FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23771

FusionGeneSummary for NDEL1_CHD3

check button Fusion gene summary
Fusion gene informationFusion gene name: NDEL1_CHD3
Fusion gene ID: 23771
HgeneTgene
Gene symbol

NDEL1

CHD3

Gene ID

81565

1107

Gene namenudE neurodevelopment protein 1 like 1chromodomain helicase DNA binding protein 3
SynonymsEOPA|MITAP1|NDE1L1|NDE2|NUDELMi-2a|Mi2-ALPHA|ZFH
Cytomap

17p13.1

17p13.1

Type of geneprotein-codingprotein-coding
Descriptionnuclear distribution protein nudE-like 1endooligopeptidase Amitosin-associated protein 1mitosin-associated protein MITAP1nudE nuclear distribution E homolog-like 1nudE nuclear distribution gene E homolog-like 1protein Nudelchromodomain-helicase-DNA-binding protein 3ATP-dependent helicase CHD3CHD-3hZFHmi-2 autoantigen 240 kDa proteinzinc finger helicasezinc-finger helicase (Snf2-like)
Modification date2018052320180522
UniProtAcc

Q9GZM8

Q12873

Ensembl transtripts involved in fusion geneENST00000334527, ENST00000299734, 
ENST00000585098, ENST00000380025, 
ENST00000402554, ENST00000583066, 
ENST00000380358, ENST00000358181, 
ENST00000330494, ENST00000570758, 
Fusion gene scores* DoF score6 X 5 X 5=1508 X 9 X 4=288
# samples 510
** MAII scorelog2(5/150*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/288*10)=-1.52606881166759
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NDEL1 [Title/Abstract] AND CHD3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCHD3

GO:0007051

spindle organization

17626165

TgeneCHD3

GO:0007098

centrosome cycle

17626165


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-FG-A60L-01ANDEL1chr17

8352004

+CHD3chr17

7813746

+
TCGALDLGGTCGA-FG-A60L-01ANDEL1chr17

8352004

+CHD3chr17

7814165

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000334527ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000334527ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000334527ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7813746

+
5CDS-intronENST00000334527ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000299734ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000299734ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000299734ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7813746

+
5CDS-intronENST00000299734ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7813746

+
intron-3CDSENST00000585098ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7813746

+
intron-3CDSENST00000585098ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7813746

+
intron-3CDSENST00000585098ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7813746

+
intron-intronENST00000585098ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000380025ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000380025ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000380025ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7813746

+
5CDS-intronENST00000380025ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000402554ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000402554ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7813746

+
In-frameENST00000402554ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7813746

+
5CDS-intronENST00000402554ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7813746

+
intron-3CDSENST00000583066ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7813746

+
intron-3CDSENST00000583066ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7813746

+
intron-3CDSENST00000583066ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7813746

+
intron-intronENST00000583066ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7813746

+
Frame-shiftENST00000334527ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000334527ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000334527ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7814165

+
5CDS-intronENST00000334527ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000299734ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000299734ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000299734ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7814165

+
5CDS-intronENST00000299734ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7814165

+
intron-3CDSENST00000585098ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7814165

+
intron-3CDSENST00000585098ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7814165

+
intron-3CDSENST00000585098ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7814165

+
intron-intronENST00000585098ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000380025ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000380025ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000380025ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7814165

+
5CDS-intronENST00000380025ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000402554ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000402554ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7814165

+
Frame-shiftENST00000402554ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7814165

+
5CDS-intronENST00000402554ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7814165

+
intron-3CDSENST00000583066ENST00000380358NDEL1chr17

8352004

+CHD3chr17

7814165

+
intron-3CDSENST00000583066ENST00000358181NDEL1chr17

8352004

+CHD3chr17

7814165

+
intron-3CDSENST00000583066ENST00000330494NDEL1chr17

8352004

+CHD3chr17

7814165

+
intron-intronENST00000583066ENST00000570758NDEL1chr17

8352004

+CHD3chr17

7814165

+

Top

FusionProtFeatures for NDEL1_CHD3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NDEL1

Q9GZM8

CHD3

Q12873

Required for organization of the cellular microtubulearray and microtubule anchoring at the centrosome. May regulatemicrotubule organization at least in part by targeting themicrotubule severing protein KATNA1 to the centrosome. Alsopositively regulates the activity of the minus-end directedmicrotubule motor protein dynein. May enhance dynein-mediatedmicrotubule sliding by targeting dynein to the microtubule plusends. Required for several dynein- and microtubule-dependentprocesses such as the maintenance of Golgi integrity, thecentripetal motion of secretory vesicles and the coupling of thenucleus and centrosome. Also required during brain development forthe migration of newly formed neurons from theventricular/subventricular zone toward the cortical plate. Plays arole, together with DISC1, in the regulation of neurite outgrowth.Required for mitosis in some cell types but appears to bedispensible for mitosis in cortical neuronal progenitors, whichinstead requires NDE1. Facilitates the polymerization ofneurofilaments from the individual subunits NEFH and NEFL.Positively regulates lysosome peripheral distribution and ruffledborder formation in osteoclasts (By similarity).{ECO:0000250|UniProtKB:Q9ERR1, ECO:0000269|PubMed:12556484,ECO:0000269|PubMed:14970193, ECO:0000269|PubMed:16291865,ECO:0000269|PubMed:17600710}. Component of the histone deacetylase NuRD complex whichparticipates in the remodeling of chromatin by deacetylatinghistones. Required for anchoring centrosomal pericentrin in bothinterphase and mitosis, for spindle organization and centrosomeintegrity. {ECO:0000269|PubMed:17626165,ECO:0000269|PubMed:9804427}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNDEL1chr17:8352004chr17:7813746ENST00000299734+5956_166175368RegionSelf-association
HgeneNDEL1chr17:8352004chr17:7813746ENST00000334527+5956_166175346RegionSelf-association
HgeneNDEL1chr17:8352004chr17:7813746ENST00000402554+51056_166175329RegionSelf-association

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNDEL1chr17:8352004chr17:7813746ENST00000299734+5928_190175368Coiled coilOntology_term=ECO:0000255
HgeneNDEL1chr17:8352004chr17:7813746ENST00000334527+5928_190175346Coiled coilOntology_term=ECO:0000255
HgeneNDEL1chr17:8352004chr17:7813746ENST00000402554+51028_190175329Coiled coilOntology_term=ECO:0000255
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640206_22118632001Compositional biasNote=Poly-Ala
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640243_24618632001Compositional biasNote=Poly-Pro
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640355_35818632001Compositional biasNote=Poly-Lys
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640434_44618632001Compositional biasNote=Poly-Glu
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640697_70318632001Compositional biasNote=Poly-Lys
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539206_22118291967Compositional biasNote=Poly-Ala
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539243_24618291967Compositional biasNote=Poly-Pro
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539355_35818291967Compositional biasNote=Poly-Lys
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539434_44618291967Compositional biasNote=Poly-Glu
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539697_70318291967Compositional biasNote=Poly-Lys
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640206_22119222060Compositional biasNote=Poly-Ala
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640243_24619222060Compositional biasNote=Poly-Pro
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640355_35819222060Compositional biasNote=Poly-Lys
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640434_44619222060Compositional biasNote=Poly-Glu
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640697_70319222060Compositional biasNote=Poly-Lys
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+36401064_122918632001DomainHelicase C-terminal
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640494_59418632001DomainChromo 1
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640631_67318632001DomainChromo 2
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640748_93218632001DomainHelicase ATP-binding
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+35391064_122918291967DomainHelicase C-terminal
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539494_59418291967DomainChromo 1
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539631_67318291967DomainChromo 2
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539748_93218291967DomainHelicase ATP-binding
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+36401064_122919222060DomainHelicase C-terminal
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640494_59419222060DomainChromo 1
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640631_67319222060DomainChromo 2
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640748_93219222060DomainHelicase ATP-binding
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640883_88618632001MotifNote=DEAH box
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539883_88618291967MotifNote=DEAH box
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640883_88619222060MotifNote=DEAH box
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640761_76818632001Nucleotide bindingATP
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539761_76818291967Nucleotide bindingATP
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640761_76819222060Nucleotide bindingATP
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640379_42618632001Zinc fingerPHD-type 1
TgeneCHD3chr17:8352004chr17:7813746ENST00000330494+3640456_50318632001Zinc fingerPHD-type 2
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539379_42618291967Zinc fingerPHD-type 1
TgeneCHD3chr17:8352004chr17:7813746ENST00000358181+3539456_50318291967Zinc fingerPHD-type 2
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640379_42619222060Zinc fingerPHD-type 1
TgeneCHD3chr17:8352004chr17:7813746ENST00000380358+3640456_50319222060Zinc fingerPHD-type 2


Top

FusionGeneSequence for NDEL1_CHD3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NDEL1_ENST00000334527_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000334527_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000334527_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000299734_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000299734_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000299734_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000380025_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000380025_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000380025_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000402554_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000402554_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF

>In-frame_NDEL1_ENST00000402554_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_313aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQS
YKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARVLNQL
EELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NDEL1_ENST00000334527_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000334527_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000334527_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000299734_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000299734_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000299734_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000380025_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000380025_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000380025_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000402554_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000402554_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG

>In-frame_NDEL1_ENST00000402554_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_939nt
ATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTC
CAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAA
AGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGC
TATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAG
GCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAAT
GCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTG
GAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATG
TCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCT
CCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTC
ATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_NDEL1_ENST00000334527_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_2311nt
AGAATGGCCTCGGACACCCAGGCAGTCCCTGACGTGTCGGGGAGGAGCCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGG
GGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCGGCGGAGGGGAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACAT
TGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGA
AGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAAT
TAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGC
ATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATG
TGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACC
AGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAA
GAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCG
CAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGG
GTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGA
TGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAG
ACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGATCTGTATAGACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCG
TCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGCTGCCAGCCCTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACC
CCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGCCCTTTGTCTTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACT
GTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCAGGGTCTTCCAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCA
GTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCAGCCGTTTCCCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGC
CTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCTTTGAAGAGAGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGG
GAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCCCCTACCTCTCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAAC
TGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCTCAGTTACCTCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCC
TAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTTGGGTGATACTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGAC
CCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCCAGATGTGGTGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTAC
TACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTGTATAAGTCAGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTT
GGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAATGTGGGCACATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCAT
GGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTTCTTGCTGCCCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTG

>In-frame_NDEL1_ENST00000334527_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_2311nt
AGAATGGCCTCGGACACCCAGGCAGTCCCTGACGTGTCGGGGAGGAGCCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGG
GGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCGGCGGAGGGGAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACAT
TGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGA
AGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAAT
TAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGC
ATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATG
TGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACC
AGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAA
GAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCG
CAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGG
GTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGA
TGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAG
ACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGATCTGTATAGACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCG
TCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGCTGCCAGCCCTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACC
CCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGCCCTTTGTCTTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACT
GTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCAGGGTCTTCCAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCA
GTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCAGCCGTTTCCCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGC
CTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCTTTGAAGAGAGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGG
GAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCCCCTACCTCTCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAAC
TGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCTCAGTTACCTCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCC
TAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTTGGGTGATACTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGAC
CCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCCAGATGTGGTGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTAC
TACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTGTATAAGTCAGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTT
GGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAATGTGGGCACATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCAT
GGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTTCTTGCTGCCCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTG

>In-frame_NDEL1_ENST00000334527_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_2311nt
AGAATGGCCTCGGACACCCAGGCAGTCCCTGACGTGTCGGGGAGGAGCCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGG
GGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCGGCGGAGGGGAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACAT
TGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGA
AGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAAT
TAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGC
ATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATG
TGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACC
AGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAA
GAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCG
CAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGG
GTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGA
TGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAG
ACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGATCTGTATAGACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCG
TCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGCTGCCAGCCCTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACC
CCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGCCCTTTGTCTTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACT
GTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCAGGGTCTTCCAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCA
GTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCAGCCGTTTCCCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGC
CTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCTTTGAAGAGAGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGG
GAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCCCCTACCTCTCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAAC
TGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCTCAGTTACCTCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCC
TAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTTGGGTGATACTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGAC
CCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCCAGATGTGGTGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTAC
TACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTGTATAAGTCAGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTT
GGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAATGTGGGCACATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCAT
GGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTTCTTGCTGCCCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTG

>In-frame_NDEL1_ENST00000299734_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_2311nt
AGAATGGCCTCGGACACCCAGGCAGTCCCTGACGTGTCGGGGAGGAGCCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGG
GGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCGGCGGAGGGGAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACAT
TGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGA
AGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAAT
TAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGC
ATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATG
TGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACC
AGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAA
GAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCG
CAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGG
GTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGA
TGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAG
ACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGATCTGTATAGACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCG
TCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGCTGCCAGCCCTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACC
CCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGCCCTTTGTCTTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACT
GTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCAGGGTCTTCCAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCA
GTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCAGCCGTTTCCCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGC
CTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCTTTGAAGAGAGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGG
GAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCCCCTACCTCTCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAAC
TGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCTCAGTTACCTCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCC
TAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTTGGGTGATACTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGAC
CCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCCAGATGTGGTGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTAC
TACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTGTATAAGTCAGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTT
GGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAATGTGGGCACATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCAT
GGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTTCTTGCTGCCCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTG

>In-frame_NDEL1_ENST00000299734_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_2311nt
AGAATGGCCTCGGACACCCAGGCAGTCCCTGACGTGTCGGGGAGGAGCCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGG
GGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCGGCGGAGGGGAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACAT
TGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGA
AGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAAT
TAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGC
ATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATG
TGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACC
AGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAA
GAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCG
CAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGG
GTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGA
TGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAG
ACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGATCTGTATAGACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCG
TCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGCTGCCAGCCCTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACC
CCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGCCCTTTGTCTTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACT
GTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCAGGGTCTTCCAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCA
GTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCAGCCGTTTCCCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGC
CTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCTTTGAAGAGAGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGG
GAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCCCCTACCTCTCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAAC
TGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCTCAGTTACCTCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCC
TAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTTGGGTGATACTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGAC
CCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCCAGATGTGGTGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTAC
TACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTGTATAAGTCAGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTT
GGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAATGTGGGCACATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCAT
GGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTTCTTGCTGCCCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTG

>In-frame_NDEL1_ENST00000299734_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_2311nt
AGAATGGCCTCGGACACCCAGGCAGTCCCTGACGTGTCGGGGAGGAGCCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGG
GGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCGGCGGAGGGGAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACAT
TGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAGATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGA
AGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAAT
TAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTGATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGC
ATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAGAAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATG
TGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAGCCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACC
AGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTGATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAA
GAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCG
CAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGG
GTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGA
TGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCCCTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAG
ACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGATCTGTATAGACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCG
TCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGCTGCCAGCCCTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACC
CCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGCCCTTTGTCTTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACT
GTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCAGGGTCTTCCAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCA
GTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCAGCCGTTTCCCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGC
CTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCTTTGAAGAGAGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGG
GAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCCCCTACCTCTCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAAC
TGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCTCAGTTACCTCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCC
TAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTTGGGTGATACTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGAC
CCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCCAGATGTGGTGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTAC
TACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTGTATAAGTCAGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTT
GGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAATGTGGGCACATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCAT
GGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTTCTTGCTGCCCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTG

>In-frame_NDEL1_ENST00000380025_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_2272nt
GGGAGGAGCCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGGGGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCG
GCGGAGGGGAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACATTGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAG
ATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAG
TTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTG
ATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAG
AAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAG
CCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTG
ATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGA
AGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCC
GGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCA
GCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCC
CTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGA
TCTGTATAGACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCGTCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGC
TGCCAGCCCTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACCCCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGC
CCTTTGTCTTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACTGTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCA
GGGTCTTCCAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCAGTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCA
GCCGTTTCCCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGCCTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCT
TTGAAGAGAGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGGGAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCC
CCTACCTCTCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAACTGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCT
CAGTTACCTCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCCTAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTT
GGGTGATACTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGACCCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCC
AGATGTGGTGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTACTACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTG
TATAAGTCAGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTTGGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAAT
GTGGGCACATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCATGGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTT
CTTGCTGCCCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTGATCCCCTCTTCTGTATCAGGTTTATTGGTTGTACATATA

>In-frame_NDEL1_ENST00000380025_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_2272nt
GGGAGGAGCCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGGGGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCG
GCGGAGGGGAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACATTGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAG
ATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAG
TTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTG
ATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAG
AAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAG
CCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTG
ATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGA
AGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCC
GGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCA
GCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCC
CTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGA
TCTGTATAGACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCGTCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGC
TGCCAGCCCTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACCCCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGC
CCTTTGTCTTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACTGTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCA
GGGTCTTCCAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCAGTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCA
GCCGTTTCCCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGCCTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCT
TTGAAGAGAGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGGGAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCC
CCTACCTCTCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAACTGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCT
CAGTTACCTCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCCTAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTT
GGGTGATACTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGACCCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCC
AGATGTGGTGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTACTACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTG
TATAAGTCAGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTTGGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAAT
GTGGGCACATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCATGGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTT
CTTGCTGCCCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTGATCCCCTCTTCTGTATCAGGTTTATTGGTTGTACATATA

>In-frame_NDEL1_ENST00000380025_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_2272nt
GGGAGGAGCCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGGGGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCG
GCGGAGGGGAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACATTGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAG
ATTTTTCAAGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAG
TTGAATTCCAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTG
ATAACCAAAGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAG
AAGATGATTTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAG
CCAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTG
ATGAAAAGGAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGA
AGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCC
GGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCA
GCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCC
CTCCAGTGCTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGA
TCTGTATAGACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCGTCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGC
TGCCAGCCCTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACCCCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGC
CCTTTGTCTTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACTGTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCA
GGGTCTTCCAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCAGTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCA
GCCGTTTCCCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGCCTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCT
TTGAAGAGAGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGGGAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCC
CCTACCTCTCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAACTGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCT
CAGTTACCTCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCCTAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTT
GGGTGATACTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGACCCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCC
AGATGTGGTGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTACTACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTG
TATAAGTCAGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTTGGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAAT
GTGGGCACATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCATGGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTT
CTTGCTGCCCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTGATCCCCTCTTCTGTATCAGGTTTATTGGTTGTACATATA

>In-frame_NDEL1_ENST00000402554_chr17_8352004_+_CHD3_ENST00000380358_chr17_7813746_+_2264nt
CCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGGGGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCGGCGGAGGG
GAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACATTGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAGATTTTTCA
AGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAATTC
CAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTGATAACCAA
AGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAGAAGATGAT
TTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAGCCAAAAGG
GCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTGATGAAAAG
GAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGAC
GTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCCGGCTGGCC
AGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCAGCGCCGCA
CCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCCCTCCAGTG
CTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGATCTGTATA
GACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCGTCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGCTGCCAGCC
CTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACCCCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGCCCTTTGTC
TTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACTGTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCAGGGTCTTC
CAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCAGTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCAGCCGTTTC
CCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGCCTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCTTTGAAGAG
AGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGGGAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCCCCTACCTC
TCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAACTGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCTCAGTTACC
TCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCCTAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTTGGGTGATA
CTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGACCCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCCAGATGTGG
TGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTACTACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTGTATAAGTC
AGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTTGGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAATGTGGGCAC
ATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCATGGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTTCTTGCTGC
CCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTGATCCCCTCTTCTGTATCAGGTTTATTGGTTGTACATATAAATTATAC

>In-frame_NDEL1_ENST00000402554_chr17_8352004_+_CHD3_ENST00000358181_chr17_7813746_+_2264nt
CCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGGGGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCGGCGGAGGG
GAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACATTGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAGATTTTTCA
AGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAATTC
CAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTGATAACCAA
AGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAGAAGATGAT
TTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAGCCAAAAGG
GCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTGATGAAAAG
GAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGAC
GTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCCGGCTGGCC
AGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCAGCGCCGCA
CCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCCCTCCAGTG
CTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGATCTGTATA
GACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCGTCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGCTGCCAGCC
CTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACCCCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGCCCTTTGTC
TTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACTGTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCAGGGTCTTC
CAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCAGTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCAGCCGTTTC
CCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGCCTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCTTTGAAGAG
AGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGGGAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCCCCTACCTC
TCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAACTGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCTCAGTTACC
TCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCCTAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTTGGGTGATA
CTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGACCCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCCAGATGTGG
TGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTACTACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTGTATAAGTC
AGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTTGGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAATGTGGGCAC
ATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCATGGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTTCTTGCTGC
CCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTGATCCCCTCTTCTGTATCAGGTTTATTGGTTGTACATATAAATTATAC

>In-frame_NDEL1_ENST00000402554_chr17_8352004_+_CHD3_ENST00000330494_chr17_7813746_+_2264nt
CCGGGCGCGGAGGTACGCTGAGTGGAGCTCGGGGCTGCGTAGGGGAGCTGAGCCGAGCGGCTGGGCGGGCCTGGCCGGGCCGGCGGAGGG
GAGACGTCGGTTGAGCGGCGGCGAACATGCGCTTTTGACACATTGGAGGCTTTCTTGATCATGGATGGTGAAGATATACCAGATTTTTCA
AGTTTAAAGGAGGAAACTGCTTATTGGAAGGAACTTTCCTTGAAGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAATTC
CAGGAAGGAAGCAGAGAATTAGAAGCAGAGTTGGAGGCACAATTAGTACAGGCTGAACAAAGAAATAGAGACTTGCAGGCTGATAACCAA
AGACTGAAATATGAAGTGGAGGCATTAAAGGAGAAGCTAGAGCATCAATATGCACAGAGCTATAAGCAGGTCTCAGTGTTAGAAGATGAT
TTAAGTCAGACTCGGGCCATTAAGGAGCAGTTGCATAAGTATGTGAGAGAGCTGGAGCAGGCCAACGACGACCTGGAGCGAGCCAAAAGG
GCAACAATAGTTTCACTGGAAGACTTTGAACAAAGGCTAAACCAGGCCATTGAACGAAATGCATTTTTAGAAAGTGAACTTGATGAAAAG
GAATCTTTGTTGGTCTCTGTACAGAGGTTAAAGGATGAAGCAAGAGTTCTGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGAC
GTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATGTCCGAGCGCAGCATCCTCAGCCGGCTGGCC
AGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCTCCGGGGTACGGGGCGGCCTTCAGCGCCGCA
CCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACGGCCCTCCAGTG
CTTGTGAAGAAGGAGAAGGAAATGGTGGGGGCATTGGTGTCAGACGGGCTGGATCGGAAGGAGCCCCGAGCCGGGGAGGTGATCTGTATA
GACGACTGACTGGATCCCAGGCCTGCCCTTCACCCAGGCCCCGTCCCCGAGGCCGACCCCCAGCTCAAGCGCTGGGGCCTGCTGCCAGCC
CTCCACCTTCCCCACCCCTTGGGCCATCACTGGGCTAGGAACCCCTTTGCCCCTCTCTGCAGCTCCTCTCTTCAAGAAGGGCCCTTTGTC
TTTCTCCACTCCCACACACCTTTCCCACCAAGCCTTGAAGACTGTGCTGGTGAGAAGAAGTCTGGGTGGGAGATGGCTGGCAGGGTCTTC
CAAGTACCTTCCTCCCACACTGCCAAGTATACACAACTTCCCAGTAAATGGTTGTGGGGAGGAAAGAGGTGGAGCCTCCCCAGCCGTTTC
CCTGCAGAATCAGCTCTGTCTCATGTGGAAGTGGAGAATCAGCCTTGCCTGGCCTTTAGGAACTTTTGTGGGGAAGAGAGCTTTGAAGAG
AGGAGGGGGACTTTAGAGAGGGATGAAAATGAGCCCTGGGAGGGAGGAAGGGACGAGGAGGGGTGGCTGCATGTTACCGTCCCCTACCTC
TCCCCACGTGGAGGGTGGAGCAGTTATGAGGGAGGAAGTCAACTGCTGTTCAGCCTCAGAATAAAGGTGCCGTTCACTGGCTCAGTTACC
TCCTGTGTACCGGCATCTTGTGTTGGGAATGTTCCCCCCTCCCTAGGGACCAAGGACCACCCCTACAAAAAGAGTAATGGTTGGGTGATA
CTCCCTCAAGCCAAAGAGGAGCTCCCCAACCTGTTCTAGGGACCCAGGTAACCTAGAAGGGTGGGAGAGAATACAATGGGCCAGATGTGG
TGGAAGCCCAGCTCTGGGGCTCAGGTTCCTGGAAGACTTCTACTACCCTCCCTCCTCAAGGCCTGGATACAGACTAAATTTGTATAAGTC
AGGCAGGGGACCTAGTCAGGGTCTTGGGAGCTACCTTGTCGTTGGGACCAGAGCAAAATAGTGGAGGGCAGGCTAGGGAAATGTGGGCAC
ATCCCCCCTCCCAGGAGGGGCCGGGGAGAGTGGCAGTTTGCATGGCGAACCCCCCACTTCCTCTTTGCTGCCCCTTCACTTTCTTGCTGC
CCCTTTCCCAGTCTCTCTTCACACCCACTCCTGGTCTGTCCTGATCCCCTCTTCTGTATCAGGTTTATTGGTTGTACATATAAATTATAC


Top

FusionGenePPI for NDEL1_CHD3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NDEL1MBIP, MAGEA11, DISC1, YWHAE, PAFAH1B1, DYNC1H1, CDK5, LMNB1, TACC3, YWHAG, IMMT, CCDC88A, CENPF, CEP170, CEP63, KALRN, ZNF197, ANK2, CCSER1, SYNE1, LUC7L2, CCSER2, MLLT10, DIXDC1, ZNF10, SNX6, MRC2, ZNF17, ZNF211, ZNF230, ZNF91, MIS18A, DCTN2, TUBG1, TUBA1A, KATNA1, KATNB1, APP, NDE1, BMI1, DTNB, GOLGA2, KIFC3, PKP2, TRIM27, XPA, ZNF180, AIMP2, USP2, ZNF264, SNAPC5, NDC80, MTUS2, ZNF544, CCHCR1, ZNF490, TRAF3IP3, NDEL1, KRT40, ZNF572, CWF19L2, ZNF417, ZNF599, ZNF844, ZNF260, CCDC183, SNAP29, C17orf59, SCARA3, NAP1L5, DYNC1I1, SSX2IP, CEP152, CEP128, CEP135, NINL, DYNLT1, CTR9, KIF20B, GRIPAP1, ANKRD26, NUP54, UTRN, SNTB1, FBXW5, SNTB2, SNTA1, ZNF445, MTCL1, CLPX, CCDC18, SLC25A43, KIAA1598, BCAS2, KTN1, OFD1, TRIM7, TRIOBP, RPS6KA3, EVI5, PRPF19, PTPN14, PAFAH1B2CHD3UBE2I, SERBP1, MBD3L1, HDAC2, MTA2, MBD2, HABP4, HDAC1, TP53, TP73, SUMO1, SMARCA5, RAD21, ADH5, ATPIF1, CASP6, FBP2, HSPH1, PCMT1, SERF2, TSPAN6, CASP8, CPE, C4orf17, CTTN, IVNS1ABP, THOC7, PRG2, PTPRS, SGSM2, SAT1, SDCCAG3, TNFRSF14, UBA3, XRCC4, SRRT, FAM134A, YAE1D1, IMMT, GPS2, IK, KIF15, LUC7L2, MAFG, MAN2A2, CRCT1, PAICS, PSME1, RPL29, SAFB, TRIM28, TTR, TXNDC9, BHLHE40, CREB1, FUBP1, RAD51, PUF60, SIRT6, SLC27A6, CSTF2, PTN, SUMO2, CHD6, HIST1H3A, NAB2, MTA3, SIN3A, SMARCA2, TAF6, MTA1, BCL6, HSF1, CSNK2A1, PCNT, MYB, DDX5, JUN, HIC1, CHD4, CHD3, RBBP4, KDM1A, TAL1, GSK3B, UROD, AIMP2, TNNT1, FABP4, HSD17B10, RGS2, CTBP1, PLK4, NR1H2, TSC22D1, NR4A1, GADD45A, KDM5B, TWIST1, HTT, GIT1, BARD1, PRPF40A, VIM, LRIF1, PIAS4, ZHX1, NEFL, TCERG1, KPNB1, IKZF1, MBD3, RBBP7, GATAD2A, SMARCC2, HDAC3, UBC, SIRT1, SKIL, SOX2, LGR4, ENO1, SHMT2, MOV10, NXF1, PHF6, CCDC8, RNF2, BMI1, ZNF219, PHF20L1, GATAD2B, CD2BP2, OTUD6B, SNRNP40, CPSF1, METAP2, MX1, KMT2A, SATB1, RPL10, CDK2AP1, PSMD14, HIST1H2BB, MCM2, SNW1, HYPK, HSFY1, FOXA1, TRIM25, UHRF2, BRD1, ZNF827


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneNDEL1chr17:8352004chr17:7813746ENST00000299734+59175_345175368CENPF
HgeneNDEL1chr17:8352004chr17:7813746ENST00000334527+59175_345175346CENPF
HgeneNDEL1chr17:8352004chr17:7813746ENST00000402554+510175_345175329CENPF
HgeneNDEL1chr17:8352004chr17:7813746ENST00000299734+59241_280175368DISC1
HgeneNDEL1chr17:8352004chr17:7813746ENST00000334527+59241_280175346DISC1
HgeneNDEL1chr17:8352004chr17:7813746ENST00000402554+510241_280175329DISC1
HgeneNDEL1chr17:8352004chr17:7813746ENST00000299734+59195_256175368KATNA1
HgeneNDEL1chr17:8352004chr17:7813746ENST00000334527+59195_256175346KATNA1
HgeneNDEL1chr17:8352004chr17:7813746ENST00000402554+510195_256175329KATNA1
HgeneNDEL1chr17:8352004chr17:7813746ENST00000299734+5964_189175368KATNB1
HgeneNDEL1chr17:8352004chr17:7813746ENST00000334527+5964_189175346KATNB1
HgeneNDEL1chr17:8352004chr17:7813746ENST00000402554+51064_189175329KATNB1
HgeneNDEL1chr17:8352004chr17:7813746ENST00000299734+59191_345175368NEFL
HgeneNDEL1chr17:8352004chr17:7813746ENST00000334527+59191_345175346NEFL
HgeneNDEL1chr17:8352004chr17:7813746ENST00000402554+510191_345175329NEFL
HgeneNDEL1chr17:8352004chr17:7813746ENST00000299734+59189_256175368YWHAE
HgeneNDEL1chr17:8352004chr17:7813746ENST00000334527+59189_256175346YWHAE
HgeneNDEL1chr17:8352004chr17:7813746ENST00000402554+510189_256175329YWHAE


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NDEL1_CHD3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NDEL1_CHD3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNDEL1C0036341Schizophrenia4PSYGENET
HgeneNDEL1C0033975Psychotic Disorders2PSYGENET
HgeneNDEL1C0349204Nonorganic psychosis1PSYGENET
HgeneNDEL1C3495559Juvenile arthritis1CTD_human
TgeneCHD3C0036920Sezary Syndrome1CTD_human