FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23787

FusionGeneSummary for NDRG1_ERG

check button Fusion gene summary
Fusion gene informationFusion gene name: NDRG1_ERG
Fusion gene ID: 23787
HgeneTgene
Gene symbol

NDRG1

ERG

Gene ID

10397

2078

Gene nameN-myc downstream regulated 1ERG, ETS transcription factor
SynonymsCAP43|CMT4D|DRG-1|DRG1|GC4|HMSNL|NDR1|NMSL|PROXY1|RIT42|RTP|TARG1|TDD5erg-3|p55
Cytomap

8q24.22

21q22.2

Type of geneprotein-codingprotein-coding
Descriptionprotein NDRG1N-myc downstream-regulated gene 1 proteindifferentiation-related gene 1 proteinnickel-specific induction protein Cap43protein regulated by oxygen-1reducing agents and tunicamycin-responsive proteintranscriptional regulator ERGFUS/ERG fusion proteinTMPRSS2/ERG fusionerythroblast transformation-specific transcription factor ERG variant 10ets-relatedtranscriptional regulator ERG (transforming protein ERG)v-ets avian erythroblastosis virus E26 on
Modification date2018052320180523
UniProtAcc

Q92597

P11308

Ensembl transtripts involved in fusion geneENST00000323851, ENST00000354944, 
ENST00000521414, ENST00000537882, 
ENST00000414097, ENST00000518176, 
ENST00000522476, ENST00000518066, 
ENST00000398907, ENST00000398905, 
ENST00000288319, ENST00000398897, 
ENST00000398911, ENST00000398910, 
ENST00000417133, ENST00000442448, 
ENST00000453032, ENST00000398919, 
ENST00000429727, ENST00000485493, 
Fusion gene scores* DoF score17 X 14 X 7=166613 X 15 X 8=1560
# samples 22226
** MAII scorelog2(22/1666*10)=-2.92081297184089
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(226/1560*10)=0.53477674355294
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: NDRG1 [Title/Abstract] AND ERG [Title/Abstract] AND fusion [Title/Abstract]

N-myc downstream regulated gene 1 (NDRG1) is fused to ERG in prostate cancer. (pmid: 19649210)
Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneERG

GO:0045944

positive regulation of transcription by RNA polymerase II

18195090|23913826


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-EJ-7314-01ANDRG1chr8

134292478

-ERGchr21

39817547

-
TCGALDPRADTCGA-KK-A8I6-01ANDRG1chr8

134292478

-ERGchr21

39817547

-
TCGALDPRADTCGA-V1-A8WW-01ANDRG1chr8

134292474

-ERGchr21

39817543

-
ChiTaRS3.1FJ627787NDRG1chr8

134296491

-ERGchr21

39817546

-
ChiTaRS3.1FJ627786NDRG1chr8

134292474

-ERGchr21

39817547

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000323851ENST00000398907NDRG1chr8

134292478

-ERGchr21

39817547

-
In-frameENST00000323851ENST00000398905NDRG1chr8

134292478

-ERGchr21

39817547

-
In-frameENST00000323851ENST00000288319NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000398897NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000398911NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000398910NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000417133NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000442448NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000453032NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000398919NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000429727NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000485493NDRG1chr8

134292478

-ERGchr21

39817547

-
In-frameENST00000354944ENST00000398907NDRG1chr8

134292478

-ERGchr21

39817547

-
In-frameENST00000354944ENST00000398905NDRG1chr8

134292478

-ERGchr21

39817547

-
In-frameENST00000354944ENST00000288319NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000398897NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000398911NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000398910NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000417133NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000442448NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000453032NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000398919NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000429727NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000485493NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000521414ENST00000398907NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000521414ENST00000398905NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000521414ENST00000288319NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000398897NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000398911NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000398910NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000417133NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000442448NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000453032NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000398919NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000429727NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000485493NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-3CDSENST00000537882ENST00000398907NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-3CDSENST00000537882ENST00000398905NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-3CDSENST00000537882ENST00000288319NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000398897NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000398911NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000398910NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000417133NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000442448NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000453032NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000398919NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000429727NDRG1chr8

134292478

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000485493NDRG1chr8

134292478

-ERGchr21

39817547

-
Frame-shitENST00000414097ENST00000398907NDRG1chr8

134292478

-ERGchr21

39817547

-
Frame-shitENST00000414097ENST00000398905NDRG1chr8

134292478

-ERGchr21

39817547

-
Frame-shitENST00000414097ENST00000288319NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000398897NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000398911NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000398910NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000417133NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000442448NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000453032NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000398919NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000429727NDRG1chr8

134292478

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000485493NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000518176ENST00000398907NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000518176ENST00000398905NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000518176ENST00000288319NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000398897NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000398911NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000398910NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000417133NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000442448NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000453032NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000398919NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000429727NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000485493NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000522476ENST00000398907NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000522476ENST00000398905NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000522476ENST00000288319NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000398897NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000398911NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000398910NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000417133NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000442448NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000453032NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000398919NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000429727NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000485493NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000518066ENST00000398907NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000518066ENST00000398905NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-3CDSENST00000518066ENST00000288319NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000398897NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000398911NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000398910NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000417133NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000442448NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000453032NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000398919NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000429727NDRG1chr8

134292478

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000485493NDRG1chr8

134292478

-ERGchr21

39817547

-
In-frameENST00000323851ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817543

-
In-frameENST00000323851ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817543

-
In-frameENST00000323851ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000323851ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000323851ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000323851ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000323851ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000323851ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000323851ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000323851ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000323851ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000323851ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817543

-
In-frameENST00000354944ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817543

-
In-frameENST00000354944ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817543

-
In-frameENST00000354944ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000354944ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000354944ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000354944ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000354944ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000354944ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000354944ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000354944ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000354944ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000354944ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000521414ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000521414ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000521414ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000521414ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000521414ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000521414ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000521414ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000521414ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000521414ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000521414ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000521414ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000521414ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-3CDSENST00000537882ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-3CDSENST00000537882ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-3CDSENST00000537882ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-intronENST00000537882ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-intronENST00000537882ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-intronENST00000537882ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-intronENST00000537882ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-intronENST00000537882ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-intronENST00000537882ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-intronENST00000537882ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-intronENST00000537882ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817543

-
5UTR-intronENST00000537882ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817543

-
Frame-shitENST00000414097ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817543

-
Frame-shitENST00000414097ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817543

-
Frame-shitENST00000414097ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000414097ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000414097ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000414097ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000414097ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000414097ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000414097ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000414097ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000414097ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817543

-
5CDS-intronENST00000414097ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000518176ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000518176ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000518176ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518176ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518176ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518176ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518176ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518176ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518176ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518176ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518176ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518176ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000522476ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000522476ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000522476ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000522476ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000522476ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000522476ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000522476ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000522476ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000522476ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000522476ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000522476ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000522476ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000518066ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000518066ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-3CDSENST00000518066ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518066ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518066ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518066ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518066ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518066ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518066ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518066ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518066ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817543

-
intron-intronENST00000518066ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817543

-
In-frameENST00000323851ENST00000398907NDRG1chr8

134296491

-ERGchr21

39817546

-
In-frameENST00000323851ENST00000398905NDRG1chr8

134296491

-ERGchr21

39817546

-
In-frameENST00000323851ENST00000288319NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000323851ENST00000398897NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000323851ENST00000398911NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000323851ENST00000398910NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000323851ENST00000417133NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000323851ENST00000442448NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000323851ENST00000453032NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000323851ENST00000398919NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000323851ENST00000429727NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000323851ENST00000485493NDRG1chr8

134296491

-ERGchr21

39817546

-
In-frameENST00000354944ENST00000398907NDRG1chr8

134296491

-ERGchr21

39817546

-
In-frameENST00000354944ENST00000398905NDRG1chr8

134296491

-ERGchr21

39817546

-
In-frameENST00000354944ENST00000288319NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000354944ENST00000398897NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000354944ENST00000398911NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000354944ENST00000398910NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000354944ENST00000417133NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000354944ENST00000442448NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000354944ENST00000453032NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000354944ENST00000398919NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000354944ENST00000429727NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000354944ENST00000485493NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000521414ENST00000398907NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000521414ENST00000398905NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000521414ENST00000288319NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000521414ENST00000398897NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000521414ENST00000398911NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000521414ENST00000398910NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000521414ENST00000417133NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000521414ENST00000442448NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000521414ENST00000453032NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000521414ENST00000398919NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000521414ENST00000429727NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000521414ENST00000485493NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-3CDSENST00000537882ENST00000398907NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-3CDSENST00000537882ENST00000398905NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-3CDSENST00000537882ENST00000288319NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-intronENST00000537882ENST00000398897NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-intronENST00000537882ENST00000398911NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-intronENST00000537882ENST00000398910NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-intronENST00000537882ENST00000417133NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-intronENST00000537882ENST00000442448NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-intronENST00000537882ENST00000453032NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-intronENST00000537882ENST00000398919NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-intronENST00000537882ENST00000429727NDRG1chr8

134296491

-ERGchr21

39817546

-
5UTR-intronENST00000537882ENST00000485493NDRG1chr8

134296491

-ERGchr21

39817546

-
Frame-shitENST00000414097ENST00000398907NDRG1chr8

134296491

-ERGchr21

39817546

-
Frame-shitENST00000414097ENST00000398905NDRG1chr8

134296491

-ERGchr21

39817546

-
Frame-shitENST00000414097ENST00000288319NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000414097ENST00000398897NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000414097ENST00000398911NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000414097ENST00000398910NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000414097ENST00000417133NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000414097ENST00000442448NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000414097ENST00000453032NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000414097ENST00000398919NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000414097ENST00000429727NDRG1chr8

134296491

-ERGchr21

39817546

-
5CDS-intronENST00000414097ENST00000485493NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000518176ENST00000398907NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000518176ENST00000398905NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000518176ENST00000288319NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518176ENST00000398897NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518176ENST00000398911NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518176ENST00000398910NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518176ENST00000417133NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518176ENST00000442448NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518176ENST00000453032NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518176ENST00000398919NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518176ENST00000429727NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518176ENST00000485493NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000522476ENST00000398907NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000522476ENST00000398905NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000522476ENST00000288319NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000522476ENST00000398897NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000522476ENST00000398911NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000522476ENST00000398910NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000522476ENST00000417133NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000522476ENST00000442448NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000522476ENST00000453032NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000522476ENST00000398919NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000522476ENST00000429727NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000522476ENST00000485493NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000518066ENST00000398907NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000518066ENST00000398905NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-3CDSENST00000518066ENST00000288319NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518066ENST00000398897NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518066ENST00000398911NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518066ENST00000398910NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518066ENST00000417133NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518066ENST00000442448NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518066ENST00000453032NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518066ENST00000398919NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518066ENST00000429727NDRG1chr8

134296491

-ERGchr21

39817546

-
intron-intronENST00000518066ENST00000485493NDRG1chr8

134296491

-ERGchr21

39817546

-
In-frameENST00000323851ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817547

-
In-frameENST00000323851ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817547

-
In-frameENST00000323851ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000323851ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817547

-
In-frameENST00000354944ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817547

-
In-frameENST00000354944ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817547

-
In-frameENST00000354944ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000354944ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000521414ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000521414ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000521414ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000521414ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-3CDSENST00000537882ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-3CDSENST00000537882ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-3CDSENST00000537882ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817547

-
5UTR-intronENST00000537882ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817547

-
Frame-shitENST00000414097ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817547

-
Frame-shitENST00000414097ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817547

-
Frame-shitENST00000414097ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817547

-
5CDS-intronENST00000414097ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000518176ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000518176ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000518176ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518176ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000522476ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000522476ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000522476ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000522476ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000518066ENST00000398907NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000518066ENST00000398905NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-3CDSENST00000518066ENST00000288319NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000398897NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000398911NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000398910NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000417133NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000442448NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000453032NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000398919NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000429727NDRG1chr8

134292474

-ERGchr21

39817547

-
intron-intronENST00000518066ENST00000485493NDRG1chr8

134292474

-ERGchr21

39817547

-

Top

FusionProtFeatures for NDRG1_ERG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NDRG1

Q92597

ERG

P11308

Stress-responsive protein involved in hormone responses,cell growth, and differentiation. Acts as a tumor suppressor inmany cell types. Necessary but not sufficient for p53/TP53-mediated caspase activation and apoptosis. Has a role in celltrafficking, notably of the Schwann cell, and is necessary for themaintenance and development of the peripheral nerve myelin sheath.Required for vesicular recycling of CDH1 and TF. May also functionin lipid trafficking. Protects cells from spindle disruptiondamage. Functions in p53/TP53-dependent mitotic spindlecheckpoint. Regulates microtubule dynamics and maintains euploidy.{ECO:0000269|PubMed:15247272, ECO:0000269|PubMed:15377670,ECO:0000269|PubMed:17786215, ECO:0000269|PubMed:9766676}. Transcriptional regulator. May participate intranscriptional regulation through the recruitment of SETDB1histone methyltransferase and subsequent modification of localchromatin structure.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneERGchr8:134292474chr21:39817543ENST00000288319-010318_3986480DNA bindingETS
TgeneERGchr8:134292474chr21:39817543ENST00000398897-09318_398-61364DNA bindingETS
TgeneERGchr8:134292474chr21:39817543ENST00000398911-110318_39813463DNA bindingETS
TgeneERGchr8:134292474chr21:39817543ENST00000398919-212318_39813487DNA bindingETS
TgeneERGchr8:134292474chr21:39817543ENST00000417133-212318_39813487DNA bindingETS
TgeneERGchr8:134292474chr21:39817543ENST00000442448-211318_39813463DNA bindingETS
TgeneERGchr8:134292474chr21:39817543ENST00000453032-09318_398-52388DNA bindingETS
TgeneERGchr8:134292474chr21:39817547ENST00000288319-010318_3986480DNA bindingETS
TgeneERGchr8:134292474chr21:39817547ENST00000398897-09318_398-61364DNA bindingETS
TgeneERGchr8:134292474chr21:39817547ENST00000398911-110318_39813463DNA bindingETS
TgeneERGchr8:134292474chr21:39817547ENST00000398919-212318_39813487DNA bindingETS
TgeneERGchr8:134292474chr21:39817547ENST00000417133-212318_39813487DNA bindingETS
TgeneERGchr8:134292474chr21:39817547ENST00000442448-211318_39813463DNA bindingETS
TgeneERGchr8:134292474chr21:39817547ENST00000453032-09318_398-52388DNA bindingETS
TgeneERGchr8:134292478chr21:39817547ENST00000288319-010318_3986480DNA bindingETS
TgeneERGchr8:134292478chr21:39817547ENST00000398897-09318_398-61364DNA bindingETS
TgeneERGchr8:134292478chr21:39817547ENST00000398911-110318_39813463DNA bindingETS
TgeneERGchr8:134292478chr21:39817547ENST00000398919-212318_39813487DNA bindingETS
TgeneERGchr8:134292478chr21:39817547ENST00000417133-212318_39813487DNA bindingETS
TgeneERGchr8:134292478chr21:39817547ENST00000442448-211318_39813463DNA bindingETS
TgeneERGchr8:134292478chr21:39817547ENST00000453032-09318_398-52388DNA bindingETS
TgeneERGchr8:134296491chr21:39817546ENST00000288319-010318_3986480DNA bindingETS
TgeneERGchr8:134296491chr21:39817546ENST00000398897-09318_398-61364DNA bindingETS
TgeneERGchr8:134296491chr21:39817546ENST00000398911-110318_39813463DNA bindingETS
TgeneERGchr8:134296491chr21:39817546ENST00000398919-212318_39813487DNA bindingETS
TgeneERGchr8:134296491chr21:39817546ENST00000417133-212318_39813487DNA bindingETS
TgeneERGchr8:134296491chr21:39817546ENST00000442448-211318_39813463DNA bindingETS
TgeneERGchr8:134296491chr21:39817546ENST00000453032-09318_398-52388DNA bindingETS
TgeneERGchr8:134292474chr21:39817543ENST00000288319-010120_2066480DomainPNT
TgeneERGchr8:134292474chr21:39817543ENST00000398897-09120_206-61364DomainPNT
TgeneERGchr8:134292474chr21:39817543ENST00000398911-110120_20613463DomainPNT
TgeneERGchr8:134292474chr21:39817543ENST00000398919-212120_20613487DomainPNT
TgeneERGchr8:134292474chr21:39817543ENST00000417133-212120_20613487DomainPNT
TgeneERGchr8:134292474chr21:39817543ENST00000442448-211120_20613463DomainPNT
TgeneERGchr8:134292474chr21:39817543ENST00000453032-09120_206-52388DomainPNT
TgeneERGchr8:134292474chr21:39817547ENST00000288319-010120_2066480DomainPNT
TgeneERGchr8:134292474chr21:39817547ENST00000398897-09120_206-61364DomainPNT
TgeneERGchr8:134292474chr21:39817547ENST00000398911-110120_20613463DomainPNT
TgeneERGchr8:134292474chr21:39817547ENST00000398919-212120_20613487DomainPNT
TgeneERGchr8:134292474chr21:39817547ENST00000417133-212120_20613487DomainPNT
TgeneERGchr8:134292474chr21:39817547ENST00000442448-211120_20613463DomainPNT
TgeneERGchr8:134292474chr21:39817547ENST00000453032-09120_206-52388DomainPNT
TgeneERGchr8:134292478chr21:39817547ENST00000288319-010120_2066480DomainPNT
TgeneERGchr8:134292478chr21:39817547ENST00000398897-09120_206-61364DomainPNT
TgeneERGchr8:134292478chr21:39817547ENST00000398911-110120_20613463DomainPNT
TgeneERGchr8:134292478chr21:39817547ENST00000398919-212120_20613487DomainPNT
TgeneERGchr8:134292478chr21:39817547ENST00000417133-212120_20613487DomainPNT
TgeneERGchr8:134292478chr21:39817547ENST00000442448-211120_20613463DomainPNT
TgeneERGchr8:134292478chr21:39817547ENST00000453032-09120_206-52388DomainPNT
TgeneERGchr8:134296491chr21:39817546ENST00000288319-010120_2066480DomainPNT
TgeneERGchr8:134296491chr21:39817546ENST00000398897-09120_206-61364DomainPNT
TgeneERGchr8:134296491chr21:39817546ENST00000398911-110120_20613463DomainPNT
TgeneERGchr8:134296491chr21:39817546ENST00000398919-212120_20613487DomainPNT
TgeneERGchr8:134296491chr21:39817546ENST00000417133-212120_20613487DomainPNT
TgeneERGchr8:134296491chr21:39817546ENST00000442448-211120_20613463DomainPNT
TgeneERGchr8:134296491chr21:39817546ENST00000453032-09120_206-52388DomainPNT

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNDRG1chr8:134292474chr21:39817543ENST00000323851-316339_36833395RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292474chr21:39817543ENST00000414097-316339_36833395RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292474chr21:39817543ENST00000522476-114339_368-73329RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292474chr21:39817543ENST00000537882-315339_368-13314RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292474chr21:39817547ENST00000323851-316339_36833395RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292474chr21:39817547ENST00000414097-316339_36833395RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292474chr21:39817547ENST00000522476-114339_368-73329RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292474chr21:39817547ENST00000537882-315339_368-13314RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292478chr21:39817547ENST00000323851-316339_36833395RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292478chr21:39817547ENST00000414097-316339_36833395RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292478chr21:39817547ENST00000522476-114339_368-73329RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292478chr21:39817547ENST00000537882-315339_368-13314RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134296491chr21:39817546ENST00000323851-216339_36821395RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134296491chr21:39817546ENST00000414097-216339_36821395RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134296491chr21:39817546ENST00000522476-114339_368-73329RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134296491chr21:39817546ENST00000537882-215339_368-25314RegionNote=3 X 10 AA tandem repeats of G-T-R-S-R-S-H-T-S-E
HgeneNDRG1chr8:134292474chr21:39817543ENST00000323851-316339_34833395RepeatNote=1
HgeneNDRG1chr8:134292474chr21:39817543ENST00000323851-316349_35833395RepeatNote=2
HgeneNDRG1chr8:134292474chr21:39817543ENST00000323851-316359_36833395RepeatNote=3
HgeneNDRG1chr8:134292474chr21:39817543ENST00000414097-316339_34833395RepeatNote=1
HgeneNDRG1chr8:134292474chr21:39817543ENST00000414097-316349_35833395RepeatNote=2
HgeneNDRG1chr8:134292474chr21:39817543ENST00000414097-316359_36833395RepeatNote=3
HgeneNDRG1chr8:134292474chr21:39817543ENST00000522476-114339_348-73329RepeatNote=1
HgeneNDRG1chr8:134292474chr21:39817543ENST00000522476-114349_358-73329RepeatNote=2
HgeneNDRG1chr8:134292474chr21:39817543ENST00000522476-114359_368-73329RepeatNote=3
HgeneNDRG1chr8:134292474chr21:39817543ENST00000537882-315339_348-13314RepeatNote=1
HgeneNDRG1chr8:134292474chr21:39817543ENST00000537882-315349_358-13314RepeatNote=2
HgeneNDRG1chr8:134292474chr21:39817543ENST00000537882-315359_368-13314RepeatNote=3
HgeneNDRG1chr8:134292474chr21:39817547ENST00000323851-316339_34833395RepeatNote=1
HgeneNDRG1chr8:134292474chr21:39817547ENST00000323851-316349_35833395RepeatNote=2
HgeneNDRG1chr8:134292474chr21:39817547ENST00000323851-316359_36833395RepeatNote=3
HgeneNDRG1chr8:134292474chr21:39817547ENST00000414097-316339_34833395RepeatNote=1
HgeneNDRG1chr8:134292474chr21:39817547ENST00000414097-316349_35833395RepeatNote=2
HgeneNDRG1chr8:134292474chr21:39817547ENST00000414097-316359_36833395RepeatNote=3
HgeneNDRG1chr8:134292474chr21:39817547ENST00000522476-114339_348-73329RepeatNote=1
HgeneNDRG1chr8:134292474chr21:39817547ENST00000522476-114349_358-73329RepeatNote=2
HgeneNDRG1chr8:134292474chr21:39817547ENST00000522476-114359_368-73329RepeatNote=3
HgeneNDRG1chr8:134292474chr21:39817547ENST00000537882-315339_348-13314RepeatNote=1
HgeneNDRG1chr8:134292474chr21:39817547ENST00000537882-315349_358-13314RepeatNote=2
HgeneNDRG1chr8:134292474chr21:39817547ENST00000537882-315359_368-13314RepeatNote=3
HgeneNDRG1chr8:134292478chr21:39817547ENST00000323851-316339_34833395RepeatNote=1
HgeneNDRG1chr8:134292478chr21:39817547ENST00000323851-316349_35833395RepeatNote=2
HgeneNDRG1chr8:134292478chr21:39817547ENST00000323851-316359_36833395RepeatNote=3
HgeneNDRG1chr8:134292478chr21:39817547ENST00000414097-316339_34833395RepeatNote=1
HgeneNDRG1chr8:134292478chr21:39817547ENST00000414097-316349_35833395RepeatNote=2
HgeneNDRG1chr8:134292478chr21:39817547ENST00000414097-316359_36833395RepeatNote=3
HgeneNDRG1chr8:134292478chr21:39817547ENST00000522476-114339_348-73329RepeatNote=1
HgeneNDRG1chr8:134292478chr21:39817547ENST00000522476-114349_358-73329RepeatNote=2
HgeneNDRG1chr8:134292478chr21:39817547ENST00000522476-114359_368-73329RepeatNote=3
HgeneNDRG1chr8:134292478chr21:39817547ENST00000537882-315339_348-13314RepeatNote=1
HgeneNDRG1chr8:134292478chr21:39817547ENST00000537882-315349_358-13314RepeatNote=2
HgeneNDRG1chr8:134292478chr21:39817547ENST00000537882-315359_368-13314RepeatNote=3
HgeneNDRG1chr8:134296491chr21:39817546ENST00000323851-216339_34821395RepeatNote=1
HgeneNDRG1chr8:134296491chr21:39817546ENST00000323851-216349_35821395RepeatNote=2
HgeneNDRG1chr8:134296491chr21:39817546ENST00000323851-216359_36821395RepeatNote=3
HgeneNDRG1chr8:134296491chr21:39817546ENST00000414097-216339_34821395RepeatNote=1
HgeneNDRG1chr8:134296491chr21:39817546ENST00000414097-216349_35821395RepeatNote=2
HgeneNDRG1chr8:134296491chr21:39817546ENST00000414097-216359_36821395RepeatNote=3
HgeneNDRG1chr8:134296491chr21:39817546ENST00000522476-114339_348-73329RepeatNote=1
HgeneNDRG1chr8:134296491chr21:39817546ENST00000522476-114349_358-73329RepeatNote=2
HgeneNDRG1chr8:134296491chr21:39817546ENST00000522476-114359_368-73329RepeatNote=3
HgeneNDRG1chr8:134296491chr21:39817546ENST00000537882-215339_348-25314RepeatNote=1
HgeneNDRG1chr8:134296491chr21:39817546ENST00000537882-215349_358-25314RepeatNote=2
HgeneNDRG1chr8:134296491chr21:39817546ENST00000537882-215359_368-25314RepeatNote=3


Top

FusionGeneSequence for NDRG1_ERG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NDRG1_ENST00000323851_chr8_134292478_-_ERG_ENST00000398907_chr21_39817547_-_484aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQR
ITTRPAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKS
KPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFF

>In-frame_NDRG1_ENST00000323851_chr8_134292478_-_ERG_ENST00000398905_chr21_39817547_-_483aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHPT
PQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSK
PNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFA

>In-frame_NDRG1_ENST00000323851_chr8_134292478_-_ERG_ENST00000288319_chr21_39817547_-_507aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQR
ITTRPDLPTEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWE
GTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHA

>In-frame_NDRG1_ENST00000354944_chr8_134292478_-_ERG_ENST00000398907_chr21_39817547_-_484aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQR
ITTRPAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKS
KPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFF

>In-frame_NDRG1_ENST00000354944_chr8_134292478_-_ERG_ENST00000398905_chr21_39817547_-_483aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHPT
PQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSK
PNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFA

>In-frame_NDRG1_ENST00000354944_chr8_134292478_-_ERG_ENST00000288319_chr21_39817547_-_507aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQR
ITTRPDLPTEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWE
GTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHA

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398907_chr21_39817543_-_484aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQR
ITTRPAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKS
KPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFF

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398905_chr21_39817543_-_483aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHPT
PQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSK
PNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFA

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000288319_chr21_39817543_-_507aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQR
ITTRPDLPTEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWE
GTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHA

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398907_chr21_39817543_-_484aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQR
ITTRPAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKS
KPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFF

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398905_chr21_39817543_-_483aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHPT
PQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSK
PNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFA

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000288319_chr21_39817543_-_507aa
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPAR
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLP
DVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQR
ITTRPDLPTEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWE
GTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHA

>In-frame_NDRG1_ENST00000323851_chr8_134296491_-_ERG_ENST00000398907_chr21_39817546_-_472aa
MSREMQDVDLAEVKPLVEKGEEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQV
NGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDG
KELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQRITTRPAAQPSPS
TVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRA
LRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTG

>In-frame_NDRG1_ENST00000323851_chr8_134296491_-_ERG_ENST00000398905_chr21_39817546_-_471aa
MSREMQDVDLAEVKPLVEKGEEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQV
NGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDG
KELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHPTPQSKAAQPSPST
VPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRAL
RYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGG

>In-frame_NDRG1_ENST00000323851_chr8_134296491_-_ERG_ENST00000288319_chr21_39817546_-_495aa
MSREMQDVDLAEVKPLVEKGEEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQV
NGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDG
KELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQRITTRPDLPTEPP
RRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPD
EVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHP

>In-frame_NDRG1_ENST00000354944_chr8_134296491_-_ERG_ENST00000398907_chr21_39817546_-_472aa
MSREMQDVDLAEVKPLVEKGEEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQV
NGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDG
KELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQRITTRPAAQPSPS
TVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRA
LRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTG

>In-frame_NDRG1_ENST00000354944_chr8_134296491_-_ERG_ENST00000398905_chr21_39817546_-_471aa
MSREMQDVDLAEVKPLVEKGEEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQV
NGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDG
KELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHPTPQSKAAQPSPST
VPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRAL
RYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGG

>In-frame_NDRG1_ENST00000354944_chr8_134296491_-_ERG_ENST00000288319_chr21_39817546_-_495aa
MSREMQDVDLAEVKPLVEKGEEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQV
NGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDG
KELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQRITTRPDLPTEPP
RRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPD
EVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHP

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398907_chr21_39817547_-_451aa
EALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGS
PDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNAD
ILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQRITTRPAAQPSPSTVPKTEDQRPQLDPTQILGPT
SSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYK
FDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398905_chr21_39817547_-_450aa
EALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGS
PDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNAD
ILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTS
SRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKF
DFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY_

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000288319_chr21_39817547_-_474aa
EALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGS
PDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNAD
ILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQRITTRPDLPTEPPRRSAWTGHGHPTPQSKAAQPS
PSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLS
RALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSP

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398907_chr21_39817547_-_451aa
EALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGS
PDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNAD
ILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQRITTRPAAQPSPSTVPKTEDQRPQLDPTQILGPT
SSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYK
FDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398905_chr21_39817547_-_450aa
EALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGS
PDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNAD
ILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTS
SRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKF
DFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY_

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000288319_chr21_39817547_-_474aa
EALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGS
PDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNAD
ILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQRITTRPDLPTEPPRRSAWTGHGHPTPQSKAAQPS
PSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLS
RALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NDRG1_ENST00000323851_chr8_134292478_-_ERG_ENST00000398907_chr21_39817547_-_1452nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGA
ATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTT
GGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAAC
TCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGC
AAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTAC
GCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCG
TACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTT
GCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGC

>In-frame_NDRG1_ENST00000323851_chr8_134292478_-_ERG_ENST00000398905_chr21_39817547_-_1449nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACG
CCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGA
CCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCC
AGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAA
CCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCC
TACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTAC
ATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCT
GCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACT

>In-frame_NDRG1_ENST00000323851_chr8_134292478_-_ERG_ENST00000288319_chr21_39817547_-_1521nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGA
ATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCT
CAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTT
GCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAA
GGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGAT
AAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCAC
GGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCC
CACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGG

>In-frame_NDRG1_ENST00000354944_chr8_134292478_-_ERG_ENST00000398907_chr21_39817547_-_1452nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGA
ATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTT
GGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAAC
TCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGC
AAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTAC
GCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCG
TACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTT
GCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGC

>In-frame_NDRG1_ENST00000354944_chr8_134292478_-_ERG_ENST00000398905_chr21_39817547_-_1449nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACG
CCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGA
CCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCC
AGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAA
CCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCC
TACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTAC
ATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCT
GCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACT

>In-frame_NDRG1_ENST00000354944_chr8_134292478_-_ERG_ENST00000288319_chr21_39817547_-_1521nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGA
ATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCT
CAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTT
GCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAA
GGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGAT
AAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCAC
GGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCC
CACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGG

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398907_chr21_39817543_-_1452nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGA
ATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTT
GGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAAC
TCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGC
AAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTAC
GCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCG
TACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTT
GCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGC

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398905_chr21_39817543_-_1449nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACG
CCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGA
CCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCC
AGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAA
CCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCC
TACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTAC
ATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCT
GCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACT

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000288319_chr21_39817543_-_1521nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGA
ATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCT
CAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTT
GCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAA
GGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGAT
AAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCAC
GGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCC
CACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGG

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398907_chr21_39817543_-_1452nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGA
ATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTT
GGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAAC
TCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGC
AAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTAC
GCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCG
TACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTT
GCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGC

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398905_chr21_39817543_-_1449nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACG
CCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGA
CCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCC
AGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAA
CCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCC
TACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTAC
ATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCT
GCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACT

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000288319_chr21_39817543_-_1521nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTT
GATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATG
ACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGG
GTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATG
GTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGC
AGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCA
GACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTAC
AACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAA
AACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGA
ATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCT
CAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTT
GCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAA
GGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGAT
AAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCAC
GGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCC
CACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGG

>In-frame_NDRG1_ENST00000323851_chr8_134296491_-_ERG_ENST00000398907_chr21_39817546_-_1416nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGGAAGCCTTATCAGTTGTGAGTGAGGAC
CAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCC
AAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTG
AATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGC
AGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGT
ACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGG
AAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTC
AGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGG
GGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCC
ACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGT
GGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAG
TTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCC
CTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCC
CTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATG
AACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGG

>In-frame_NDRG1_ENST00000323851_chr8_134296491_-_ERG_ENST00000398905_chr21_39817546_-_1413nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGGAAGCCTTATCAGTTGTGAGTGAGGAC
CAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCC
AAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTG
AATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGC
AGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGT
ACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGG
AAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTC
AGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGAT
TTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACA
GTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGC
CAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTC
AAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTC
CGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTC
CAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAAC
TTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGT

>In-frame_NDRG1_ENST00000323851_chr8_134296491_-_ERG_ENST00000288319_chr21_39817546_-_1485nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGGAAGCCTTATCAGTTGTGAGTGAGGAC
CAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCC
AAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTG
AATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGC
AGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGT
ACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGG
AAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTC
AGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGG
GGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCC
AGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGAC
CAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAG
TTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGAC
GAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAG
AACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAG
TCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCT
CCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGG

>In-frame_NDRG1_ENST00000354944_chr8_134296491_-_ERG_ENST00000398907_chr21_39817546_-_1416nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGGAAGCCTTATCAGTTGTGAGTGAGGAC
CAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCC
AAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTG
AATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGC
AGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGT
ACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGG
AAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTC
AGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGG
GGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCC
ACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGT
GGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAG
TTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCC
CTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCC
CTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATG
AACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGG

>In-frame_NDRG1_ENST00000354944_chr8_134296491_-_ERG_ENST00000398905_chr21_39817546_-_1413nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGGAAGCCTTATCAGTTGTGAGTGAGGAC
CAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCC
AAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTG
AATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGC
AGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGT
ACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGG
AAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTC
AGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGAT
TTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACA
GTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGC
CAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTC
AAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTC
CGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTC
CAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAAC
TTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGT

>In-frame_NDRG1_ENST00000354944_chr8_134296491_-_ERG_ENST00000288319_chr21_39817546_-_1485nt
ATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAGGGGAGGAAGCCTTATCAGTTGTGAGTGAGGAC
CAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCC
AAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTG
AATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGC
AGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGT
ACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGG
AAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTC
AGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGG
GGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCC
AGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGAC
CAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAG
TTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGAC
GAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAG
AACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAG
TCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCT
CCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGG

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398907_chr21_39817547_-_1353nt
GAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCC
TCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATC
AAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGC
CCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATC
GTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAAC
ATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGAC
ATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCA
CGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACT
AGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACA
AGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGC
ATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAAC
ATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAG
TTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGC
TCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCA
AACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTAC

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398905_chr21_39817547_-_1350nt
GAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCC
TCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATC
AAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGC
CCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATC
GTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAAC
ATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGAC
ATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCA
CGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCG
AAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGT
AGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATC
ACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATG
AACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTC
GACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCC
TATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAAC
CCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAA

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000288319_chr21_39817547_-_1422nt
GAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCC
TCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATC
AAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGC
CCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATC
GTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAAC
ATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGAC
ATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCA
CGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACT
AGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCT
CCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCA
GGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAAC
GGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGC
CGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCC
CAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAG
AAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCA

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398907_chr21_39817547_-_1353nt
GAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCC
TCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATC
AAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGC
CCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATC
GTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAAC
ATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGAC
ATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCA
CGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACT
AGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACA
AGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGC
ATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAAC
ATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAG
TTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGC
TCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCA
AACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTAC

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398905_chr21_39817547_-_1350nt
GAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCC
TCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATC
AAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGC
CCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATC
GTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAAC
ATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGAC
ATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCA
CGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCG
AAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGT
AGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATC
ACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATG
AACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTC
GACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCC
TATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAAC
CCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAA

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000288319_chr21_39817547_-_1422nt
GAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCC
TCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATC
AAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGC
CCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATC
GTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAAC
ATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGAC
ATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCA
CGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACT
AGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCT
CCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCA
GGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAAC
GGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGC
CGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCC
CAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAG
AAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NDRG1_ENST00000323851_chr8_134292478_-_ERG_ENST00000398907_chr21_39817547_-_4950nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCT
ACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTC
AGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTG
ATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACA
TGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGC
TGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCA
AGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATT
TGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAA
ATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACC
AGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGT
TCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACG
AGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGA
ACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGT
CATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTC
CAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGC
TCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCAT
CGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAA
GAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCAT
CTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATA
AACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGT
TTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCA
TCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTC
AAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGT
GAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCA
ATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAG
TGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAAT
GAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTA
AGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGT
GCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTG
ATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATAT
GAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTT
GCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTG
TGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATT
TCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGG
GTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACA
AGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATA
ACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTG
TGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTG
GGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGG
CGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTT
TTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCT
CCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTC
CTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTT
GGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCAT
GAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCA
GGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTT
CAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCT
GTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTT
GTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATG
TCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACC
TGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGG
GCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTA
TTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACTCAAAAATACACCAAA

>In-frame_NDRG1_ENST00000323851_chr8_134292478_-_ERG_ENST00000398905_chr21_39817547_-_4947nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCT
ACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTC
AGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTG
ATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACA
TGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGC
TGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCA
AGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATT
TGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGA
GATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGC
GTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCC
TCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGG
TGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACA
TCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCAT
CTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAG
CCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCC
CCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGC
CACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAG
ATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTG
TGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAAC
TTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTA
TAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCA
ACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAA
CTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAG
CGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATG
AAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGT
TAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAA
AATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGA
GATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCG
TTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATC
TCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAA
GTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCA
CTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGC
AAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCT
AGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTT
GTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGC
TACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACG
TCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGG
CTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGC
ATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGC
TAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTG
CTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCT
GACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTT
AGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGA
ATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAG
CAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGT
TATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAA
AATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTT
TGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTC
TTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCC
CGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGC
AACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCA
CAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTT

>In-frame_NDRG1_ENST00000323851_chr8_134292478_-_ERG_ENST00000288319_chr21_39817547_-_5019nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCT
ACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTC
AGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTG
ATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACA
TGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGC
TGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCA
AGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATT
TGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAA
ATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTC
ACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTT
ATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGG
ACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAG
AGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATG
GGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCT
CAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTT
CCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTT
CTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGA
ACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGA
GGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAA
GACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGA
ATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAA
AACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAA
CTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAA
GTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGA
GGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACA
TTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGC
GTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGT
CTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGC
CACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTAT
ACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACAC
ACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAAT
GCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAA
GTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAA
TAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGA
AGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAG
TTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAA
CTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGG
TTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCC
TGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCAC
AAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGC
TGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTT
GCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTG
GATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATA
CAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACA
CCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAG
ACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGA
GCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTG
TTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCT
TGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGC
CTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGT
GCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCC
GGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGT
TCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCAT

>In-frame_NDRG1_ENST00000354944_chr8_134292478_-_ERG_ENST00000398907_chr21_39817547_-_4965nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGT
TGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGA
GCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCT
CAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACA
TGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACC
ATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAAC
TGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGA
CTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAG
CTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGC
CCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGA
TCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGA
TGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTT
ACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGC
CCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTG
TGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATAT
ACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTG
CATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGG
AAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGA
ATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGT
CTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTT
GACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAG
AGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACA
GCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGA
GGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAA
GAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTG
TTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTT
CTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCT
CCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTG
AGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTT
ATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCT
TAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATA
CAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACT
TTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCC
CTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAG
GCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTT
GTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTA
CAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGA
GTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTA
GAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAG
GTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTT
CACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGAC
ACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACA
AAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATC
AGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCT
TCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCC
TCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATA
ATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCAT
GAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGAT
TTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAG
TTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTG
CACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGC
TGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTT
TAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACT

>In-frame_NDRG1_ENST00000354944_chr8_134292478_-_ERG_ENST00000398905_chr21_39817547_-_4962nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGT
TGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGA
GCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCT
CAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACA
TGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACC
ATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAAC
TGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGA
CTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCAT
ATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCA
AAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCC
AGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGA
CGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACT
ACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCC
ACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGG
CGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACC
CCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCAT
TCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAG
GAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATA
TGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTT
AAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGAC
CTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGA
GACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCT
GTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGA
TGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAA
ACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTA
TACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTT
TGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCA
CAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGT
CGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATA
CACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAA
TGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAG
GAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTG
TCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTC
CTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCC
TATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTT
GAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAG
AAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTT
ACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAG
TCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTG
ACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCAC
GTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACG
ATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAG
TGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGT
CATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCA
AGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCC
ACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATT
CTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAA
CCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTG
TCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTT
GATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCAC
AGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGG
GAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAA
AAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACTCAA

>In-frame_NDRG1_ENST00000354944_chr8_134292478_-_ERG_ENST00000288319_chr21_39817547_-_5034nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGT
TGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGA
GCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCT
CAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACA
TGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACC
ATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAAC
TGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGA
CTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAG
CTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGAT
CAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTC
CTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCC
TGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGG
CCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCA
TGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTC
TGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCC
TCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCA
CCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCAC
AAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATC
CAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGG
ACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTT
AGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAA
TGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACA
GACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTG
TGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGT
GTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAG
ACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAG
GAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAAT
TTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGAT
GGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTT
GTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCG
GCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTT
ATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTT
TTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAG
GGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGC
CCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTC
ATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTAC
CACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCT
AGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTT
GGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATC
TTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAG
CCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTA
TGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGAC
ACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGG
GAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATG
CAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAA
GATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTAT
TAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAAT
GGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGT
CCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTC
AATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGG
AGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAAC
CCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAG
GGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGC

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398907_chr21_39817543_-_4950nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCT
ACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTC
AGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTG
ATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACA
TGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGC
TGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCA
AGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATT
TGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAA
ATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACC
AGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGT
TCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACG
AGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGA
ACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGT
CATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTC
CAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGC
TCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCAT
CGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAA
GAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCAT
CTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATA
AACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGT
TTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCA
TCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTC
AAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGT
GAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCA
ATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAG
TGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAAT
GAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTA
AGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGT
GCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTG
ATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATAT
GAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTT
GCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTG
TGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATT
TCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGG
GTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACA
AGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATA
ACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTG
TGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTG
GGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGG
CGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTT
TTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCT
CCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTC
CTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTT
GGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCAT
GAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCA
GGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTT
CAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCT
GTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTT
GTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATG
TCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACC
TGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGG
GCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTA
TTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACTCAAAAATACACCAAA

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398905_chr21_39817543_-_4947nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCT
ACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTC
AGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTG
ATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACA
TGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGC
TGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCA
AGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATT
TGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGA
GATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGC
GTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCC
TCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGG
TGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACA
TCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCAT
CTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAG
CCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCC
CCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGC
CACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAG
ATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTG
TGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAAC
TTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTA
TAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCA
ACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAA
CTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAG
CGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATG
AAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGT
TAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAA
AATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGA
GATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCG
TTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATC
TCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAA
GTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCA
CTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGC
AAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCT
AGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTT
GTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGC
TACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACG
TCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGG
CTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGC
ATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGC
TAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTG
CTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCT
GACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTT
AGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGA
ATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAG
CAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGT
TATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAA
AATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTT
TGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTC
TTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCC
CGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGC
AACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCA
CAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTT

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000288319_chr21_39817543_-_5019nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCT
ACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTC
AGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTG
ATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACA
TGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGC
TGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCA
AGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATT
TGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAA
ATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTC
ACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTT
ATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGG
ACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAG
AGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATG
GGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCT
CAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTT
CCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTT
CTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGA
ACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGA
GGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAA
GACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGA
ATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAA
AACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAA
CTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAA
GTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGA
GGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACA
TTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGC
GTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGT
CTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGC
CACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTAT
ACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACAC
ACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAAT
GCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAA
GTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAA
TAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGA
AGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAG
TTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAA
CTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGG
TTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCC
TGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCAC
AAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGC
TGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTT
GCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTG
GATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATA
CAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACA
CCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAG
ACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGA
GCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTG
TTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCT
TGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGC
CTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGT
GCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCC
GGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGT
TCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCAT

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398907_chr21_39817543_-_4965nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGT
TGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGA
GCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCT
CAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACA
TGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACC
ATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAAC
TGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGA
CTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAG
CTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGC
CCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGA
TCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGA
TGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTT
ACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGC
CCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTG
TGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATAT
ACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTG
CATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGG
AAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGA
ATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGT
CTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTT
GACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAG
AGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACA
GCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGA
GGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAA
GAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTG
TTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTT
CTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCT
CCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTG
AGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTT
ATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCT
TAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATA
CAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACT
TTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCC
CTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAG
GCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTT
GTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTA
CAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGA
GTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTA
GAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAG
GTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTT
CACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGAC
ACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACA
AAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATC
AGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCT
TCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCC
TCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATA
ATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCAT
GAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGAT
TTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAG
TTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTG
CACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGC
TGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTT
TAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACT

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398905_chr21_39817543_-_4962nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGT
TGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGA
GCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCT
CAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACA
TGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACC
ATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAAC
TGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGA
CTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCAT
ATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCA
AAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCC
AGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGA
CGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACT
ACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCC
ACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGG
CGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACC
CCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCAT
TCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAG
GAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATA
TGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTT
AAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGAC
CTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGA
GACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCT
GTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGA
TGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAA
ACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTA
TACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTT
TGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCA
CAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGT
CGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATA
CACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAA
TGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAG
GAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTG
TCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTC
CTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCC
TATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTT
GAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAG
AAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTT
ACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAG
TCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTG
ACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCAC
GTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACG
ATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAG
TGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGT
CATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCA
AGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCC
ACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATT
CTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAA
CCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTG
TCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTT
GATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCAC
AGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGG
GAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAA
AAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACTCAA

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000288319_chr21_39817543_-_5034nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGT
TGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGA
GCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCT
CAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACA
TGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACC
ATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAAC
TGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGA
CTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAG
CTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGAT
CAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTC
CTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCC
TGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGG
CCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCA
TGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTC
TGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCC
TCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCA
CCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCAC
AAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATC
CAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGG
ACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTT
AGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAA
TGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACA
GACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTG
TGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGT
GTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAG
ACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAG
GAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAAT
TTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGAT
GGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTT
GTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCG
GCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTT
ATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTT
TTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAG
GGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGC
CCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTC
ATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTAC
CACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCT
AGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTT
GGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATC
TTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAG
CCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTA
TGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGAC
ACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGG
GAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATG
CAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAA
GATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTAT
TAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAAT
GGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGT
CCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTC
AATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGG
AGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAAC
CCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAG
GGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGC

>In-frame_NDRG1_ENST00000323851_chr8_134296491_-_ERG_ENST00000398907_chr21_39817546_-_4914nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCG
CGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCA
CCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGG
GCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAG
TTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACG
TCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACG
CCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACT
CTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTA
CAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGAC
CAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCA
GCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAAC
CCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCT
ACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACA
TGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTG
CCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTT
ACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGT
GCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGT
CTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGA
AGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAA
ACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTA
AAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGC
TGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTT
ACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAG
GAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTA
CAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGG
GAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGA
AACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCA
CGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTT
TCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACA
ATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAA
TAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAA
CATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCAC
CCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTC
ACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCA
CAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGG
CAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAG
CTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGC
TGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCT
TGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGA
ACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGC
TGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCC
AACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTG
GCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATA
GAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATAT
TCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATT
TTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCT
AATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATAC
TCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAA
ATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTG
CTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTC
TGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAA
AGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTG

>In-frame_NDRG1_ENST00000323851_chr8_134296491_-_ERG_ENST00000398905_chr21_39817546_-_4911nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCG
CGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCA
CCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGG
GCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAG
TTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACG
TCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACG
CCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACT
CTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCC
AGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAA
CAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCT
GCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCA
ACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACA
AGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGG
GCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCC
CAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACT
ACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCC
TCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTT
ACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGC
ATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACT
GGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAA
ATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGT
TTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACA
GTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAG
GAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAA
TGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAA
GTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAAC
ATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGC
AGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCC
CCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATC
GATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAA
AATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACAT
GTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCA
AATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACA
TTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAA
ATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAA
ATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTC
TCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGG
CTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGG
TCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACT
GGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGT
GGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAAC
CATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCA
GTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAA
ATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCA
ATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTG
GATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAAT
TCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCA
GACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATC
ACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTG
CAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGA
CAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGT
GACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGG

>In-frame_NDRG1_ENST00000323851_chr8_134296491_-_ERG_ENST00000288319_chr21_39817546_-_4983nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCG
CGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCA
CCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGG
GCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAG
TTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACG
TCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACG
CCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACT
CTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTA
CAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAAC
CATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAA
ATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCA
CCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGC
TCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGA
TCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACC
CACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATT
CACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAG
GCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAA
GCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGG
ATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAA
AGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAA
TAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAA
CAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATA
CATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGA
ACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAG
GAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGA
GGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAAC
AAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATT
ATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCG
GCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAAT
TATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGA
ATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCA
TGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGAT
TTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCC
AGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTA
TGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGC
TATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAG
CTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTT
TAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAAT
GTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTC
AAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGT
TTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGG
CTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGC
AGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACT
GTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGAT
AATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTC
CATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTG
AGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGG
TCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTA
CTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGA
CTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTG
CTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGA
TGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAA
AGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAA

>In-frame_NDRG1_ENST00000354944_chr8_134296491_-_ERG_ENST00000398907_chr21_39817546_-_4929nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTA
AGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAAC
CCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAG
GCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCA
CGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAAT
ATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCA
CCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATA
AAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAG
CTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTT
ATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGG
ACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAG
AGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATG
GGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCT
CAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTT
CCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTT
CTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGA
ACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGA
GGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAA
GACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGA
ATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAA
AACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAA
CTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAA
GTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGA
GGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACA
TTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGC
GTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGT
CTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGC
CACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTAT
ACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACAC
ACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAAT
GCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAA
GTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAA
TAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGA
AGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAG
TTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAA
CTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGG
TTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCC
TGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCAC
AAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGC
TGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTT
GCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTG
GATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATA
CAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACA
CCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAG
ACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGA
GCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTG
TTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCT
TGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGC
CTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGT
GCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCC
GGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGT
TCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCAT

>In-frame_NDRG1_ENST00000354944_chr8_134296491_-_ERG_ENST00000398905_chr21_39817546_-_4926nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTA
AGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAAC
CCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAG
GCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCA
CGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAAT
ATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCA
CCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATA
AAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACG
GCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATC
AGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACA
GCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGC
GGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGA
AGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAG
ACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCA
GTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTC
ATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACA
TGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGG
AGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGAC
AGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATC
CCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAAC
TACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTG
CATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTT
TCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGG
GTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTT
GGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTA
ATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTG
ATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCAC
AATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACA
AGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACG
ACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCA
GAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTT
GCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAG
GATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGG
ACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTC
AGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTG
TATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTT
CTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGA
GCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAA
TGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGA
ATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCC
AAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGAT
TAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAA
TCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCT
ACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACA
TGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCA
ACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTA
CTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGC
CCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTT
GTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCT
TTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGA
GGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCT
GCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCA

>In-frame_NDRG1_ENST00000354944_chr8_134296491_-_ERG_ENST00000288319_chr21_39817546_-_4998nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTA
AGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAAC
CCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAG
GCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCA
CGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAAT
ATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCA
CCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATA
AAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAG
CTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGT
CGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAA
GTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCA
TCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACA
TGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGT
TCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCT
CCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAA
ACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACT
AAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCA
AGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACT
ACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATG
AAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGG
ATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATA
GAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTT
GGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTA
TTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAA
GAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGA
GTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTA
GTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATT
CAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGG
CATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCC
TTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGAT
ATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAAT
AAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTG
CTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAAT
GGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTG
GAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATC
ACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATA
AAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCA
CTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTA
TCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCC
AGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGC
CCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGA
TGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCAT
CCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTT
AGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATA
CACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATT
TTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGAT
AACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCC
AAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGAC
TCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACC
AAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAG
TTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAG
CAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGAC
CCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGA

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398907_chr21_39817547_-_4950nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCT
ACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTC
AGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTG
ATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACA
TGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGC
TGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCA
AGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATT
TGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAA
ATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACC
AGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGT
TCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACG
AGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGA
ACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGT
CATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTC
CAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGC
TCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCAT
CGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAA
GAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCAT
CTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATA
AACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGT
TTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCA
TCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTC
AAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGT
GAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCA
ATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAG
TGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAAT
GAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTA
AGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGT
GCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTG
ATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATAT
GAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTT
GCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTG
TGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATT
TCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGG
GTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACA
AGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATA
ACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTG
TGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTG
GGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGG
CGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTT
TTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCT
CCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTC
CTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTT
GGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCAT
GAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCA
GGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTT
CAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCT
GTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTT
GTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATG
TCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACC
TGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGG
GCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTA
TTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACTCAAAAATACACCAAA

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000398905_chr21_39817547_-_4947nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCT
ACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTC
AGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTG
ATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACA
TGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGC
TGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCA
AGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATT
TGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGA
GATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGC
GTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCC
TCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGG
TGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACA
TCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCAT
CTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAG
CCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCC
CCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGC
CACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAG
ATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTG
TGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAAC
TTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTA
TAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCA
ACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAA
CTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAG
CGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATG
AAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGT
TAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAA
AATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGA
GATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCG
TTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATC
TCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAA
GTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCA
CTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGC
AAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCT
AGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTT
GTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGC
TACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACG
TCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGG
CTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGC
ATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGC
TAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTG
CTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCT
GACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTT
AGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGA
ATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAG
CAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGT
TATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAA
AATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTT
TGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTC
TTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCC
CGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGC
AACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCA
CAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTT

>In-frame_NDRG1_ENST00000323851_chr8_134292474_-_ERG_ENST00000288319_chr21_39817547_-_5019nt
CCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGCACCGTCCTTTCCTTT
CTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGCCTTTGGTGGAGAAAG
GGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCT
ACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTC
AGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTG
ATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACA
TGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGC
TGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCA
AGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATT
TGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAA
ATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTC
ACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTT
ATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGG
ACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAG
AGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATG
GGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCT
CAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTT
CCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTT
CTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGA
ACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGA
GGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAA
GACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGA
ATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAA
AACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAA
CTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAA
GTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGA
GGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACA
TTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGC
GTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGT
CTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGC
CACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTAT
ACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACAC
ACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAAT
GCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAA
GTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAA
TAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGA
AGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAG
TTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAA
CTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGG
TTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCC
TGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCAC
AAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGC
TGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTT
GCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTG
GATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATA
CAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACA
CCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAG
ACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGA
GCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTG
TTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCT
TGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGC
CTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGT
GCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCC
GGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGT
TCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCAT

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398907_chr21_39817547_-_4965nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGT
TGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGA
GCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCT
CAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACA
TGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACC
ATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAAC
TGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGA
CTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAG
CTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGC
CCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGA
TCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGA
TGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTT
ACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGC
CCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTG
TGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATAT
ACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTG
CATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGG
AAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGA
ATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGT
CTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTT
GACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAG
AGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACA
GCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGA
GGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAA
GAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTG
TTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTT
CTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCT
CCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTG
AGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTT
ATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCT
TAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATA
CAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACT
TTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCC
CTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAG
GCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTT
GTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTA
CAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGA
GTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTA
GAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAG
GTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTT
CACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGAC
ACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACA
AAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATC
AGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCT
TCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCC
TCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATA
ATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCAT
GAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGAT
TTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAG
TTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTG
CACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGC
TGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTT
TAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACT

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000398905_chr21_39817547_-_4962nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGT
TGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGA
GCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCT
CAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACA
TGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACC
ATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAAC
TGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGA
CTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCAT
ATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCA
AAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCC
AGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGA
CGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACT
ACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCC
ACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGG
CGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACC
CCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCAT
TCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAG
GAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATA
TGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTT
AAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGAC
CTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGA
GACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCT
GTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGA
TGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAA
ACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTA
TACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTT
TGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCA
CAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGT
CGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATA
CACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAA
TGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAG
GAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTG
TCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTC
CTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCC
TATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTT
GAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAG
AAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTT
ACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAG
TCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTG
ACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCAC
GTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACG
ATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAG
TGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGT
CATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCA
AGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCC
ACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATT
CTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAA
CCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTG
TCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTT
GATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCAC
AGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGG
GAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAA
AAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACTCAA

>In-frame_NDRG1_ENST00000354944_chr8_134292474_-_ERG_ENST00000288319_chr21_39817547_-_5034nt
AAACCTCGCCTGGCTCCCAGCTGGTGCTGAAGCTCGTCAGTTCACCATCCGCCCTCGGCTTCCGCGGGGCGCTGGGCCGCCAGCCTCGGC
ACCGTCCTTTCCTTTCTCCCTCGCGTTAGGCAGGTGACAGCAGGGACATGTCTCGGGAGATGCAGGATGTAGACCTCGCTGAGGTGAAGC
CTTTGGTGGAGAAAGGGGAGACCATCACCGGCCTCCTGCAAGAGTTTGATGTCCAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGT
TGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGA
GCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCT
CAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACA
TGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACC
ATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAAC
TGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGA
CTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAG
CTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGAT
CAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTC
CTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCC
TGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGG
CCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCA
TGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTC
TGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCC
TCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCA
CCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCAC
AAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATC
CAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGG
ACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTT
AGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAA
TGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACA
GACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTG
TGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGT
GTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAG
ACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAG
GAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAAT
TTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGAT
GGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTT
GTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCG
GCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTT
ATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTT
TTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAG
GGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGC
CCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTC
ATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTAC
CACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCT
AGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTT
GGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATC
TTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAG
CCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTA
TGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGAC
ACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGG
GAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATG
CAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAA
GATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTAT
TAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAAT
GGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGT
CCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTC
AATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGG
AGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAAC
CCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAG
GGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGC


Top

FusionGenePPI for NDRG1_ERG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NDRG1ARL4D, PHYHIP, S100B, HSP90AA1, HSPA5, VCP, CANX, PSMC3, PSMC2, PSMD2, XRCC6, RUVBL2, ILF3, SEC23A, COPB2, CLTC, AP2M1, AP1M2, MME, CTNNB1, ACTG1, KIF5B, PPP2R2A, TLE3, HSD17B4, CNDP2, DARS, DLST, ACSL3, FASN, MAOA, LDHA, PKM, RPN2, TARS, SHMT2, SLC25A6, ATP1A1, EEF2, EEF1G, EIF2S3, EIF3E, PABPC1, RPS3, RPS6, RPL24, RPL3, RPS16, RPS8, RPS20, RPS9, RPL4, RPS26, NCL, HNRNPF, HNRNPU, HNRNPH1, DDX1, DDX5, UPF1, EWSR1, CDH1, ANXA5, CLNS1A, IGBP1, SPAG9, MLH1, ACOT7, DDX39B, GSR, DPP3, EIF4H, FTO, KYNU, MVD, NAMPT, PEPD, PGD, BCL2L11, HSPA4, CUL2, TAF9, SGK1, SUZ12, EED, NDRG2, DHX15, G6PD, GART, HIP1R, CCDC22, CLIC4, NAA50, RTCB, SH2D4A, THUMPD1, TIMM13, TSG101, USP14, XPO1, NIF3L1, NTMT1, TARDBP, UFM1, TMEM17, ERBB3, FXYD1, PDE4DIP, S1PR2, FAM60A, CDK15, TRIM25ERGJUN, ETS2, AR, HSPA4, HSPA8, NEDD4, PRKDC, XRCC5, XRCC6, PARP1, XRCC4, NME1, DDX3X, PCBP1, HNRNPA2B1, DDX5, TRIM21, TPM1, HNRNPM, EIF2S1, RPLP0, PRPF8, RPL7A, HNRNPDL, TUBB, CAD, ACTB, ATP5A1, RPS18, HNRNPU, SPTAN1, DNAJA1, DNAJA2, DNAJA4, APP, USP9X, ADAR, CDC5L, CLTC, DDX21, DDX23, DKC1, EEF1A2, ELAVL1, FBL, HNRNPA1, HNRNPAB, HNRNPC, HNRNPD, HNRNPF, HNRNPH1, HNRNPH3, HNRNPUL1, HNRNPUL2, HSPD1, ILF2, ILF3, LANCL1, MATR3, NCL, NOLC1, NONO, NPM1, NUMA1, POLR2A, PRPF40A, PUF60, RCC2, SF3B1, SF3B2, SF3B3, SFPQ, SNRNP200, SYN1, TOP1, TOP2B, XRN2, CUL3, SPOP, TRIM25, UBR5, TRIM33, RING1, UBR4, RNF2, TRIP12, HUWE1, STUB1, UHRF1, HERC2, BRD4, BRD2, BRD3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NDRG1_ERG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NDRG1_ERG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNDRG1C0027627Neoplasm Metastasis2CTD_human
HgeneNDRG1C0004114Astrocytoma1CTD_human
HgeneNDRG1C0007131Non-Small Cell Lung Carcinoma1CTD_human
HgeneNDRG1C0007134Renal Cell Carcinoma1CTD_human
HgeneNDRG1C0017636Glioblastoma1CTD_human
HgeneNDRG1C0022665Kidney Neoplasm1CTD_human
HgeneNDRG1C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneNDRG1C0023903Liver neoplasms1CTD_human
HgeneNDRG1C0025202melanoma1CTD_human
HgeneNDRG1C0026640Mouth Neoplasms1CTD_human
HgeneNDRG1C0029295Oropharyngeal Neoplasms1CTD_human
HgeneNDRG1C0033578Prostatic Neoplasms1CTD_human
HgeneNDRG1C0149925Small cell carcinoma of lung1CTD_human
HgeneNDRG1C0206658Smooth Muscle Tumor1CTD_human
HgeneNDRG1C0206734Hemangioblastoma1CTD_human
HgeneNDRG1C0887833Carcinoma, Pancreatic Ductal1CTD_human
HgeneNDRG1C1168401Squamous cell carcinoma of the head and neck1CTD_human
HgeneNDRG1C1458155Mammary Neoplasms1CTD_human
TgeneERGC0033578Prostatic Neoplasms5CTD_human
TgeneERGC0023418leukemia1CTD_human
TgeneERGC0023467Leukemia, Myelocytic, Acute1CTD_human
TgeneERGC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human