGACCTTCGCAGACCACAGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTG
CGTCCACTCCTGACAAGCTGGCCCAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCA
GCCTGGGCTCCGACGACCCCGAGACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTA
CCAAGGGAGCTGCCAGCAAGCCAGTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGC
TCCTCAAGACTGTAAAGGCAGTGGAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTA
CGGTGTTCCAGTCAAAAGACGTACCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCA
AAGCCGTGGCAGCTGGGAACTCATGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGG
CTTGCAAGCAAGCATCCTTCCACCCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACT
TGGACCTCCTGGAGCACGTCTTGGTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCG
GCGCTGTGACAGAGCTCATCCAGGCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAG
AGTTACTGGGGGCTGCAGCATCCATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGA
CCCTGGACTTTGAGGAACAGATCTTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGA
GGGAGCTGGTGGCCCAAGGAAAGGTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCC
GGATGGTGGCGGCTGCGACCAGCAGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTG
CCAAGCAGGTCGCCGCTTCCACGGCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGG
CGGCAGGAAATGCTGTGAAAAGAGCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTG
TAGTGAAAACCAAGTTTGTGGGGGGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAA
GGAAAAAACTGGCCCAAATCCGCCAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGAT
GGCGAGCCCCAGGGGATGGCCCTGGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTCC
CGGGTGAGCCTGGAGCCCTGCGTGCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGTC
CTACCCACAACTCCTCTGCCGCCTCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAGA
AAAGTCAGTATTATGTTGTTCTCAGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGATA
GGGAAAAAAATCATTGACGTCATAGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGAA
ACACAAACCCGTGTGGACTCCGGGAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCGC
CCCTGTTTGCACGCTTTCTTGCCTCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGAT
TATTTTGTTCCTCCGTAGTCCAAAGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCCT
TACCCTGCAGAGGCTGTTTCAGCTCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTTA
GCGTCCAGGGTGGGGATTCTGCTGGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGGT
CACAAGCCCGGATTGGAAAGGATCTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAAA
ATCTAAATGCATCCTAAAATCAATGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGGA
TGTCACACTTCCAGAATTTCATATTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACCC
TTAATCTGCACCTTTAGCCAAGGCAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAGA
ATTCATAGTGGGGAAGGTAAAAGTTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTCT
CTCTCTCTCTCTGGTGTGCTATCATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGGT
CCTCCGAAGATGTCACCTTTCGACCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGAC
AGCTTCCCATATTTATAAGTTACTTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGTA
AAGGAAAAGCAAGTGAGAGTATGTGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCTG
TTGGGGAAAAGCTGGCACACTCTTGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGGA
GGGGCACACGTGCTTCCAGAGACACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTGG
GGATCCCCTCTGTGGCCCAGCCCACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCCA
TCCTGAAAACCCAGGACCAAGGCAGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATACC
AGAAAAGCCTCCAGAGACAAACCAAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCTA
TATAAATACTCACCTTTCTGGAGTCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCTC
ATCTGTCCTTTCCTCATCCACCCTGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAAG
GGCCATGCCTTGTCTGGATGTTATTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAAA
TAACACAGGCATGAGTTCATTTGGGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGGA
GCATAGAAGTGTATCTCTGTGAAGAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCCT
TGGGCTGATTTTTGTGCCAGAAATTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAAT
TTAGATTTTACTTGGGCCTTTCAGGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGCC
AGTGTCCAGCCAGCTGTGGCCCTGGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCCA
GGTCGGCTGCAGAGGCAGCTGCCCAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTAT
CAGGGAAAACCCTTCGAGCTTCTTCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGTT
CCTAATTTATCAAAAAATTATAACCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCAT
CAAGGAACCAGACACAGGTCAAAAGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGTT
TCCTCCCTGGCAGATAGTCCCCAGAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGATC
TCAGCACAGACTATCAGCATGTTCCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTTA
CCAACCCAAGAAATTTGGAGACATTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCCA
GTAGTGGCTCTGGTCCTATCTCTCCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAAA
TGTCCTCAGTCTGTTGCTCCATCTTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGGT
TGATTCTTTTAAATGCTACAAACAAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGCC
CTCCAGGGAGCATCAGTGTACCTGAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTCA
CCAACCTTCAAGATCCAGAAGAAAACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATAA

>In-frame_NEDD4L_ENST00000256830_chr18_55711940_+_TLN2_ENST00000561311_chr15_63063163_+_6502nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC
CAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGATGGCGAGCCCCAGGGGATGGCCCT
GGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTCCCGGGTGAGCCTGGAGCCCTGCGT
GCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGTCCTACCCACAACTCCTCTGCCGCC
TCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAGAAAAGTCAGTATTATGTTGTTCTC
AGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGATAGGGAAAAAAATCATTGACGTCAT
AGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGAAACACAAACCCGTGTGGACTCCGG
GAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCGCCCCTGTTTGCACGCTTTCTTGCC
TCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGATTATTTTGTTCCTCCGTAGTCCAA
AGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCCTTACCCTGCAGAGGCTGTTTCAGC
TCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTTAGCGTCCAGGGTGGGGATTCTGCT
GGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGGTCACAAGCCCGGATTGGAAAGGAT
CTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAAAATCTAAATGCATCCTAAAATCAA
TGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGGATGTCACACTTCCAGAATTTCATA
TTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACCCTTAATCTGCACCTTTAGCCAAGG
CAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAGAATTCATAGTGGGGAAGGTAAAAG
TTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTCTCTCTCTCTCTCTGGTGTGCTATC
ATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGGTCCTCCGAAGATGTCACCTTTCGA
CCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGACAGCTTCCCATATTTATAAGTTAC
TTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGTAAAGGAAAAGCAAGTGAGAGTATG
TGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCTGTTGGGGAAAAGCTGGCACACTCT
TGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGGAGGGGCACACGTGCTTCCAGAGAC
ACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTGGGGATCCCCTCTGTGGCCCAGCCC
ACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCCATCCTGAAAACCCAGGACCAAGGC
AGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATACCAGAAAAGCCTCCAGAGACAAACC
AAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCTATATAAATACTCACCTTTCTGGAG
TCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCTCATCTGTCCTTTCCTCATCCACCC
TGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAAGGGCCATGCCTTGTCTGGATGTTA
TTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAAATAACACAGGCATGAGTTCATTTG
GGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGGAGCATAGAAGTGTATCTCTGTGAA
GAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCCTTGGGCTGATTTTTGTGCCAGAAA
TTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAATTTAGATTTTACTTGGGCCTTTCA
GGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGCCAGTGTCCAGCCAGCTGTGGCCCT
GGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCCAGGTCGGCTGCAGAGGCAGCTGCC
CAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTATCAGGGAAAACCCTTCGAGCTTCT
TCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGTTCCTAATTTATCAAAAAATTATAA
CCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCATCAAGGAACCAGACACAGGTCAAA
AGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGTTTCCTCCCTGGCAGATAGTCCCCA
GAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGATCTCAGCACAGACTATCAGCATGTT
CCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTTACCAACCCAAGAAATTTGGAGACA
TTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCCAGTAGTGGCTCTGGTCCTATCTCT
CCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAAATGTCCTCAGTCTGTTGCTCCATC
TTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGGTTGATTCTTTTAAATGCTACAAAC
AAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGCCCTCCAGGGAGCATCAGTGTACCT
GAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTCACCAACCTTCAAGATCCAGAAGAA
AACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATAAGTTATTTTTTTTTATTTGCCAGA

>In-frame_NEDD4L_ENST00000256830_chr18_55711940_+_TLN2_ENST00000306829_chr15_63063163_+_6502nt
ATGGCGACCGGGCTCGGGGAGCCGGTCTATGGACTTTCCGAAGACGAGGTGACACAACTGGCAAGCTATTTTGAGCCCTTGATCTTAGCC
GCAGTTGGTGTGGCCTCCAAGATTCTTGATCATCAGCAGCAGATGACGGTGCTGGACCAGACCAAGACTCTCGCAGAGTCTGCCTTGCAG
ATGTTGTATGCAGCCAAAGAAGGTGGCGGAAACCCCAAGGCACAACACACCCATGACGCCATCACAGAGGCCGCCCAGTTGATGAAGGAA
GCCGTGGATGACATCATGGTGACGCTGAACGAAGCTGCCAGTGAAGTGGGGCTGGTTGGGGGCATGGTGGACGCCATTGCAGAAGCCATG
AGCAAGCTGGATGAAGGCACTCCTCCAGAACCAAAGGGAACATTTGTCGACTATCAGACGACTGTGGTTAAATACTCCAAAGCCATTGCG
GTGACAGCTCAGGAAATGATGACTAAGTCGGTTACTAACCCGGAGGAGTTGGGAGGACTGGCTTCACAAATGACCAGTGACTATGGGCAC
CTGGCTTTCCAGGGCCAGATGGCAGCAGCCACGGCGGAACCAGAGGAGATCGGATTCCAGATTCGCACTCGTGTGCAGGACCTGGGCCAC
GGCTGTATCTTCCTGGTGCAGAAGGCAGGGGCCCTCCAGGTCTGCCCCACAGACAGCTACACCAAGAGGGAGCTGATCGAATGCGCCCGT
GCCGTCACGGAAAAGGTCTCCTTGGTGCTCTCGGCTCTCCAGGCCGGGAACAAAGGAACCCAGGCATGCATTACAGCCGCCACCGCTGTG
TCTGGGATCATTGCCGACCTGGACACCACCATTATGTTTGCAACAGCGGGGACGCTGAATGCAGAGAACAGTGAGACCTTCGCAGACCAC
AGGGAGAACATTCTCAAGACGGCCAAGGCCTTGGTAGAAGACACGAAACTACTTGTGTCAGGAGCTGCGTCCACTCCTGACAAGCTGGCC
CAGGCGGCCCAGTCCTCAGCAGCCACCATCACCCAGCTCGCAGAAGTGGTCAAGCTGGGGGCAGCCAGCCTGGGCTCCGACGACCCCGAG
ACCCAGGTGGTTTTGATCAATGCCATCAAAGATGTGGCCAAGGCCCTTTCTGATCTCATCAGTGCTACCAAGGGAGCTGCCAGCAAGCCA
GTGGACGACCCTTCCATGTACCAGCTCAAGGGGGCTGCCAAGGTGATGGTGACCAATGTCACCTCGCTCCTCAAGACTGTAAAGGCAGTG
GAGGATGAGGCCACCCGGGGCACCAGGGCGCTTGAGGCCACAATTGAATGCATAAAGCAGGAGCTTACGGTGTTCCAGTCAAAAGACGTA
CCTGAAAAGACATCATCACCTGAAGAATCCATAAGGATGACGAAAGGCATCACCATGGCAACAGCCAAAGCCGTGGCAGCTGGGAACTCA
TGTAGACAGGAGGACGTGATTGCTACTGCCAACCTGAGCCGGAAAGCCGTGTCAGATATGTTGACGGCTTGCAAGCAAGCATCCTTCCAC
CCCGATGTCAGTGACGAGGTGAGAACCAGAGCCTTGCGTTTCGGGACGGAGTGCACCCTTGGCTACTTGGACCTCCTGGAGCACGTCTTG
GTGATTCTTCAGAAACCAACCCCAGAATTCAAGCAGCAGCTGGCCGCTTTCTCCAAGCGAGTCGCCGGCGCTGTGACAGAGCTCATCCAG
GCGGCGGAAGCCATGAAAGGAACAGAGTGGGTGGATCCAGAAGACCCAACTGTCATTGCAGAAACAGAGTTACTGGGGGCTGCAGCATCC
ATCGAAGCTGCTGCTAAGAAGTTAGAGCAACTGAAGCCAAGAGCAAAACCAAAACAAGCGGATGAGACCCTGGACTTTGAGGAACAGATC
TTGGAAGCTGCTAAATCCATTGCTGCTGCCACAAGCGCCCTGGTCAAATCGGCCTCAGCAGCCCAGAGGGAGCTGGTGGCCCAAGGAAAG
GTGGGCTCCATCCCTGCCAATGCTGCAGACGACGGACAGTGGTCACAGGGGCTGATTTCTGCTGCCCGGATGGTGGCGGCTGCGACCAGC
AGTCTCTGTGAGGCGGCCAATGCCTCCGTTCAGGGACACGCCAGCGAGGAGAAGCTCATCTCATCTGCCAAGCAGGTCGCCGCTTCCACG
GCTCAGCTGCTGGTGGCCTGCAAGGTGAAGGCCGACCAGGATTCAGAGGCCATGAGGCGGCTACAGGCGGCAGGAAATGCTGTGAAAAGA
GCCTCAGACAATCTTGTCCGTGCAGCCCAGAAGGCAGCTTTTGGCAAAGCTGATGACGACGATGTTGTAGTGAAAACCAAGTTTGTGGGG
GGCATTGCTCAGATCATCGCCGCCCAGGAAGAAATGCTAAAGAAAGAGCGAGAACTGGAAGAAGCAAGGAAAAAACTGGCCCAAATCCGC
CAGCAGCAGTATAAGTTTTTACCCACCGAGCTGAGGGAAGATGAGGGCTAAAGGTGCGAGCCCAGATGGCGAGCCCCAGGGGATGGCCCT
GGCTGAACTGGACAGACAGTGTTCCTGAGAGGCTGGGCACTTAGCTGGAAACCGCCCACCTCCCTCCCGGGTGAGCCTGGAGCCCTGCGT
GCTTGTTCTCACATCTCTGTCCCGTCGGCACTGGCTGCATGATCGTGATGTCACACGGTACAATGTCCTACCCACAACTCCTCTGCCGCC
TCCCCTCATGCCTCACCGTGTCTCAGGAGAGAGGGGTGCACGTTTCATGGACTGTTACCAACAAAGAAAAGTCAGTATTATGTTGTTCTC
AGACACTTTGGCTTTTGTTGGTCCTTCTCTTAGGCCTGCTCCTGGACCTCTTTATGATATTGTGATAGGGAAAAAAATCATTGACGTCAT
AGAATATTCTTCTTCCTCTCAGGAGAAGACGGAAGCTGGAGTTGGACATGGTTCATAAAAGCCAGAAACACAAACCCGTGTGGACTCCGG
GAGGGTGACTCAGGTCCTCCTTCCATGTCTTGAGCACTGGCTCACCCAGGGGGTGAAAAATTCCCGCCCCTGTTTGCACGCTTTCTTGCC
TCCGTGTGTAAGCTCCTTGTACAACCCAGACCCATCTTGTATTTTGTGGCCCAGAAAACTGAACGATTATTTTGTTCCTCCGTAGTCCAA
AGGGCAGAGTTGCGGAAGGCCGTCGGGGCTTGGTGAGCAGGGGCTGTAATACAGTCTGTGGGCTCCTTACCCTGCAGAGGCTGTTTCAGC
TCACACAGAGTCATCCACACAAACCCACGGCTCCCAGTTGACAGTCAGTGGAATGCTCGTCTCCTTAGCGTCCAGGGTGGGGATTCTGCT
GGAATAAAGAGCTTCCTCAGTGACTCATCTTTAGGTCCCACGCTGGTTTCTGTGCCTTCAGAATGGTCACAAGCCCGGATTGGAAAGGAT
CTGCTTACAAACCTGTCCCCTGTCCTCCAACCCAAAACGCCTTTTTTTCTGTCTTAATATCCAGAAAATCTAAATGCATCCTAAAATCAA
TGTGAACCTTTAACAAGATAGTTTTACTTATTATCACATAAGACATAAGATGTTTTCATTTTCTGGATGTCACACTTCCAGAATTTCATA
TTTTTCCCCTCTTTTCTTTCCCCTTTTCAGAGCCCTCCCATAGGAAGGGAAGGGCTTGAATTTACCCTTAATCTGCACCTTTAGCCAAGG
CAGTGCATGGAAGATGAATGGCTCGTGGGACAGAATCTAATGCCAGGGAGCAGGAGTGTTTGAAAGAATTCATAGTGGGGAAGGTAAAAG
TTAATGGAAGTACATGATTTTCAAAACTGGTAACAGTTAAAGGCACTCACCCTCCGCCTCTCTCTCTCTCTCTCTCTCTGGTGTGCTATC
ATGTCTTGGACTCCATCCACACTATAGTTTCAAAGTTCCACTGACGGGGGAAAGTTGGTGCTTTGGTCCTCCGAAGATGTCACCTTTCGA
CCTTGCCCGATCTTGTTTCACCAGACTCTAGCCCATGTCATGGTTTTAAAATACATAAACTTCTGACAGCTTCCCATATTTATAAGTTAC
TTATAAGTGCTGCACGTATTAGAATTTTTTTTTTTCAGACCAGTAAAGTTAGAGAAAAGACGCTGTAAAGGAAAAGCAAGTGAGAGTATG
TGTAGGACACTGACAGTGTGTGGGCACCAGTTCTGAAGAGGAGGGGAGCTGCTGGAGCCCTAGCCTGTTGGGGAAAAGCTGGCACACTCT
TGGCTCGCCCTCTTTGAGTGGAGCTGATCCAACACCTCATGCCTGCCTTGGCCGGACACTGAGAGGAGGGGCACACGTGCTTCCAGAGAC
ACTCAGGAGTCAGACCCCAATGCTCAGAGTCACAATGTGTTCATGGCCTCCTGTAACAGGACTCTGGGGATCCCCTCTGTGGCCCAGCCC
ACCCCACCCTCTGCTCTTCTATGCTGTGCCCAGGGCAGCTGCCCTCTTCTGCCTGTGCCCCATCCCATCCTGAAAACCCAGGACCAAGGC
AGGGGCAGGCAGCCAGTTCTTCCACCTTGCCTCAGAGTCATTTAAAACCTTTACTGCATTTGATACCAGAAAAGCCTCCAGAGACAAACC
AAATGCAAAGGCCTTTCCTTTATAACTCTAAAGAACAGGCATCGAAAGTTTATTTTTGTAGGAGCTATATAAATACTCACCTTTCTGGAG
TCGTCCAGTGCTGGGAGCTTTGGGGAGTTTGGTTCTCAGTTATCACCTGGTATGGTCCCAGTTTCTCATCTGTCCTTTCCTCATCCACCC
TGCACATGTGTATGTGAACGGCTTCGTGGCCGGTGTGGTGGTTTCTCATTTCATAAGATAGTTGAAGGGCCATGCCTTGTCTGGATGTTA
TTTAATAGGCACTACTGCGGTGTCCTCAGATGGTACTGAGGGGGCCTTCTGGTCCTTCAAAGGAAAATAACACAGGCATGAGTTCATTTG
GGAGTGTGAACTTTCAGAACACCTAATAAGAGAGTGGTGTCAGAGTAAAAACGGCCCCAGGTCTGGAGCATAGAAGTGTATCTCTGTGAA
GAGAGAGCCGGTGTGTTGACATGTGGTTCTTCTCACACCCCTCTACTCCTCGAGGGCTTTGAATCCTTGGGCTGATTTTTGTGCCAGAAA
TTGCTGTTCCCGATGGCCAAAAGGGGAACCTGAACTGGATTTCAGAACTGCCCAGTGATTTGAAAATTTAGATTTTACTTGGGCCTTTCA
GGAGTCTTTAGATAGGGATGCTGAGGTCATATTTAGTTCAATGAACAGCCCTTGTTTAAGTTTTGCCAGTGTCCAGCCAGCTGTGGCCCT
GGCCATCTGTGCAGGCAGGTTCCTCAATTCCTGGTTGGCCCTGCAGTCGGTCAACACAGTCCCTCCAGGTCGGCTGCAGAGGCAGCTGCC
CAGCCTGCAGTCTATGCACGGGCCTTAAGAAATGAGCTGCCTGTAGCCTCACGGCATATGCTTTTATCAGGGAAAACCCTTCGAGCTTCT
TCTGATTCTCACCTGCTTGCTTTCTGGCTGTCTTAGTCAGTGTGTTTACAGGCAACTAAAGCCTGTTCCTAATTTATCAAAAAATTATAA
CCAAAATTCACCATAGCCTAAGAGAGTAAACCCCACCTCCAAAGTGATGCCAAGGCCAAAACCTCATCAAGGAACCAGACACAGGTCAAA
AGTGGTGAGCAAGCCATGGTCTCTGCTCCTGGGGAACTCACACGCTGACCCCCGAGGAGCCTTGGTTTCCTCCCTGGCAGATAGTCCCCA
GAATCTTCTCTCCCAGCTTTGAGGTTCTGGGCTCTGGAAAGGCCTCTGGGATGCTGGCCTTAAGATCTCAGCACAGACTATCAGCATGTT
CCATTCTCAGATTCCTGGAGGAAAGGTACCCTCTGTTGACCAAGGGGCTGGCTGCTTCTGAGACTTACCAACCCAAGAAATTTGGAGACA
TTCCCCTCAGGCTAAAAGGCAGCGGTCCCCAGAGTTCAGAAAGCAAAAGATCTTGACAACTGTGCCAGTAGTGGCTCTGGTCCTATCTCT
CCACAGTGCTGGCCTCTGCTGGGGAAGGCATCTTTCCCAAAGGTATCCCCAAGTACCATGTTGAAAATGTCCTCAGTCTGTTGCTCCATC
TTTCTGAGCCTCTGCTTGGTATGTCATGTTTATGGTCACTACGGATGAGTGTGTGCAGAGTTTGGGTTGATTCTTTTAAATGCTACAAAC
AAGAGCTATTTCTTTTCAATAAAAAAGGTTTGGATTCGGCCTCTTCCTCTGAGCCCACCTCCCAGCCCTCCAGGGAGCATCAGTGTACCT
GAGTCACTTTGTCTGCATCTCTTCATCCCACAAAACACGAGGCTGGGTCTCATTCAGCGGCCTCTCACCAACCTTCAAGATCCAGAAGAA
AACAGGAACGTTCAGCTCTGCCCTGTGTCGTATCTAATCACATACATTAATTTATCTAACCACATAAGTTATTTTTTTTTATTTGCCAGA


Top

FusionGenePPI for NEDD4L_TLN2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NEDD4LSFN, NR3C1, ARHGDIA, SCNN1A, SCNN1B, SCNN1G, NEDD4L, AMOT, YWHAG, YWHAZ, PSMD4, YWHAB, TNK2, OCLN, APBB1, TOLLIP, NDFIP1, KCNB1, MAPKAPK3, CLIC2, EFEMP2, HGS, NDFIP2, MAP3K3, VDAC2, ZDHHC3, CAMK1D, RANBP10, CDK5, ABL1, MAGEB1, DMTN, AICDA, MARK2, KCNAB1, FKBP3, DAPK3, BRAF, MAP3K5, DDX54, ZAK, KCNAB3, NTRK1, CUEDC1, RPS6KB2, ABL2, CACNB1, YY1, MAP3K2, BBX, PRKX, ACVR1B, ADAP2, BMPR1A, AKT3, MINK1, AURKC, NSRP1, WIBG, SGK2, UBAC1, RPL30, MERTK, SRMS, SERPINF1, DYRK3, IFRD2, SCD, ROBO3, TRIM41, TMA16, TAF1B, SPAG8, STAC, H1F0, PRR16, KIFC3, RASL10B, PRRG1, CDK3, KCNAB2, FGF12, RNF7, APEX2, MRPL19, TGFB1I1, TBC1D7, NHP2, TMEM55A, CYP26B1, DECR2, SENP2, SIVA1, RASL11B, MAP2, STK40, NUDT16L1, C7orf50, TCEAL2, ZC3HAV1L, MOB3A, TARBP2, ZADH2, WBP2, ELAVL1, YWHAH, SGK1, RAF1, TSC22D3, WNK4, WNK1, IKBKB, SMAD7, AMOTL1, UBE2D2, UBC, SMAD2, SMAD3, YWHAQ, NPC2, MT2A, ATP1B1, CYBRD1, SLC7A7, PBX1, ACY3, HAX1, KIF3B, KCNH2, CAV3, UBE2L3, UBE2K, UBE2D1, UBE2E3, UBE2J2, CDC34, ARRDC3, ARRDC4, MED28, FBXL15, LAPTM5, RNF11, KCNQ1, SGK3, UBE2D3, NOTCH1, AATF, GORAB, UBE2N, HCN1, SMAD6, SLC9A3, SNCA, WNK3, PTCH1, DAZAP2, MOV10, CCDC8, FAM189B, PRRG3, TMEM51, TMEM171, SUSD6, FAM189A2, WBP1, ARRDC1, TMEM92, TMEM52B, LDLRAD4, XPO1, LITAF, SLC22A11, SLC22A8, RHOB, CRYAB, GRB10, KCNA3, ULK1, ERBB3, PTK2B, GRIA1, ILDR1, TNFAIP3, TNFRSF19, LPAR1, EDEM3, TRIM25, SCN5A, UBE2E1, UBE2E2, UBE2L6TLN2PIP5K1C, TWF2, EXOC8, NUP93, ALB, SHFM1, RGCC, DCUN1D5, DDI2, DIAPH1, HAT1, SNF8, TRMT6, TRMT61A, TTC4, UBL7, CLK1, HNRNPD, SKP1, SYNCRIP, DGCR8, SGTB, CHMP4B, CDC5L, KANK4, CCND2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneTLN2chr18:55711940chr15:63063163ENST00000306829+3756312_40617322543PIP5K1C
TgeneTLN2chr18:55711940chr15:63063163ENST00000561311+3958312_40617322543PIP5K1C


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NEDD4L_TLN2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NEDD4L_TLN2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNEDD4LC0020538Hypertensive disease2CTD_human
HgeneNEDD4LC0008925Cleft Palate1CTD_human
HgeneNEDD4LC0014175Endometriosis1CTD_human
HgeneNEDD4LC0039075Syndactyly1CTD_human
HgeneNEDD4LC1868720Periventricular Nodular Heterotopia1CTD_human;ORPHANET