FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23751

FusionGeneSummary for NCSTN_ATP1A4

check button Fusion gene summary
Fusion gene informationFusion gene name: NCSTN_ATP1A4
Fusion gene ID: 23751
HgeneTgene
Gene symbol

NCSTN

ATP1A4

Gene ID

23385

480

Gene namenicastrinATPase Na+/K+ transporting subunit alpha 4
SynonymsATAG1874ATP1A1|ATP1AL2
Cytomap

1q23.2

1q23.2

Type of geneprotein-codingprotein-coding
Descriptionnicastrinanterior pharynx-defective 2sodium/potassium-transporting ATPase subunit alpha-4ATPase, Na+/K+ transporting, alpha 4 polypeptideATPase, Na+/K+ transporting, alpha polypeptide-like 2Na(+)/K(+) ATPase alpha-4 subunitNa+/K+ ATPase 4Na+/K+ ATPase, alpha-D polypeptideNa,K-ATPase su
Modification date2018052320180523
UniProtAcc

Q92542

Q13733

Ensembl transtripts involved in fusion geneENST00000294785, ENST00000368063, 
ENST00000535857, ENST00000392212, 
ENST00000459963, ENST00000368065, 
ENST00000368081, ENST00000418334, 
ENST00000470705, 
Fusion gene scores* DoF score7 X 7 X 4=1962 X 2 X 2=8
# samples 83
** MAII scorelog2(8/196*10)=-1.29278174922785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/8*10)=1.90689059560852
Context

PubMed: NCSTN [Title/Abstract] AND ATP1A4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNCSTN

GO:0006509

membrane protein ectodomain proteolysis

15274632

HgeneNCSTN

GO:0016485

protein processing

15274632

HgeneNCSTN

GO:0042982

amyloid precursor protein metabolic process

25043039|26280335

HgeneNCSTN

GO:0043085

positive regulation of catalytic activity

15274632

TgeneATP1A4

GO:0030317

flagellated sperm motility

12112599

TgeneATP1A4

GO:0030641

regulation of cellular pH

12112599


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-BH-A1FD-01ANCSTNchr1

160314616

+ATP1A4chr1

160145882

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000294785ENST00000368081NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
5CDS-3UTRENST00000294785ENST00000418334NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
5CDS-intronENST00000294785ENST00000470705NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
In-frameENST00000368063ENST00000368081NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
5CDS-3UTRENST00000368063ENST00000418334NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
5CDS-intronENST00000368063ENST00000470705NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
In-frameENST00000535857ENST00000368081NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
5CDS-3UTRENST00000535857ENST00000418334NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
5CDS-intronENST00000535857ENST00000470705NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
In-frameENST00000392212ENST00000368081NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
5CDS-3UTRENST00000392212ENST00000418334NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
5CDS-intronENST00000392212ENST00000470705NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
intron-3CDSENST00000459963ENST00000368081NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
intron-3UTRENST00000459963ENST00000418334NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
intron-intronENST00000459963ENST00000470705NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
intron-3CDSENST00000368065ENST00000368081NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
intron-3UTRENST00000368065ENST00000418334NCSTNchr1

160314616

+ATP1A4chr1

160145882

+
intron-intronENST00000368065ENST00000470705NCSTNchr1

160314616

+ATP1A4chr1

160145882

+

Top

FusionProtFeatures for NCSTN_ATP1A4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NCSTN

Q92542

ATP1A4

Q13733

Essential subunit of the gamma-secretase complex, anendoprotease complex that catalyzes the intramembrane cleavage ofintegral membrane proteins such as Notch receptors and APP(amyloid-beta precursor protein) (PubMed:10993067,PubMed:12679784, PubMed:25043039, PubMed:26280335). The gamma-secretase complex plays a role in Notch and Wnt signaling cascadesand regulation of downstream processes via its role in processingkey regulatory proteins, and by regulating cytosolic CTNNB1levels. {ECO:0000269|PubMed:10993067, ECO:0000269|PubMed:12679784,ECO:0000269|PubMed:25043039, ECO:0000269|PubMed:26280335}. This is the catalytic component of the active enzyme,which catalyzes the hydrolysis of ATP coupled with the exchange ofsodium and potassium ions across the plasma membrane. This actioncreates the electrochemical gradient of sodium and potassium ions,providing the energy for active transport of various nutrients.Plays a role in sperm motility.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+14221013_10297701030Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422799_8087701030Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422830_8497701030Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422873_9247701030Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422945_9577701030Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422977_9917701030Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+051013_1029-37166Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05117_139-37166Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05161_296-37166Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+051_95-37166Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05317_328-37166Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05347_778-37166Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05799_808-37166Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05830_849-37166Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05873_924-37166Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05945_957-37166Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05977_991-37166Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422779_7987701030TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422809_8297701030TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422850_8727701030TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422925_9447701030TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422958_9767701030TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422992_10127701030TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05140_160-37166TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05297_316-37166TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05329_346-37166TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05779_798-37166TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05809_829-37166TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05850_872-37166TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05925_944-37166TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05958_976-37166TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+0596_116-37166TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+05992_1012-37166TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCSTNchr1:160314616chr1:160145882ENST00000294785+21734_66963710Topological domainExtracellular
HgeneNCSTNchr1:160314616chr1:160145882ENST00000294785+217691_70963710Topological domainCytoplasmic
HgeneNCSTNchr1:160314616chr1:160145882ENST00000368063+31834_66943690Topological domainExtracellular
HgeneNCSTNchr1:160314616chr1:160145882ENST00000368063+318691_70943690Topological domainCytoplasmic
HgeneNCSTNchr1:160314616chr1:160145882ENST00000392212+21734_66943690Topological domainExtracellular
HgeneNCSTNchr1:160314616chr1:160145882ENST00000392212+217691_70943690Topological domainCytoplasmic
HgeneNCSTNchr1:160314616chr1:160145882ENST00000294785+217670_69063710TransmembraneHelical
HgeneNCSTNchr1:160314616chr1:160145882ENST00000368063+318670_69043690TransmembraneHelical
HgeneNCSTNchr1:160314616chr1:160145882ENST00000392212+217670_69043690TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422117_1397701030Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422161_2967701030Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+14221_957701030Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422317_3287701030Topological domainExtracellular
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422347_7787701030Topological domainCytoplasmic
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422140_1607701030TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422297_3167701030TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+1422329_3467701030TransmembraneHelical
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+142296_1167701030TransmembraneHelical


Top

FusionGeneSequence for NCSTN_ATP1A4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NCSTN_ENST00000294785_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_323aa
MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQCRLIFDNLKKSIMYTLTSNIPEITPFL
MFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKRLPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPV
DLLGIRLHWEDKYLNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYT

>In-frame_NCSTN_ENST00000368063_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_303aa
MDFNLILESLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQCRLIFDNLKKSIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCID
LGTDMVPAISLAYESAESDIMKRLPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKYLNDLEDS
YGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCA

>In-frame_NCSTN_ENST00000535857_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_323aa
MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQCRLIFDNLKKSIMYTLTSNIPEITPFL
MFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKRLPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPV
DLLGIRLHWEDKYLNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYT

>In-frame_NCSTN_ENST00000392212_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_303aa
MDFNLILESLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQCRLIFDNLKKSIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCID
LGTDMVPAISLAYESAESDIMKRLPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKYLNDLEDS
YGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NCSTN_ENST00000294785_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_969nt
ATGGCTACGGCAGGGGGTGGCTCTGGGGCTGACCCGGGAAGTCGGGGTCTCCTTCGCCTTCTGTCTTTCTGCGTCCTACTAGCAGGTTTG
TGCAGGGGAAACTCAGTGGAGAGGAAGATATATATCCCCTTAAATAAAACAGCTCCCTGTGTTCGCCTGCTCAACGCCACTCATCAGATT
GGCTGCCAGTGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCATGTACACCCTGACCAGCAACATCCCCGAGATCACGCCCTTCCTG
ATGTTCATCATCCTCGGTATACCCCTGCCTCTGGGAACCATAACCATCCTCTGCATTGATCTCGGCACTGACATGGTCCCTGCCATCTCC
TTGGCTTATGAGTCAGCTGAAAGCGACATCATGAAGAGGCTTCCAAGGAACCCAAAGACGGATAATCTGGTGAACCACCGTCTCATTGGC
ATGGCCTATGGACAGATTGGGATGATCCAGGCTCTGGCTGGATTCTTTACCTACTTTGTAATCCTGGCTGAGAATGGTTTTAGGCCTGTT
GATCTGCTGGGCATCCGCCTCCACTGGGAAGATAAATACTTGAATGACCTGGAGGACAGCTACGGACAGCAGTGGACCTATGAGCAACGA
AAAGTTGTGGAGTTCACATGCCAAACGGCCTTTTTTGTCACCATCGTGGTTGTGCAGTGGGCGGATCTCATCATCTCCAAGACTCGCCGC
AACTCACTTTTCCAGCAGGGCATGAGAAACAAAGTCTTAATATTTGGGATCCTGGAGGAGACACTCTTGGCTGCATTTCTGTCCTACACT
CCAGGCATGGACGTGGCCCTGCGAATGTACCCACTCAAGATAACCTGGTGGCTCTGTGCCATTCCCTACAGTATTCTCATCTTCGTCTAT

>In-frame_NCSTN_ENST00000368063_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_909nt
ATGGACTTTAATCTCATTTTAGAAAGTTTGTGCAGGGGAAACTCAGTGGAGAGGAAGATATATATCCCCTTAAATAAAACAGCTCCCTGT
GTTCGCCTGCTCAACGCCACTCATCAGATTGGCTGCCAGTGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCATGTACACCCTGACC
AGCAACATCCCCGAGATCACGCCCTTCCTGATGTTCATCATCCTCGGTATACCCCTGCCTCTGGGAACCATAACCATCCTCTGCATTGAT
CTCGGCACTGACATGGTCCCTGCCATCTCCTTGGCTTATGAGTCAGCTGAAAGCGACATCATGAAGAGGCTTCCAAGGAACCCAAAGACG
GATAATCTGGTGAACCACCGTCTCATTGGCATGGCCTATGGACAGATTGGGATGATCCAGGCTCTGGCTGGATTCTTTACCTACTTTGTA
ATCCTGGCTGAGAATGGTTTTAGGCCTGTTGATCTGCTGGGCATCCGCCTCCACTGGGAAGATAAATACTTGAATGACCTGGAGGACAGC
TACGGACAGCAGTGGACCTATGAGCAACGAAAAGTTGTGGAGTTCACATGCCAAACGGCCTTTTTTGTCACCATCGTGGTTGTGCAGTGG
GCGGATCTCATCATCTCCAAGACTCGCCGCAACTCACTTTTCCAGCAGGGCATGAGAAACAAAGTCTTAATATTTGGGATCCTGGAGGAG
ACACTCTTGGCTGCATTTCTGTCCTACACTCCAGGCATGGACGTGGCCCTGCGAATGTACCCACTCAAGATAACCTGGTGGCTCTGTGCC
ATTCCCTACAGTATTCTCATCTTCGTCTATGATGAAATCAGAAAACTCCTCATCCGTCAGCACCCGGATGGCTGGGTGGAAAGGGAGACG

>In-frame_NCSTN_ENST00000535857_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_969nt
ATGGCTACGGCAGGGGGTGGCTCTGGGGCTGACCCGGGAAGTCGGGGTCTCCTTCGCCTTCTGTCTTTCTGCGTCCTACTAGCAGGTTTG
TGCAGGGGAAACTCAGTGGAGAGGAAGATATATATCCCCTTAAATAAAACAGCTCCCTGTGTTCGCCTGCTCAACGCCACTCATCAGATT
GGCTGCCAGTGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCATGTACACCCTGACCAGCAACATCCCCGAGATCACGCCCTTCCTG
ATGTTCATCATCCTCGGTATACCCCTGCCTCTGGGAACCATAACCATCCTCTGCATTGATCTCGGCACTGACATGGTCCCTGCCATCTCC
TTGGCTTATGAGTCAGCTGAAAGCGACATCATGAAGAGGCTTCCAAGGAACCCAAAGACGGATAATCTGGTGAACCACCGTCTCATTGGC
ATGGCCTATGGACAGATTGGGATGATCCAGGCTCTGGCTGGATTCTTTACCTACTTTGTAATCCTGGCTGAGAATGGTTTTAGGCCTGTT
GATCTGCTGGGCATCCGCCTCCACTGGGAAGATAAATACTTGAATGACCTGGAGGACAGCTACGGACAGCAGTGGACCTATGAGCAACGA
AAAGTTGTGGAGTTCACATGCCAAACGGCCTTTTTTGTCACCATCGTGGTTGTGCAGTGGGCGGATCTCATCATCTCCAAGACTCGCCGC
AACTCACTTTTCCAGCAGGGCATGAGAAACAAAGTCTTAATATTTGGGATCCTGGAGGAGACACTCTTGGCTGCATTTCTGTCCTACACT
CCAGGCATGGACGTGGCCCTGCGAATGTACCCACTCAAGATAACCTGGTGGCTCTGTGCCATTCCCTACAGTATTCTCATCTTCGTCTAT

>In-frame_NCSTN_ENST00000392212_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_909nt
ATGGACTTTAATCTCATTTTAGAAAGTTTGTGCAGGGGAAACTCAGTGGAGAGGAAGATATATATCCCCTTAAATAAAACAGCTCCCTGT
GTTCGCCTGCTCAACGCCACTCATCAGATTGGCTGCCAGTGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCATGTACACCCTGACC
AGCAACATCCCCGAGATCACGCCCTTCCTGATGTTCATCATCCTCGGTATACCCCTGCCTCTGGGAACCATAACCATCCTCTGCATTGAT
CTCGGCACTGACATGGTCCCTGCCATCTCCTTGGCTTATGAGTCAGCTGAAAGCGACATCATGAAGAGGCTTCCAAGGAACCCAAAGACG
GATAATCTGGTGAACCACCGTCTCATTGGCATGGCCTATGGACAGATTGGGATGATCCAGGCTCTGGCTGGATTCTTTACCTACTTTGTA
ATCCTGGCTGAGAATGGTTTTAGGCCTGTTGATCTGCTGGGCATCCGCCTCCACTGGGAAGATAAATACTTGAATGACCTGGAGGACAGC
TACGGACAGCAGTGGACCTATGAGCAACGAAAAGTTGTGGAGTTCACATGCCAAACGGCCTTTTTTGTCACCATCGTGGTTGTGCAGTGG
GCGGATCTCATCATCTCCAAGACTCGCCGCAACTCACTTTTCCAGCAGGGCATGAGAAACAAAGTCTTAATATTTGGGATCCTGGAGGAG
ACACTCTTGGCTGCATTTCTGTCCTACACTCCAGGCATGGACGTGGCCCTGCGAATGTACCCACTCAAGATAACCTGGTGGCTCTGTGCC
ATTCCCTACAGTATTCTCATCTTCGTCTATGATGAAATCAGAAAACTCCTCATCCGTCAGCACCCGGATGGCTGGGTGGAAAGGGAGACG


* Fusion transcript sequences (Full-length transcript).
>In-frame_NCSTN_ENST00000294785_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_1372nt
GCGCCTGGAAACACGAACTTCCGGTCTCTTAGGCTCCGGGCCACAGAGACGGTGTCAGTGGTAGCCTAGAGAGGCCGCTAACAGACAGGA
GCCGAACGGGGGCTTCCGCTCAGCAGAGAGGCAAGATGGCTACGGCAGGGGGTGGCTCTGGGGCTGACCCGGGAAGTCGGGGTCTCCTTC
GCCTTCTGTCTTTCTGCGTCCTACTAGCAGGTTTGTGCAGGGGAAACTCAGTGGAGAGGAAGATATATATCCCCTTAAATAAAACAGCTC
CCTGTGTTCGCCTGCTCAACGCCACTCATCAGATTGGCTGCCAGTGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCATGTACACCC
TGACCAGCAACATCCCCGAGATCACGCCCTTCCTGATGTTCATCATCCTCGGTATACCCCTGCCTCTGGGAACCATAACCATCCTCTGCA
TTGATCTCGGCACTGACATGGTCCCTGCCATCTCCTTGGCTTATGAGTCAGCTGAAAGCGACATCATGAAGAGGCTTCCAAGGAACCCAA
AGACGGATAATCTGGTGAACCACCGTCTCATTGGCATGGCCTATGGACAGATTGGGATGATCCAGGCTCTGGCTGGATTCTTTACCTACT
TTGTAATCCTGGCTGAGAATGGTTTTAGGCCTGTTGATCTGCTGGGCATCCGCCTCCACTGGGAAGATAAATACTTGAATGACCTGGAGG
ACAGCTACGGACAGCAGTGGACCTATGAGCAACGAAAAGTTGTGGAGTTCACATGCCAAACGGCCTTTTTTGTCACCATCGTGGTTGTGC
AGTGGGCGGATCTCATCATCTCCAAGACTCGCCGCAACTCACTTTTCCAGCAGGGCATGAGAAACAAAGTCTTAATATTTGGGATCCTGG
AGGAGACACTCTTGGCTGCATTTCTGTCCTACACTCCAGGCATGGACGTGGCCCTGCGAATGTACCCACTCAAGATAACCTGGTGGCTCT
GTGCCATTCCCTACAGTATTCTCATCTTCGTCTATGATGAAATCAGAAAACTCCTCATCCGTCAGCACCCGGATGGCTGGGTGGAAAGGG
AGACGTACTACTAAACTCAGCAGATGAAGAGCTTCATGTGACACAGGGGTGTTGTGAGAGCTGGGATGGGGCCAGAGATTATAAGTTTGA
CACAACATCTGAGACACTAGGATGAATTATCTTGGATGAGAAAGATGGGCAATCCTGGGCTGGCTTGAGGGAATCATGGGCAGAGGATGA
GGTGGGCTGAAGGGAAGCCCAGCCTGCATCTAGCTGGAGCCCCGCAGGGAGGGGCATGGTCCTGCTGAATCCCGTAGCCAGTCTAGACAG

>In-frame_NCSTN_ENST00000368063_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_1467nt
AGAGACGGTGTCAGTGGTAGCCTAGAGAGGCCGCTAACAGACAGGAGCCGAACGGGGGCTTCCGCTCAGCAGAGAGGCAAGATGGCTACG
GCAGGGGGTGGCTCTGGGGCTGACCCGGGAAGTCGGGGTCTCCTTCGCCTTCTGTCTTTCTGCGTCCTACTAGCAGTGTCACTGTCAATG
GCGCTACATGGACTTTGTAATAACCCTTTGAGGCACATAGCTGGGTGCCATGTAGAACATGTATCTGTTACGATAAGTGTGTGCCCAAGA
AATCAGAAGAATGGACTTTAATCTCATTTTAGAAAGTTTGTGCAGGGGAAACTCAGTGGAGAGGAAGATATATATCCCCTTAAATAAAAC
AGCTCCCTGTGTTCGCCTGCTCAACGCCACTCATCAGATTGGCTGCCAGTGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCATGTA
CACCCTGACCAGCAACATCCCCGAGATCACGCCCTTCCTGATGTTCATCATCCTCGGTATACCCCTGCCTCTGGGAACCATAACCATCCT
CTGCATTGATCTCGGCACTGACATGGTCCCTGCCATCTCCTTGGCTTATGAGTCAGCTGAAAGCGACATCATGAAGAGGCTTCCAAGGAA
CCCAAAGACGGATAATCTGGTGAACCACCGTCTCATTGGCATGGCCTATGGACAGATTGGGATGATCCAGGCTCTGGCTGGATTCTTTAC
CTACTTTGTAATCCTGGCTGAGAATGGTTTTAGGCCTGTTGATCTGCTGGGCATCCGCCTCCACTGGGAAGATAAATACTTGAATGACCT
GGAGGACAGCTACGGACAGCAGTGGACCTATGAGCAACGAAAAGTTGTGGAGTTCACATGCCAAACGGCCTTTTTTGTCACCATCGTGGT
TGTGCAGTGGGCGGATCTCATCATCTCCAAGACTCGCCGCAACTCACTTTTCCAGCAGGGCATGAGAAACAAAGTCTTAATATTTGGGAT
CCTGGAGGAGACACTCTTGGCTGCATTTCTGTCCTACACTCCAGGCATGGACGTGGCCCTGCGAATGTACCCACTCAAGATAACCTGGTG
GCTCTGTGCCATTCCCTACAGTATTCTCATCTTCGTCTATGATGAAATCAGAAAACTCCTCATCCGTCAGCACCCGGATGGCTGGGTGGA
AAGGGAGACGTACTACTAAACTCAGCAGATGAAGAGCTTCATGTGACACAGGGGTGTTGTGAGAGCTGGGATGGGGCCAGAGATTATAAG
TTTGACACAACATCTGAGACACTAGGATGAATTATCTTGGATGAGAAAGATGGGCAATCCTGGGCTGGCTTGAGGGAATCATGGGCAGAG
GATGAGGTGGGCTGAAGGGAAGCCCAGCCTGCATCTAGCTGGAGCCCCGCAGGGAGGGGCATGGTCCTGCTGAATCCCGTAGCCAGTCTA

>In-frame_NCSTN_ENST00000535857_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_1258nt
AGAGAGGCAAGATGGCTACGGCAGGGGGTGGCTCTGGGGCTGACCCGGGAAGTCGGGGTCTCCTTCGCCTTCTGTCTTTCTGCGTCCTAC
TAGCAGGTTTGTGCAGGGGAAACTCAGTGGAGAGGAAGATATATATCCCCTTAAATAAAACAGCTCCCTGTGTTCGCCTGCTCAACGCCA
CTCATCAGATTGGCTGCCAGTGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCATGTACACCCTGACCAGCAACATCCCCGAGATCA
CGCCCTTCCTGATGTTCATCATCCTCGGTATACCCCTGCCTCTGGGAACCATAACCATCCTCTGCATTGATCTCGGCACTGACATGGTCC
CTGCCATCTCCTTGGCTTATGAGTCAGCTGAAAGCGACATCATGAAGAGGCTTCCAAGGAACCCAAAGACGGATAATCTGGTGAACCACC
GTCTCATTGGCATGGCCTATGGACAGATTGGGATGATCCAGGCTCTGGCTGGATTCTTTACCTACTTTGTAATCCTGGCTGAGAATGGTT
TTAGGCCTGTTGATCTGCTGGGCATCCGCCTCCACTGGGAAGATAAATACTTGAATGACCTGGAGGACAGCTACGGACAGCAGTGGACCT
ATGAGCAACGAAAAGTTGTGGAGTTCACATGCCAAACGGCCTTTTTTGTCACCATCGTGGTTGTGCAGTGGGCGGATCTCATCATCTCCA
AGACTCGCCGCAACTCACTTTTCCAGCAGGGCATGAGAAACAAAGTCTTAATATTTGGGATCCTGGAGGAGACACTCTTGGCTGCATTTC
TGTCCTACACTCCAGGCATGGACGTGGCCCTGCGAATGTACCCACTCAAGATAACCTGGTGGCTCTGTGCCATTCCCTACAGTATTCTCA
TCTTCGTCTATGATGAAATCAGAAAACTCCTCATCCGTCAGCACCCGGATGGCTGGGTGGAAAGGGAGACGTACTACTAAACTCAGCAGA
TGAAGAGCTTCATGTGACACAGGGGTGTTGTGAGAGCTGGGATGGGGCCAGAGATTATAAGTTTGACACAACATCTGAGACACTAGGATG
AATTATCTTGGATGAGAAAGATGGGCAATCCTGGGCTGGCTTGAGGGAATCATGGGCAGAGGATGAGGTGGGCTGAAGGGAAGCCCAGCC

>In-frame_NCSTN_ENST00000392212_chr1_160314616_+_ATP1A4_ENST00000368081_chr1_160145882_+_1187nt
ATGGACTTTAATCTCATTTTAGAAAGTTTGTGCAGGGGAAACTCAGTGGAGAGGAAGATATATATCCCCTTAAATAAAACAGCTCCCTGT
GTTCGCCTGCTCAACGCCACTCATCAGATTGGCTGCCAGTGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCATGTACACCCTGACC
AGCAACATCCCCGAGATCACGCCCTTCCTGATGTTCATCATCCTCGGTATACCCCTGCCTCTGGGAACCATAACCATCCTCTGCATTGAT
CTCGGCACTGACATGGTCCCTGCCATCTCCTTGGCTTATGAGTCAGCTGAAAGCGACATCATGAAGAGGCTTCCAAGGAACCCAAAGACG
GATAATCTGGTGAACCACCGTCTCATTGGCATGGCCTATGGACAGATTGGGATGATCCAGGCTCTGGCTGGATTCTTTACCTACTTTGTA
ATCCTGGCTGAGAATGGTTTTAGGCCTGTTGATCTGCTGGGCATCCGCCTCCACTGGGAAGATAAATACTTGAATGACCTGGAGGACAGC
TACGGACAGCAGTGGACCTATGAGCAACGAAAAGTTGTGGAGTTCACATGCCAAACGGCCTTTTTTGTCACCATCGTGGTTGTGCAGTGG
GCGGATCTCATCATCTCCAAGACTCGCCGCAACTCACTTTTCCAGCAGGGCATGAGAAACAAAGTCTTAATATTTGGGATCCTGGAGGAG
ACACTCTTGGCTGCATTTCTGTCCTACACTCCAGGCATGGACGTGGCCCTGCGAATGTACCCACTCAAGATAACCTGGTGGCTCTGTGCC
ATTCCCTACAGTATTCTCATCTTCGTCTATGATGAAATCAGAAAACTCCTCATCCGTCAGCACCCGGATGGCTGGGTGGAAAGGGAGACG
TACTACTAAACTCAGCAGATGAAGAGCTTCATGTGACACAGGGGTGTTGTGAGAGCTGGGATGGGGCCAGAGATTATAAGTTTGACACAA
CATCTGAGACACTAGGATGAATTATCTTGGATGAGAAAGATGGGCAATCCTGGGCTGGCTTGAGGGAATCATGGGCAGAGGATGAGGTGG
GCTGAAGGGAAGCCCAGCCTGCATCTAGCTGGAGCCCCGCAGGGAGGGGCATGGTCCTGCTGAATCCCGTAGCCAGTCTAGACAGTAAAT


Top

FusionGenePPI for NCSTN_ATP1A4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NCSTNAPH1A, PSEN1, PSENEN, PSEN2, APP, BACE1, ELAVL1, SPP1, FBXO6, ATP6V1B1, RPS14, THRAP3, RAD50, SRSF11, SEPT7, SEPT2, FTSJ3, USP39, UTP14A, RPS11, RBM25, PRPF6, SRSF10, RRS1, TRA2A, TRIM55, RRP7A, PSIP1, NUMA1, NOP56, TOP1, PHGDH, SURF4, RCC1, TOP2B, PRPF40A, SMARCC2, SRSF1, RFC4, SAP18, NOP58, SUPT16H, U2AF1, NOP16, SLC27A2, RCC2, BCAS2, NOP2, PCDHA2, TPBG, GTF3C1, S100A9, SNRPD2, SSRP1, RPS7, IK, DPF2, SMARCA5, SMARCB1, LMNB1, LAMP2, SART1, TRMT112, WDR18, RSL1D1, SMU1, ZC3H18, HNRNPU, RAB31, MYBBP1A, SAFB, TMEM14B, HNRNPR, APH1B, ERLIN2, GSAP, LGALS3, HNRNPF, KHDRBS1, NTRK1, EWSR1, ALDOA, SLC25A5, ATP1A1, ATP2A2, ATP5A1, BSG, NDUFB5, SLC2A1, SLC7A5, SLC25A12, TRIP13, TTI1, TOMM20, SCAMP3, RPP38, SPTLC1, EBP, YIF1A, MAGED2, PRSS21, IMMT, ELL2, PNKD, TCTN3, CRNKL1, TRMT6, ESYT2, SQRDL, SRPRB, FASTKD5, FAM111A, MMS19, WLS, CLPTM1L, MAGT1, C19orf52, SFXN1, ACTA1, ALOX5, MICAL1, RRAS, SRC, PAG1, EEF1A2, EEPD1, PTPRG, VASN, AHNAK2, EPHA2, YES1, RAP2A, NCAM1ATP1A4CUL3, COPS5, CAND1, P2RY8, ATP1B4, CHRM3, HIST1H4A, RPGR, LRRCC1, CYLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneATP1A4chr1:160314616chr1:160145882ENST00000470705+0590_92-37166phosphoinositide-3 kinase


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneATP1A4chr1:160314616chr1:160145882ENST00000368081+142290_927701030phosphoinositide-3 kinase


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NCSTN_ATP1A4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NCSTN_ATP1A4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNCSTNC1840560Hidradenitis suppurativa, familial2CTD_human;UNIPROT
HgeneNCSTNC0002395Alzheimer's Disease1CTD_human