FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23943

FusionGeneSummary for NECAP2_EPHA2

check button Fusion gene summary
Fusion gene informationFusion gene name: NECAP2_EPHA2
Fusion gene ID: 23943
HgeneTgene
Gene symbol

NECAP2

EPHA2

Gene ID

55707

1969

Gene nameNECAP endocytosis associated 2EPH receptor A2
Synonyms-ARCC2|CTPA|CTPP1|CTRCT6|ECK
Cytomap

1p36.13

1p36.13

Type of geneprotein-codingprotein-coding
Descriptionadaptin ear-binding coat-associated protein 2adaptin-ear-binding coat-associated protein 2ephrin type-A receptor 2epithelial cell receptor protein tyrosine kinasesoluble EPHA2 variant 1tyrosine-protein kinase receptor ECK
Modification date2018052320180523
UniProtAcc

Q9NVZ3

P29317

Ensembl transtripts involved in fusion geneENST00000337132, ENST00000504551, 
ENST00000457722, ENST00000406746, 
ENST00000443980, ENST00000486390, 
ENST00000358432, ENST00000461614, 
Fusion gene scores* DoF score3 X 4 X 2=244 X 4 X 4=64
# samples 44
** MAII scorelog2(4/24*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NECAP2 [Title/Abstract] AND EPHA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneEPHA2

GO:0008630

intrinsic apoptotic signaling pathway in response to DNA damage

18339848

TgeneEPHA2

GO:0033628

regulation of cell adhesion mediated by integrin

10655584

TgeneEPHA2

GO:0043491

protein kinase B signaling

19573808

TgeneEPHA2

GO:0048013

ephrin receptor signaling pathway

10655584|20861311

TgeneEPHA2

GO:0051898

negative regulation of protein kinase B signaling

19573808


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVOVTCGA-25-2400-01ANECAP2chr1

16775696

+EPHA2chr1

16456914

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000337132ENST00000358432NECAP2chr1

16775696

+EPHA2chr1

16456914

-
5CDS-intronENST00000337132ENST00000461614NECAP2chr1

16775696

+EPHA2chr1

16456914

-
In-frameENST00000504551ENST00000358432NECAP2chr1

16775696

+EPHA2chr1

16456914

-
5CDS-intronENST00000504551ENST00000461614NECAP2chr1

16775696

+EPHA2chr1

16456914

-
In-frameENST00000457722ENST00000358432NECAP2chr1

16775696

+EPHA2chr1

16456914

-
5CDS-intronENST00000457722ENST00000461614NECAP2chr1

16775696

+EPHA2chr1

16456914

-
In-frameENST00000406746ENST00000358432NECAP2chr1

16775696

+EPHA2chr1

16456914

-
5CDS-intronENST00000406746ENST00000461614NECAP2chr1

16775696

+EPHA2chr1

16456914

-
In-frameENST00000443980ENST00000358432NECAP2chr1

16775696

+EPHA2chr1

16456914

-
5CDS-intronENST00000443980ENST00000461614NECAP2chr1

16775696

+EPHA2chr1

16456914

-
intron-3CDSENST00000486390ENST00000358432NECAP2chr1

16775696

+EPHA2chr1

16456914

-
intron-intronENST00000486390ENST00000461614NECAP2chr1

16775696

+EPHA2chr1

16456914

-

Top

FusionProtFeatures for NECAP2_EPHA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NECAP2

Q9NVZ3

EPHA2

P29317

Involved in endocytosis. {ECO:0000250}. Receptor tyrosine kinase which binds promiscuouslymembrane-bound ephrin-A family ligands residing on adjacent cells,leading to contact-dependent bidirectional signaling intoneighboring cells. The signaling pathway downstream of thereceptor is referred to as forward signaling while the signalingpathway downstream of the ephrin ligand is referred to as reversesignaling. Activated by the ligand ephrin-A1/EFNA1 regulatesmigration, integrin-mediated adhesion, proliferation anddifferentiation of cells. Regulates cell adhesion anddifferentiation through DSG1/desmoglein-1 and inhibition of theERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May alsoparticipate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration.During development, may function in distinctive aspects of patternformation and subsequently in development of several fetaltissues. Involved for instance in angiogenesis, in early hindbraindevelopment and epithelial proliferation and branchingmorphogenesis during mammary gland development. Engaged by theligand ephrin-A5/EFNA5 may regulate lens fiber cells shape andinteractions and be important for lens transparency developmentand maintenance. With ephrin-A2/EFNA2 may play a role in boneremodeling through regulation of osteoclastogenesis andosteoblastogenesis. {ECO:0000269|PubMed:10655584,ECO:0000269|PubMed:16236711, ECO:0000269|PubMed:18339848,ECO:0000269|PubMed:19573808, ECO:0000269|PubMed:20679435,ECO:0000269|PubMed:20861311, ECO:0000269|PubMed:23358419,ECO:0000269|PubMed:26158630, ECO:0000269|PubMed:27385333}. (Microbial infection) Acts as a receptor for hepatitis Cvirus (HCV) in hepatocytes and facilitates its cell entry.Mediates HCV entry by promoting the formation of the CD81-CLDN1receptor complexes that are essential for HCV entry and byenhancing membrane fusion of cells expressing HCV envelopeglycoproteins. {ECO:0000269|PubMed:21516087}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-1317904_968825977DomainSAM
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-1317974_976825977MotifPDZ-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNECAP2chr1:16775696chr1:16456914ENST00000337132+58240_243163264MotifNote=WXXF motif 1
HgeneNECAP2chr1:16775696chr1:16456914ENST00000337132+58260_263163264MotifNote=WXXF motif 2
HgeneNECAP2chr1:16775696chr1:16456914ENST00000406746+59240_243163321MotifNote=WXXF motif 1
HgeneNECAP2chr1:16775696chr1:16456914ENST00000406746+59260_263163321MotifNote=WXXF motif 2
HgeneNECAP2chr1:16775696chr1:16456914ENST00000443980+57240_243163274MotifNote=WXXF motif 1
HgeneNECAP2chr1:16775696chr1:16456914ENST00000443980+57260_263163274MotifNote=WXXF motif 2
HgeneNECAP2chr1:16775696chr1:16456914ENST00000457722+58240_243137238MotifNote=WXXF motif 1
HgeneNECAP2chr1:16775696chr1:16456914ENST00000457722+58260_263137238MotifNote=WXXF motif 2
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-1317188_325825977Compositional biasNote=Cys-rich
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-131728_206825977DomainEph LBD
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-1317328_432825977DomainFibronectin type-III 1
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-1317438_529825977DomainFibronectin type-III 2
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-1317613_875825977DomainProtein kinase
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-1317619_627825977Nucleotide bindingATP
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-131724_537825977Topological domainExtracellular
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-1317559_976825977Topological domainCytoplasmic
TgeneEPHA2chr1:16775696chr1:16456914ENST00000358432-1317538_558825977TransmembraneHelical


Top

FusionGeneSequence for NECAP2_EPHA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NECAP2_ENST00000337132_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_315aa
MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRY
FVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIAVMKAINDGFRLPTPMDC
PSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVSEWLESIKMQQTTEHFMAAGYTA

>In-frame_NECAP2_ENST00000504551_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_254aa
MEESGYESVLCVKPDVHVYRIPPRATNRGYRGALCSGPGGSVSWHSCGECDGFQQVLRDPHRRWKWWVKQQCEFAKQAQNPDQGPKLDLG
FKEGQTIKLNIAVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEG

>In-frame_NECAP2_ENST00000457722_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_289aa
MEESGAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAF
DFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIAVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIV
SILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVSEWLESIKMQQTTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRI

>In-frame_NECAP2_ENST00000406746_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_315aa
MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRY
FVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIAVMKAINDGFRLPTPMDC
PSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVSEWLESIKMQQTTEHFMAAGYTA

>In-frame_NECAP2_ENST00000443980_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_315aa
MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRY
FVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIAVMKAINDGFRLPTPMDC
PSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVSEWLESIKMQQTTEHFMAAGYTA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NECAP2_ENST00000337132_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_945nt
ATGGAGGAGAGCGGGTACGAGTCGGTGCTCTGTGTCAAGCCTGACGTCCACGTCTACCGCATCCCTCCGCGGGCTACCAACCGTGGCTAC
AGGGCTGCGGAGTGGCAGCTGGACCAGCCATCATGGAGTGGCCGGCTGAGGATCACTGCAAAGGGACAGATGGCCTACATCAAGCTGGAG
GACAGGACGTCAGGGGAGCTCTTTGCTCAGGCCCCGGTGGATCAGTTTCCTGGCACAGCTGTGGAGAGTGTGACGGATTCCAGCAGGTAC
TTCGTGATCCGCATCGAAGATGGAAATGGGCGACGGGCGTTTATTGGAATTGGCTTCGGGGACCGAGGTGATGCCTTTGACTTCAATGTT
GCATTGCAGGACCATTTCAAGTGGGTGAAACAGCAGTGTGAATTTGCAAAACAAGCCCAGAACCCAGACCAAGGCCCTAAACTGGACCTG
GGCTTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAGTGATGAAAGCCATCAATGATGGCTTCCGGCTCCCCACACCCATGGACTGC
CCCTCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGCAGGAGCGTGCCCGCCGCCCCAAGTTCGCTGACATCGTCAGCATCCTGGAC
AAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACCCCCGCGTGTCTATCCGGCTCCCCAGCACGAGCGGCTCGGAG
GGGGTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCATCAAGATGCAGCAGTATACGGAGCACTTCATGGCGGCCGGCTACACTGCC
ATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGGTGCGGCTGCCCGGCCACCAGAAGCGCATCGCCTACAGCCTG

>In-frame_NECAP2_ENST00000504551_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_762nt
ATGGAGGAGAGCGGGTACGAGTCGGTGCTCTGTGTCAAGCCTGACGTCCACGTCTACCGCATCCCTCCGCGGGCTACCAACCGTGGCTAC
AGGGGAGCTCTTTGCTCAGGCCCCGGTGGATCAGTTTCCTGGCACAGCTGTGGAGAGTGTGACGGATTCCAGCAGGTACTTCGTGATCCG
CATCGAAGATGGAAATGGTGGGTGAAACAGCAGTGTGAATTTGCAAAACAAGCCCAGAACCCAGACCAAGGCCCTAAACTGGACCTGGGC
TTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAGTGATGAAAGCCATCAATGATGGCTTCCGGCTCCCCACACCCATGGACTGCCCC
TCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGCAGGAGCGTGCCCGCCGCCCCAAGTTCGCTGACATCGTCAGCATCCTGGACAAG
CTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACCCCCGCGTGTCTATCCGGCTCCCCAGCACGAGCGGCTCGGAGGGG
GTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCATCAAGATGCAGCAGTATACGGAGCACTTCATGGCGGCCGGCTACACTGCCATC
GAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGGTGCGGCTGCCCGGCCACCAGAAGCGCATCGCCTACAGCCTGCTG

>In-frame_NECAP2_ENST00000457722_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_867nt
ATGGAGGAGAGCGGGGCTGCGGAGTGGCAGCTGGACCAGCCATCATGGAGTGGCCGGCTGAGGATCACTGCAAAGGGACAGATGGCCTAC
ATCAAGCTGGAGGACAGGACGTCAGGGGAGCTCTTTGCTCAGGCCCCGGTGGATCAGTTTCCTGGCACAGCTGTGGAGAGTGTGACGGAT
TCCAGCAGGTACTTCGTGATCCGCATCGAAGATGGAAATGGGCGACGGGCGTTTATTGGAATTGGCTTCGGGGACCGAGGTGATGCCTTT
GACTTCAATGTTGCATTGCAGGACCATTTCAAGTGGGTGAAACAGCAGTGTGAATTTGCAAAACAAGCCCAGAACCCAGACCAAGGCCCT
AAACTGGACCTGGGCTTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAGTGATGAAAGCCATCAATGATGGCTTCCGGCTCCCCACA
CCCATGGACTGCCCCTCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGCAGGAGCGTGCCCGCCGCCCCAAGTTCGCTGACATCGTC
AGCATCCTGGACAAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACCCCCGCGTGTCTATCCGGCTCCCCAGCACG
AGCGGCTCGGAGGGGGTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCATCAAGATGCAGCAGTATACGGAGCACTTCATGGCGGCC
GGCTACACTGCCATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGGTGCGGCTGCCCGGCCACCAGAAGCGCATC

>In-frame_NECAP2_ENST00000406746_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_945nt
ATGGAGGAGAGCGGGTACGAGTCGGTGCTCTGTGTCAAGCCTGACGTCCACGTCTACCGCATCCCTCCGCGGGCTACCAACCGTGGCTAC
AGGGCTGCGGAGTGGCAGCTGGACCAGCCATCATGGAGTGGCCGGCTGAGGATCACTGCAAAGGGACAGATGGCCTACATCAAGCTGGAG
GACAGGACGTCAGGGGAGCTCTTTGCTCAGGCCCCGGTGGATCAGTTTCCTGGCACAGCTGTGGAGAGTGTGACGGATTCCAGCAGGTAC
TTCGTGATCCGCATCGAAGATGGAAATGGGCGACGGGCGTTTATTGGAATTGGCTTCGGGGACCGAGGTGATGCCTTTGACTTCAATGTT
GCATTGCAGGACCATTTCAAGTGGGTGAAACAGCAGTGTGAATTTGCAAAACAAGCCCAGAACCCAGACCAAGGCCCTAAACTGGACCTG
GGCTTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAGTGATGAAAGCCATCAATGATGGCTTCCGGCTCCCCACACCCATGGACTGC
CCCTCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGCAGGAGCGTGCCCGCCGCCCCAAGTTCGCTGACATCGTCAGCATCCTGGAC
AAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACCCCCGCGTGTCTATCCGGCTCCCCAGCACGAGCGGCTCGGAG
GGGGTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCATCAAGATGCAGCAGTATACGGAGCACTTCATGGCGGCCGGCTACACTGCC
ATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGGTGCGGCTGCCCGGCCACCAGAAGCGCATCGCCTACAGCCTG

>In-frame_NECAP2_ENST00000443980_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_945nt
ATGGAGGAGAGCGGGTACGAGTCGGTGCTCTGTGTCAAGCCTGACGTCCACGTCTACCGCATCCCTCCGCGGGCTACCAACCGTGGCTAC
AGGGCTGCGGAGTGGCAGCTGGACCAGCCATCATGGAGTGGCCGGCTGAGGATCACTGCAAAGGGACAGATGGCCTACATCAAGCTGGAG
GACAGGACGTCAGGGGAGCTCTTTGCTCAGGCCCCGGTGGATCAGTTTCCTGGCACAGCTGTGGAGAGTGTGACGGATTCCAGCAGGTAC
TTCGTGATCCGCATCGAAGATGGAAATGGGCGACGGGCGTTTATTGGAATTGGCTTCGGGGACCGAGGTGATGCCTTTGACTTCAATGTT
GCATTGCAGGACCATTTCAAGTGGGTGAAACAGCAGTGTGAATTTGCAAAACAAGCCCAGAACCCAGACCAAGGCCCTAAACTGGACCTG
GGCTTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAGTGATGAAAGCCATCAATGATGGCTTCCGGCTCCCCACACCCATGGACTGC
CCCTCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGCAGGAGCGTGCCCGCCGCCCCAAGTTCGCTGACATCGTCAGCATCCTGGAC
AAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACCCCCGCGTGTCTATCCGGCTCCCCAGCACGAGCGGCTCGGAG
GGGGTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCATCAAGATGCAGCAGTATACGGAGCACTTCATGGCGGCCGGCTACACTGCC
ATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGGTGCGGCTGCCCGGCCACCAGAAGCGCATCGCCTACAGCCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_NECAP2_ENST00000337132_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_1913nt
GAAACCTGGTCAGAGAGTCGCACCGCTTCCGTCCGTCGGACAGAGGAACGGTGGAAGTCGCCGGAAGTTCGGTGGGCTCCAGGCGTCGCG
ATGGAGGAGAGCGGGTACGAGTCGGTGCTCTGTGTCAAGCCTGACGTCCACGTCTACCGCATCCCTCCGCGGGCTACCAACCGTGGCTAC
AGGGCTGCGGAGTGGCAGCTGGACCAGCCATCATGGAGTGGCCGGCTGAGGATCACTGCAAAGGGACAGATGGCCTACATCAAGCTGGAG
GACAGGACGTCAGGGGAGCTCTTTGCTCAGGCCCCGGTGGATCAGTTTCCTGGCACAGCTGTGGAGAGTGTGACGGATTCCAGCAGGTAC
TTCGTGATCCGCATCGAAGATGGAAATGGGCGACGGGCGTTTATTGGAATTGGCTTCGGGGACCGAGGTGATGCCTTTGACTTCAATGTT
GCATTGCAGGACCATTTCAAGTGGGTGAAACAGCAGTGTGAATTTGCAAAACAAGCCCAGAACCCAGACCAAGGCCCTAAACTGGACCTG
GGCTTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAGTGATGAAAGCCATCAATGATGGCTTCCGGCTCCCCACACCCATGGACTGC
CCCTCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGCAGGAGCGTGCCCGCCGCCCCAAGTTCGCTGACATCGTCAGCATCCTGGAC
AAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACCCCCGCGTGTCTATCCGGCTCCCCAGCACGAGCGGCTCGGAG
GGGGTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCATCAAGATGCAGCAGTATACGGAGCACTTCATGGCGGCCGGCTACACTGCC
ATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGGTGCGGCTGCCCGGCCACCAGAAGCGCATCGCCTACAGCCTG
CTGGGACTCAAGGACCAGGTGAACACTGTGGGGATCCCCATCTGAGCCTCGACAGGGCCTGGAGCCCCATCGGCCAAGAATACTTGAAGA
AACAGAGTGGCCTCCCTGCTGTGCCATGCTGGGCCACTGGGGACTTTATTTATTTCTAGTTCTTTCCTCCCCCTGCAACTTCCGCTGAGG
GGTCTCGGATGACACCCTGGCCTGAACTGAGGAGATGACCAGGGATGCTGGGCTGGGCCCTCTTTCCCTGCGAGACGCACACAGCTGAGC
ACTTAGCAGGCACCGCCACGTCCCAGCATCCCTGGAGCAGGAGCCCCGCCACAGCCTTCGGACAGACATATGGGATATTCCCAAGCCGAC
CTTCCCTCCGCCTTCTCCCACATGAGGCCATCTCAGGAGATGGAGGGCTTGGCCCAGCGCCAAGTAAACAGGGTACCTCAAGCCCCATTT
CCTCACACTAAGAGGGCAGACTGTGAACTTGACTGGGTGAGACCCAAAGCGGTCCCTGTCCCTCTAGTGCCTTCTTTAGACCCTCGGGCC
CCATCCTCATCCCTGACTGGCCAAACCCTTGCTTTCCTGGGCCTTTGCAAGATGCTTGGTTGTGTTGAGGTTTTTAAATATATATTTTGT
ACTTTGTGGAGAGAATGTGTGTGTGTGGCAGGGGGCCCCGCCAGGGCTGGGGACAGAGGGTGTCAAACATTCGTGAGCTGGGGACTCAGG
GACCGGTGCTGCAGGAGTGTCCTGCCCATGCCCCAGTCGGCCCCATCTCTCATCCTTTTGGATAAGTTTCTATTCTGTCAGTGTTAAAGA
TTTTGTTTTGTTGGACATTTTTTTCGAATCTTAATTTATTATTTTTTTTATATTTATTGTTAGAAAATGACTTATTTCTGCTCTGGAATA

>In-frame_NECAP2_ENST00000504551_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_1681nt
GGTGGAAGTCGCCGGAAGTTCGGTGGGCTCCAGGCGTCGCGATGGAGGAGAGCGGGTACGAGTCGGTGCTCTGTGTCAAGCCTGACGTCC
ACGTCTACCGCATCCCTCCGCGGGCTACCAACCGTGGCTACAGGGGAGCTCTTTGCTCAGGCCCCGGTGGATCAGTTTCCTGGCACAGCT
GTGGAGAGTGTGACGGATTCCAGCAGGTACTTCGTGATCCGCATCGAAGATGGAAATGGTGGGTGAAACAGCAGTGTGAATTTGCAAAAC
AAGCCCAGAACCCAGACCAAGGCCCTAAACTGGACCTGGGCTTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAGTGATGAAAGCCA
TCAATGATGGCTTCCGGCTCCCCACACCCATGGACTGCCCCTCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGCAGGAGCGTGCCC
GCCGCCCCAAGTTCGCTGACATCGTCAGCATCCTGGACAAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACCCCC
GCGTGTCTATCCGGCTCCCCAGCACGAGCGGCTCGGAGGGGGTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCATCAAGATGCAGC
AGTATACGGAGCACTTCATGGCGGCCGGCTACACTGCCATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGGTGC
GGCTGCCCGGCCACCAGAAGCGCATCGCCTACAGCCTGCTGGGACTCAAGGACCAGGTGAACACTGTGGGGATCCCCATCTGAGCCTCGA
CAGGGCCTGGAGCCCCATCGGCCAAGAATACTTGAAGAAACAGAGTGGCCTCCCTGCTGTGCCATGCTGGGCCACTGGGGACTTTATTTA
TTTCTAGTTCTTTCCTCCCCCTGCAACTTCCGCTGAGGGGTCTCGGATGACACCCTGGCCTGAACTGAGGAGATGACCAGGGATGCTGGG
CTGGGCCCTCTTTCCCTGCGAGACGCACACAGCTGAGCACTTAGCAGGCACCGCCACGTCCCAGCATCCCTGGAGCAGGAGCCCCGCCAC
AGCCTTCGGACAGACATATGGGATATTCCCAAGCCGACCTTCCCTCCGCCTTCTCCCACATGAGGCCATCTCAGGAGATGGAGGGCTTGG
CCCAGCGCCAAGTAAACAGGGTACCTCAAGCCCCATTTCCTCACACTAAGAGGGCAGACTGTGAACTTGACTGGGTGAGACCCAAAGCGG
TCCCTGTCCCTCTAGTGCCTTCTTTAGACCCTCGGGCCCCATCCTCATCCCTGACTGGCCAAACCCTTGCTTTCCTGGGCCTTTGCAAGA
TGCTTGGTTGTGTTGAGGTTTTTAAATATATATTTTGTACTTTGTGGAGAGAATGTGTGTGTGTGGCAGGGGGCCCCGCCAGGGCTGGGG
ACAGAGGGTGTCAAACATTCGTGAGCTGGGGACTCAGGGACCGGTGCTGCAGGAGTGTCCTGCCCATGCCCCAGTCGGCCCCATCTCTCA
TCCTTTTGGATAAGTTTCTATTCTGTCAGTGTTAAAGATTTTGTTTTGTTGGACATTTTTTTCGAATCTTAATTTATTATTTTTTTTATA

>In-frame_NECAP2_ENST00000457722_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_1783nt
GGAAGTCGCCGGAAGTTCGGTGGGCTCCAGGCGTCGCGATGGAGGAGAGCGGGGCTGCGGAGTGGCAGCTGGACCAGCCATCATGGAGTG
GCCGGCTGAGGATCACTGCAAAGGGACAGATGGCCTACATCAAGCTGGAGGACAGGACGTCAGGGGAGCTCTTTGCTCAGGCCCCGGTGG
ATCAGTTTCCTGGCACAGCTGTGGAGAGTGTGACGGATTCCAGCAGGTACTTCGTGATCCGCATCGAAGATGGAAATGGGCGACGGGCGT
TTATTGGAATTGGCTTCGGGGACCGAGGTGATGCCTTTGACTTCAATGTTGCATTGCAGGACCATTTCAAGTGGGTGAAACAGCAGTGTG
AATTTGCAAAACAAGCCCAGAACCCAGACCAAGGCCCTAAACTGGACCTGGGCTTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAG
TGATGAAAGCCATCAATGATGGCTTCCGGCTCCCCACACCCATGGACTGCCCCTCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGC
AGGAGCGTGCCCGCCGCCCCAAGTTCGCTGACATCGTCAGCATCCTGGACAAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTG
ACTTTGACCCCCGCGTGTCTATCCGGCTCCCCAGCACGAGCGGCTCGGAGGGGGTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCA
TCAAGATGCAGCAGTATACGGAGCACTTCATGGCGGCCGGCTACACTGCCATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGA
GGATTGGGGTGCGGCTGCCCGGCCACCAGAAGCGCATCGCCTACAGCCTGCTGGGACTCAAGGACCAGGTGAACACTGTGGGGATCCCCA
TCTGAGCCTCGACAGGGCCTGGAGCCCCATCGGCCAAGAATACTTGAAGAAACAGAGTGGCCTCCCTGCTGTGCCATGCTGGGCCACTGG
GGACTTTATTTATTTCTAGTTCTTTCCTCCCCCTGCAACTTCCGCTGAGGGGTCTCGGATGACACCCTGGCCTGAACTGAGGAGATGACC
AGGGATGCTGGGCTGGGCCCTCTTTCCCTGCGAGACGCACACAGCTGAGCACTTAGCAGGCACCGCCACGTCCCAGCATCCCTGGAGCAG
GAGCCCCGCCACAGCCTTCGGACAGACATATGGGATATTCCCAAGCCGACCTTCCCTCCGCCTTCTCCCACATGAGGCCATCTCAGGAGA
TGGAGGGCTTGGCCCAGCGCCAAGTAAACAGGGTACCTCAAGCCCCATTTCCTCACACTAAGAGGGCAGACTGTGAACTTGACTGGGTGA
GACCCAAAGCGGTCCCTGTCCCTCTAGTGCCTTCTTTAGACCCTCGGGCCCCATCCTCATCCCTGACTGGCCAAACCCTTGCTTTCCTGG
GCCTTTGCAAGATGCTTGGTTGTGTTGAGGTTTTTAAATATATATTTTGTACTTTGTGGAGAGAATGTGTGTGTGTGGCAGGGGGCCCCG
CCAGGGCTGGGGACAGAGGGTGTCAAACATTCGTGAGCTGGGGACTCAGGGACCGGTGCTGCAGGAGTGTCCTGCCCATGCCCCAGTCGG
CCCCATCTCTCATCCTTTTGGATAAGTTTCTATTCTGTCAGTGTTAAAGATTTTGTTTTGTTGGACATTTTTTTCGAATCTTAATTTATT

>In-frame_NECAP2_ENST00000406746_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_1861nt
GGAAGTCGCCGGAAGTTCGGTGGGCTCCAGGCGTCGCGATGGAGGAGAGCGGGTACGAGTCGGTGCTCTGTGTCAAGCCTGACGTCCACG
TCTACCGCATCCCTCCGCGGGCTACCAACCGTGGCTACAGGGCTGCGGAGTGGCAGCTGGACCAGCCATCATGGAGTGGCCGGCTGAGGA
TCACTGCAAAGGGACAGATGGCCTACATCAAGCTGGAGGACAGGACGTCAGGGGAGCTCTTTGCTCAGGCCCCGGTGGATCAGTTTCCTG
GCACAGCTGTGGAGAGTGTGACGGATTCCAGCAGGTACTTCGTGATCCGCATCGAAGATGGAAATGGGCGACGGGCGTTTATTGGAATTG
GCTTCGGGGACCGAGGTGATGCCTTTGACTTCAATGTTGCATTGCAGGACCATTTCAAGTGGGTGAAACAGCAGTGTGAATTTGCAAAAC
AAGCCCAGAACCCAGACCAAGGCCCTAAACTGGACCTGGGCTTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAGTGATGAAAGCCA
TCAATGATGGCTTCCGGCTCCCCACACCCATGGACTGCCCCTCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGCAGGAGCGTGCCC
GCCGCCCCAAGTTCGCTGACATCGTCAGCATCCTGGACAAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACCCCC
GCGTGTCTATCCGGCTCCCCAGCACGAGCGGCTCGGAGGGGGTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCATCAAGATGCAGC
AGTATACGGAGCACTTCATGGCGGCCGGCTACACTGCCATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGGTGC
GGCTGCCCGGCCACCAGAAGCGCATCGCCTACAGCCTGCTGGGACTCAAGGACCAGGTGAACACTGTGGGGATCCCCATCTGAGCCTCGA
CAGGGCCTGGAGCCCCATCGGCCAAGAATACTTGAAGAAACAGAGTGGCCTCCCTGCTGTGCCATGCTGGGCCACTGGGGACTTTATTTA
TTTCTAGTTCTTTCCTCCCCCTGCAACTTCCGCTGAGGGGTCTCGGATGACACCCTGGCCTGAACTGAGGAGATGACCAGGGATGCTGGG
CTGGGCCCTCTTTCCCTGCGAGACGCACACAGCTGAGCACTTAGCAGGCACCGCCACGTCCCAGCATCCCTGGAGCAGGAGCCCCGCCAC
AGCCTTCGGACAGACATATGGGATATTCCCAAGCCGACCTTCCCTCCGCCTTCTCCCACATGAGGCCATCTCAGGAGATGGAGGGCTTGG
CCCAGCGCCAAGTAAACAGGGTACCTCAAGCCCCATTTCCTCACACTAAGAGGGCAGACTGTGAACTTGACTGGGTGAGACCCAAAGCGG
TCCCTGTCCCTCTAGTGCCTTCTTTAGACCCTCGGGCCCCATCCTCATCCCTGACTGGCCAAACCCTTGCTTTCCTGGGCCTTTGCAAGA
TGCTTGGTTGTGTTGAGGTTTTTAAATATATATTTTGTACTTTGTGGAGAGAATGTGTGTGTGTGGCAGGGGGCCCCGCCAGGGCTGGGG
ACAGAGGGTGTCAAACATTCGTGAGCTGGGGACTCAGGGACCGGTGCTGCAGGAGTGTCCTGCCCATGCCCCAGTCGGCCCCATCTCTCA
TCCTTTTGGATAAGTTTCTATTCTGTCAGTGTTAAAGATTTTGTTTTGTTGGACATTTTTTTCGAATCTTAATTTATTATTTTTTTTATA

>In-frame_NECAP2_ENST00000443980_chr1_16775696_+_EPHA2_ENST00000358432_chr1_16456914_-_1849nt
AAGTTCGGTGGGCTCCAGGCGTCGCGATGGAGGAGAGCGGGTACGAGTCGGTGCTCTGTGTCAAGCCTGACGTCCACGTCTACCGCATCC
CTCCGCGGGCTACCAACCGTGGCTACAGGGCTGCGGAGTGGCAGCTGGACCAGCCATCATGGAGTGGCCGGCTGAGGATCACTGCAAAGG
GACAGATGGCCTACATCAAGCTGGAGGACAGGACGTCAGGGGAGCTCTTTGCTCAGGCCCCGGTGGATCAGTTTCCTGGCACAGCTGTGG
AGAGTGTGACGGATTCCAGCAGGTACTTCGTGATCCGCATCGAAGATGGAAATGGGCGACGGGCGTTTATTGGAATTGGCTTCGGGGACC
GAGGTGATGCCTTTGACTTCAATGTTGCATTGCAGGACCATTTCAAGTGGGTGAAACAGCAGTGTGAATTTGCAAAACAAGCCCAGAACC
CAGACCAAGGCCCTAAACTGGACCTGGGCTTCAAGGAGGGCCAGACCATCAAGCTCAACATCGCAGTGATGAAAGCCATCAATGATGGCT
TCCGGCTCCCCACACCCATGGACTGCCCCTCCGCCATCTACCAGCTCATGATGCAGTGCTGGCAGCAGGAGCGTGCCCGCCGCCCCAAGT
TCGCTGACATCGTCAGCATCCTGGACAAGCTCATTCGTGCCCCTGACTCCCTCAAGACCCTGGCTGACTTTGACCCCCGCGTGTCTATCC
GGCTCCCCAGCACGAGCGGCTCGGAGGGGGTGCCCTTCCGCACGGTGTCCGAGTGGCTGGAGTCCATCAAGATGCAGCAGTATACGGAGC
ACTTCATGGCGGCCGGCTACACTGCCATCGAGAAGGTGGTGCAGATGACCAACGACGACATCAAGAGGATTGGGGTGCGGCTGCCCGGCC
ACCAGAAGCGCATCGCCTACAGCCTGCTGGGACTCAAGGACCAGGTGAACACTGTGGGGATCCCCATCTGAGCCTCGACAGGGCCTGGAG
CCCCATCGGCCAAGAATACTTGAAGAAACAGAGTGGCCTCCCTGCTGTGCCATGCTGGGCCACTGGGGACTTTATTTATTTCTAGTTCTT
TCCTCCCCCTGCAACTTCCGCTGAGGGGTCTCGGATGACACCCTGGCCTGAACTGAGGAGATGACCAGGGATGCTGGGCTGGGCCCTCTT
TCCCTGCGAGACGCACACAGCTGAGCACTTAGCAGGCACCGCCACGTCCCAGCATCCCTGGAGCAGGAGCCCCGCCACAGCCTTCGGACA
GACATATGGGATATTCCCAAGCCGACCTTCCCTCCGCCTTCTCCCACATGAGGCCATCTCAGGAGATGGAGGGCTTGGCCCAGCGCCAAG
TAAACAGGGTACCTCAAGCCCCATTTCCTCACACTAAGAGGGCAGACTGTGAACTTGACTGGGTGAGACCCAAAGCGGTCCCTGTCCCTC
TAGTGCCTTCTTTAGACCCTCGGGCCCCATCCTCATCCCTGACTGGCCAAACCCTTGCTTTCCTGGGCCTTTGCAAGATGCTTGGTTGTG
TTGAGGTTTTTAAATATATATTTTGTACTTTGTGGAGAGAATGTGTGTGTGTGGCAGGGGGCCCCGCCAGGGCTGGGGACAGAGGGTGTC
AAACATTCGTGAGCTGGGGACTCAGGGACCGGTGCTGCAGGAGTGTCCTGCCCATGCCCCAGTCGGCCCCATCTCTCATCCTTTTGGATA
AGTTTCTATTCTGTCAGTGTTAAAGATTTTGTTTTGTTGGACATTTTTTTCGAATCTTAATTTATTATTTTTTTTATATTTATTGTTAGA


Top

FusionGenePPI for NECAP2_EPHA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NECAP2TRAF2, PLSCR1, AP2B1, NMI, AP1G1, GGA1, GGA2, EPS15, AP2M1, APP, HSPA8, FN1, AP2S1, CARM1, AP2A2, AP2A1, AP1B1, ZYG11B, FBXO11, NECAP1, TES, AP1M1, ITSN1, ANKRD28, MPI, UFC1, CEP170, CEP128, SCLT1, RUNDC3A, SPATA1EPHA2SLA, SHC1, GRB2, PIK3R1, PTK2, PTPN11, ACP1, ELAVL1, CBL, EPHA2, APP, EEF2, HSP90AA1, GATAD1, KPNA3, RBL1, NUDT9, ADRBK1, CDK17, PSME2, LSM7, ITGA3, ITGB1, ITGB3, ITGB5, ITGAV, CLTC, AP2M1, AP2B1, AP2A1, AP2S1, EPS15, UBE4A, EGFR, SLC25A41, TAS2R7, CCR1, TMEM185A, RD3, PIFO, NTRK1, TMEM17, TMEM216, FANCD2, SSR3, TGFBR1, ZBTB14, VPS4B, SCAMP3, HEXIM1, GOLIM4, NDUFA13, SMARCAD1, MRPS35, MICALL1, TSG101, CDH1, DUSP18, DUSP19, DUPD1, DUSP26, SDC1, CYP2S1, GJB7, LRRIQ1, NCSTN, NTRK3, MAS1, CIR1, SIGLECL1, TARDBP, MRAP2, PPM1L, ILKAP, PTPRR, PTPN7, DUSP14, STYX, TPTE, TPTE2, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NECAP2_EPHA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneEPHA2P29317DB08896RegorafenibEphrin type-A receptor 2small moleculeapproved
TgeneEPHA2P29317DB01254DasatinibEphrin type-A receptor 2small moleculeapproved|investigational

Top

RelatedDiseases for NECAP2_EPHA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneEPHA2C1861825CATARACT, POSTERIOR POLAR, 12UNIPROT
TgeneEPHA2C0028326Noonan Syndrome1CTD_human
TgeneEPHA2C0175704LEOPARD Syndrome1CTD_human