FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23745

FusionGeneSummary for NCOR2_SCARB1

check button Fusion gene summary
Fusion gene informationFusion gene name: NCOR2_SCARB1
Fusion gene ID: 23745
HgeneTgene
Gene symbol

NCOR2

SCARB1

Gene ID

9612

949

Gene namenuclear receptor corepressor 2scavenger receptor class B member 1
SynonymsCTG26|N-CoR2|SMAP270|SMRT|SMRTE|SMRTE-tau|TNRC14|TRAC|TRAC-1|TRAC1CD36L1|CLA-1|CLA1|HDLQTL6|SR-BI|SRB1
Cytomap

12q24.31

12q24.31

Type of geneprotein-codingprotein-coding
Descriptionnuclear receptor corepressor 2CTG repeat protein 26T3 receptor-associating factorsilencing mediator for retinoid and thyroid hormone receptorsthyroid-, retinoic-acid-receptor-associated corepressorscavenger receptor class B member 1CD36 and LIMPII analogous 1CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1scavenger receptor class B type III
Modification date2018052720180520
UniProtAcc

Q9Y618

Q8WTV0

Ensembl transtripts involved in fusion geneENST00000405201, ENST00000404621, 
ENST00000404121, ENST00000356219, 
ENST00000397355, ENST00000429285, 
ENST00000339570, ENST00000415380, 
ENST00000261693, ENST00000376788, 
ENST00000546215, ENST00000535005, 
ENST00000541205, ENST00000540495, 
ENST00000544327, 
Fusion gene scores* DoF score18 X 20 X 15=54003 X 7 X 9=189
# samples 3013
** MAII scorelog2(30/5400*10)=-4.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(13/189*10)=-0.539874611192618
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NCOR2 [Title/Abstract] AND SCARB1 [Title/Abstract] AND fusion [Title/Abstract]

Characterization of fusion genes in common and rare epithelial ovarian cancer histologic subtypes (pmid: 28423358)
Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSCARB1

GO:0010886

positive regulation of cholesterol storage

9211901

TgeneSCARB1

GO:0015920

lipopolysaccharide transport

12651854

TgeneSCARB1

GO:0032497

detection of lipopolysaccharide

12651854

TgeneSCARB1

GO:0034384

high-density lipoprotein particle clearance

9211901

TgeneSCARB1

GO:0043654

recognition of apoptotic cell

9211901

TgeneSCARB1

GO:0051000

positive regulation of nitric-oxide synthase activity

11792700


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVACCTCGA-OR-A5KY-01ANCOR2chr12

124882665

-SCARB1chr12

125263132

-
TCGARVBRCATCGA-B6-A0X1-01ANCOR2chr12

124904503

-SCARB1chr12

125302253

-
TCGARVESCATCGA-2H-A9GN-01ANCOR2chr12

125020111

-SCARB1chr12

125271049

-
TCGARVESCATCGA-L5-A43M-01ANCOR2chr12

125020111

-SCARB1chr12

125302253

-
TCGARVESCATCGA-L5-A891-01ANCOR2chr12

125051854

-SCARB1chr12

125302253

-
TCGARVLUADTCGA-55-8301-01ANCOR2chr12

125020111

-SCARB1chr12

125284788

-
TCGARVLUADTCGA-78-7152-01ANCOR2chr12

125051854

-SCARB1chr12

125302253

-
TCGARVSARCTCGA-QQ-A8VH-01ANCOR2chr12

124904503

-SCARB1chr12

125302253

-
TCGARVSTADTCGA-CD-A4MH-01ANCOR2chr12

125020111

-SCARB1chr12

125302253

-
TCGARVSTADTCGA-VQ-A91Y-01ANCOR2chr12

124979693

-SCARB1chr12

125302253

-
TCGARVUCECTCGA-E6-A8L9-01ANCOR2chr12

125051854

-SCARB1chr12

125279814

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000405201ENST00000339570NCOR2chr12

124882665

-SCARB1chr12

125263132

-
In-frameENST00000405201ENST00000415380NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000405201ENST00000261693NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000405201ENST00000376788NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000405201ENST00000546215NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000405201ENST00000535005NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000405201ENST00000541205NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000405201ENST00000540495NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000405201ENST00000544327NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000404621ENST00000339570NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000404621ENST00000415380NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000404621ENST00000261693NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000404621ENST00000376788NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000404621ENST00000546215NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000404621ENST00000535005NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000404621ENST00000541205NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000404621ENST00000540495NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000404621ENST00000544327NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000404121ENST00000339570NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000404121ENST00000415380NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000404121ENST00000261693NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000404121ENST00000376788NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000404121ENST00000546215NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000404121ENST00000535005NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000404121ENST00000541205NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000404121ENST00000540495NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000404121ENST00000544327NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000356219ENST00000339570NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000356219ENST00000415380NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000356219ENST00000261693NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000356219ENST00000376788NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000356219ENST00000546215NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000356219ENST00000535005NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000356219ENST00000541205NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000356219ENST00000540495NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000356219ENST00000544327NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000397355ENST00000339570NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000397355ENST00000415380NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000397355ENST00000261693NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000397355ENST00000376788NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000397355ENST00000546215NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000397355ENST00000535005NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000397355ENST00000541205NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000397355ENST00000540495NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000397355ENST00000544327NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000429285ENST00000339570NCOR2chr12

124882665

-SCARB1chr12

125263132

-
Frame-shiftENST00000429285ENST00000415380NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000429285ENST00000261693NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000429285ENST00000376788NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-3UTRENST00000429285ENST00000546215NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000429285ENST00000535005NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000429285ENST00000541205NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000429285ENST00000540495NCOR2chr12

124882665

-SCARB1chr12

125263132

-
5CDS-intronENST00000429285ENST00000544327NCOR2chr12

124882665

-SCARB1chr12

125263132

-
In-frameENST00000405201ENST00000339570NCOR2chr12

124904503

-SCARB1chr12

125302253

-
In-frameENST00000405201ENST00000415380NCOR2chr12

124904503

-SCARB1chr12

125302253

-
In-frameENST00000405201ENST00000261693NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000405201ENST00000376788NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000405201ENST00000546215NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000405201ENST00000535005NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000405201ENST00000541205NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000405201ENST00000540495NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000405201ENST00000544327NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000404621ENST00000339570NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000404621ENST00000415380NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000404621ENST00000261693NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000404621ENST00000376788NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000404621ENST00000546215NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404621ENST00000535005NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404621ENST00000541205NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404621ENST00000540495NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404621ENST00000544327NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000404121ENST00000339570NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000404121ENST00000415380NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000404121ENST00000261693NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000404121ENST00000376788NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000404121ENST00000546215NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404121ENST00000535005NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404121ENST00000541205NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404121ENST00000540495NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404121ENST00000544327NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000356219ENST00000339570NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000356219ENST00000415380NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000356219ENST00000261693NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000356219ENST00000376788NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000356219ENST00000546215NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000356219ENST00000535005NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000356219ENST00000541205NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000356219ENST00000540495NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000356219ENST00000544327NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000397355ENST00000339570NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000397355ENST00000415380NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000397355ENST00000261693NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000397355ENST00000376788NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000397355ENST00000546215NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000397355ENST00000535005NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000397355ENST00000541205NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000397355ENST00000540495NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000397355ENST00000544327NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000429285ENST00000339570NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000429285ENST00000415380NCOR2chr12

124904503

-SCARB1chr12

125302253

-
Frame-shiftENST00000429285ENST00000261693NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000429285ENST00000376788NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-intronENST00000429285ENST00000546215NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000429285ENST00000535005NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000429285ENST00000541205NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000429285ENST00000540495NCOR2chr12

124904503

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000429285ENST00000544327NCOR2chr12

124904503

-SCARB1chr12

125302253

-
intron-3CDSENST00000405201ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125271049

-
intron-3CDSENST00000405201ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125271049

-
intron-3CDSENST00000405201ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125271049

-
intron-3CDSENST00000405201ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125271049

-
intron-3CDSENST00000405201ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125271049

-
intron-5UTRENST00000405201ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125271049

-
intron-5UTRENST00000405201ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125271049

-
intron-5UTRENST00000405201ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125271049

-
intron-5UTRENST00000405201ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404621ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404621ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404621ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404621ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404621ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000404621ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000404621ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000404621ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000404621ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404121ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404121ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404121ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404121ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000404121ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000404121ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000404121ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000404121ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000404121ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000356219ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000356219ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000356219ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000356219ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000356219ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000356219ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000356219ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000356219ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000356219ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000397355ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000397355ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000397355ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000397355ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000397355ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000397355ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000397355ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000397355ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000397355ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000429285ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000429285ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000429285ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000429285ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-3CDSENST00000429285ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000429285ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000429285ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000429285ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125271049

-
5UTR-5UTRENST00000429285ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125271049

-
intron-3CDSENST00000405201ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125302253

-
intron-3CDSENST00000405201ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125302253

-
intron-3CDSENST00000405201ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125302253

-
intron-intronENST00000405201ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125302253

-
intron-intronENST00000405201ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125302253

-
intron-5UTRENST00000405201ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125302253

-
intron-5UTRENST00000405201ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125302253

-
intron-5UTRENST00000405201ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125302253

-
intron-5UTRENST00000405201ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000404621ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000404621ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000404621ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000404621ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000404621ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404621ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404621ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404621ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404621ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000404121ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000404121ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000404121ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000404121ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000404121ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404121ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404121ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404121ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404121ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000356219ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000356219ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000356219ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000356219ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000356219ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000356219ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000356219ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000356219ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000356219ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000397355ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000397355ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000397355ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000397355ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000397355ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000397355ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000397355ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000397355ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000397355ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000429285ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000429285ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000429285ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000429285ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-intronENST00000429285ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000429285ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000429285ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000429285ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000429285ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125302253

-
intron-3CDSENST00000405201ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000405201ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000405201ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000405201ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000405201ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000405201ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000405201ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000405201ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000405201ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000404621ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000404621ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000404621ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000404621ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000404621ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000404621ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000404621ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000404621ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000404621ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000404121ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000404121ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000404121ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000404121ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000404121ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000404121ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000404121ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000404121ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000404121ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000356219ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000356219ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000356219ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000356219ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000356219ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000356219ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000356219ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000356219ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000356219ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000397355ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000397355ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000397355ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000397355ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000397355ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000397355ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000397355ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000397355ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000397355ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000429285ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000429285ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000429285ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000429285ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-intronENST00000429285ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000429285ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000429285ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000429285ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-5UTRENST00000429285ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125302253

-
intron-3CDSENST00000405201ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125284788

-
intron-3CDSENST00000405201ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125284788

-
intron-3CDSENST00000405201ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125284788

-
intron-3CDSENST00000405201ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125284788

-
intron-3CDSENST00000405201ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125284788

-
intron-5UTRENST00000405201ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125284788

-
intron-5UTRENST00000405201ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125284788

-
intron-5UTRENST00000405201ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125284788

-
intron-5UTRENST00000405201ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404621ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404621ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404621ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404621ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404621ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000404621ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000404621ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000404621ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000404621ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404121ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404121ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404121ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404121ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000404121ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000404121ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000404121ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000404121ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000404121ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000356219ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000356219ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000356219ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000356219ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000356219ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000356219ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000356219ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000356219ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000356219ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000397355ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000397355ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000397355ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000397355ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000397355ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000397355ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000397355ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000397355ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000397355ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000429285ENST00000339570NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000429285ENST00000415380NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000429285ENST00000261693NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000429285ENST00000376788NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-3CDSENST00000429285ENST00000546215NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000429285ENST00000535005NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000429285ENST00000541205NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000429285ENST00000540495NCOR2chr12

125020111

-SCARB1chr12

125284788

-
5UTR-5UTRENST00000429285ENST00000544327NCOR2chr12

125020111

-SCARB1chr12

125284788

-
In-frameENST00000405201ENST00000339570NCOR2chr12

124979693

-SCARB1chr12

125302253

-
In-frameENST00000405201ENST00000415380NCOR2chr12

124979693

-SCARB1chr12

125302253

-
In-frameENST00000405201ENST00000261693NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000405201ENST00000376788NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000405201ENST00000546215NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000405201ENST00000535005NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000405201ENST00000541205NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000405201ENST00000540495NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000405201ENST00000544327NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000404621ENST00000339570NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000404621ENST00000415380NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000404621ENST00000261693NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000404621ENST00000376788NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000404621ENST00000546215NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404621ENST00000535005NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404621ENST00000541205NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404621ENST00000540495NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000404621ENST00000544327NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000404121ENST00000339570NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000404121ENST00000415380NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5UTR-3CDSENST00000404121ENST00000261693NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5UTR-intronENST00000404121ENST00000376788NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5UTR-intronENST00000404121ENST00000546215NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404121ENST00000535005NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404121ENST00000541205NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404121ENST00000540495NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5UTR-5UTRENST00000404121ENST00000544327NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000356219ENST00000339570NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000356219ENST00000415380NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000356219ENST00000261693NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000356219ENST00000376788NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000356219ENST00000546215NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000356219ENST00000535005NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000356219ENST00000541205NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000356219ENST00000540495NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000356219ENST00000544327NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000397355ENST00000339570NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000397355ENST00000415380NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000397355ENST00000261693NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000397355ENST00000376788NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000397355ENST00000546215NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000397355ENST00000535005NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000397355ENST00000541205NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000397355ENST00000540495NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000397355ENST00000544327NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000429285ENST00000339570NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000429285ENST00000415380NCOR2chr12

124979693

-SCARB1chr12

125302253

-
Frame-shiftENST00000429285ENST00000261693NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000429285ENST00000376788NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-intronENST00000429285ENST00000546215NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000429285ENST00000535005NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000429285ENST00000541205NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000429285ENST00000540495NCOR2chr12

124979693

-SCARB1chr12

125302253

-
5CDS-5UTRENST00000429285ENST00000544327NCOR2chr12

124979693

-SCARB1chr12

125302253

-
intron-3CDSENST00000405201ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000405201ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000405201ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000405201ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000405201ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000405201ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000405201ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000405201ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000405201ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404621ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404621ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404621ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404621ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404621ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000404621ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000404621ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000404621ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000404621ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404121ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404121ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404121ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404121ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000404121ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000404121ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000404121ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000404121ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000404121ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000356219ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000356219ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000356219ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000356219ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000356219ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000356219ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000356219ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000356219ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000356219ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000397355ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000397355ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000397355ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000397355ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000397355ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000397355ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000397355ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000397355ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000397355ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000429285ENST00000339570NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000429285ENST00000415380NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000429285ENST00000261693NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000429285ENST00000376788NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-3CDSENST00000429285ENST00000546215NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000429285ENST00000535005NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000429285ENST00000541205NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000429285ENST00000540495NCOR2chr12

125051854

-SCARB1chr12

125279814

-
intron-5UTRENST00000429285ENST00000544327NCOR2chr12

125051854

-SCARB1chr12

125279814

-

Top

FusionProtFeatures for NCOR2_SCARB1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NCOR2

Q9Y618

SCARB1

Q8WTV0

Transcriptional corepressor. Mediates thetranscriptional repression activity of some nuclear receptors bypromoting chromatin condensation, thus preventing access of thebasal transcription. Isoform 1 and isoform 5 have differentaffinities for different nuclear receptors. Involved in theregulation BCL6-dependent of the germinal center (GC) reactions,mainly through the control of the GC B-cells proliferation andsurvival. {ECO:0000269|PubMed:18212045,ECO:0000269|PubMed:23911289}. Receptor for different ligands such as phospholipids,cholesterol ester, lipoproteins, phosphatidylserine and apoptoticcells (PubMed:12016218, PubMed:12519372, PubMed:21226579).Receptor for HDL, mediating selective uptake of cholesteryl etherand HDL-dependent cholesterol efflux (PubMed:26965621). Alsofacilitates the flux of free and esterified cholesterol betweenthe cell surface and apoB-containing lipoproteins and modifiedlipoproteins, although less efficiently than HDL. May be involvedin the phagocytosis of apoptotic cells, via its phosphatidylserinebinding activity (PubMed:12016218). {ECO:0000269|PubMed:12016218,ECO:0000269|PubMed:12519372, ECO:0000269|PubMed:16020694,ECO:0000269|PubMed:21226579, ECO:0000269|PubMed:26965621}. (Microbial infection) Acts as a receptor for hepatitis Cvirus in hepatocytes and appears to facilitate its cell entry(PubMed:12356718, PubMed:12913001, PubMed:18000990). Bindingbetween SCARB1 and the hepatitis C virus glycoprotein E2 isindependent of the genotype of the viral isolate(PubMed:12356718). Mediates uptake of M.fortuitum, E.coli andS.aureus (PubMed:16020694). {ECO:0000269|PubMed:12356718,ECO:0000269|PubMed:16020694, ECO:0000269|PubMed:18000990}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-1748174_2156252522Coiled coilOntology_term=ECO:0000255
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-1748522_5616252522Coiled coilOntology_term=ECO:0000255
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-1448174_2154942522Coiled coilOntology_term=ECO:0000255
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-1748494_5106252522Compositional biasNote=Poly-Gln
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-1748427_4786252522DomainSANT 1
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-1448427_4784942522DomainSANT 1
TgeneSCARB1chr12:124882665chr12:125263132ENST00000376788-911465_552410616Topological domainCytoplasmic
TgeneSCARB1chr12:124904503chr12:125302253ENST00000261693-013465_55242734Topological domainCytoplasmic
TgeneSCARB1chr12:124904503chr12:125302253ENST00000376788-0111_11-43616Topological domainCytoplasmic
TgeneSCARB1chr12:124904503chr12:125302253ENST00000376788-01133_443-43616Topological domainExtracellular
TgeneSCARB1chr12:124904503chr12:125302253ENST00000376788-011465_552-43616Topological domainCytoplasmic
TgeneSCARB1chr12:124904503chr12:125302253ENST00000415380-012465_55242553Topological domainCytoplasmic
TgeneSCARB1chr12:124979693chr12:125302253ENST00000261693-013465_55242734Topological domainCytoplasmic
TgeneSCARB1chr12:124979693chr12:125302253ENST00000376788-0111_11-43616Topological domainCytoplasmic
TgeneSCARB1chr12:124979693chr12:125302253ENST00000376788-01133_443-43616Topological domainExtracellular
TgeneSCARB1chr12:124979693chr12:125302253ENST00000376788-011465_552-43616Topological domainCytoplasmic
TgeneSCARB1chr12:124979693chr12:125302253ENST00000415380-012465_55242553Topological domainCytoplasmic
TgeneSCARB1chr12:124882665chr12:125263132ENST00000376788-911444_464410616TransmembraneHelical
TgeneSCARB1chr12:124904503chr12:125302253ENST00000261693-013444_46442734TransmembraneHelical
TgeneSCARB1chr12:124904503chr12:125302253ENST00000376788-01112_32-43616TransmembraneHelical
TgeneSCARB1chr12:124904503chr12:125302253ENST00000376788-011444_464-43616TransmembraneHelical
TgeneSCARB1chr12:124904503chr12:125302253ENST00000415380-012444_46442553TransmembraneHelical
TgeneSCARB1chr12:124979693chr12:125302253ENST00000261693-013444_46442734TransmembraneHelical
TgeneSCARB1chr12:124979693chr12:125302253ENST00000376788-01112_32-43616TransmembraneHelical
TgeneSCARB1chr12:124979693chr12:125302253ENST00000376788-011444_464-43616TransmembraneHelical
TgeneSCARB1chr12:124979693chr12:125302253ENST00000415380-012444_46442553TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-1448522_5614942522Coiled coilOntology_term=ECO:0000255
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-248174_215352522Coiled coilOntology_term=ECO:0000255
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-248522_561352522Coiled coilOntology_term=ECO:0000255
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-17481392_13976252522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-17481850_18546252522Compositional biasNote=Poly-Gly
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-17482487_24906252522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-1748682_6856252522Compositional biasNote=Poly-Lys
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-1748778_8206252522Compositional biasNote=Pro-rich
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-1748995_10036252522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-14481392_13974942522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-14481850_18544942522Compositional biasNote=Poly-Gly
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-14482487_24904942522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-1448494_5104942522Compositional biasNote=Poly-Gln
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-1448682_6854942522Compositional biasNote=Poly-Lys
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-1448778_8204942522Compositional biasNote=Pro-rich
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-1448995_10034942522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-2481392_1397352522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-2481850_1854352522Compositional biasNote=Poly-Gly
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-2482487_2490352522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-248494_510352522Compositional biasNote=Poly-Gln
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-248682_685352522Compositional biasNote=Poly-Lys
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-248778_820352522Compositional biasNote=Pro-rich
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-248995_1003352522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-1748610_6616252522DomainSANT 2
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-1448610_6614942522DomainSANT 2
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-248427_478352522DomainSANT 1
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-248610_661352522DomainSANT 2
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-17482147_21516252522MotifNote=CORNR box of ID1
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-17482350_23546252522MotifNote=CORNR box of ID2
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-14482147_21514942522MotifNote=CORNR box of ID1
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-14482350_23544942522MotifNote=CORNR box of ID2
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-2482147_2151352522MotifNote=CORNR box of ID1
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-2482350_2354352522MotifNote=CORNR box of ID2
TgeneSCARB1chr12:124882665chr12:125263132ENST00000261693-11131_11510734Topological domainCytoplasmic
TgeneSCARB1chr12:124882665chr12:125263132ENST00000261693-111333_443510734Topological domainExtracellular
TgeneSCARB1chr12:124882665chr12:125263132ENST00000261693-1113465_552510734Topological domainCytoplasmic
TgeneSCARB1chr12:124882665chr12:125263132ENST00000376788-9111_11410616Topological domainCytoplasmic
TgeneSCARB1chr12:124882665chr12:125263132ENST00000376788-91133_443410616Topological domainExtracellular
TgeneSCARB1chr12:124882665chr12:125263132ENST00000415380-10121_11550553Topological domainCytoplasmic
TgeneSCARB1chr12:124882665chr12:125263132ENST00000415380-101233_443550553Topological domainExtracellular
TgeneSCARB1chr12:124882665chr12:125263132ENST00000415380-1012465_552550553Topological domainCytoplasmic
TgeneSCARB1chr12:124904503chr12:125302253ENST00000261693-0131_1142734Topological domainCytoplasmic
TgeneSCARB1chr12:124904503chr12:125302253ENST00000261693-01333_44342734Topological domainExtracellular
TgeneSCARB1chr12:124904503chr12:125302253ENST00000415380-0121_1142553Topological domainCytoplasmic
TgeneSCARB1chr12:124904503chr12:125302253ENST00000415380-01233_44342553Topological domainExtracellular
TgeneSCARB1chr12:124979693chr12:125302253ENST00000261693-0131_1142734Topological domainCytoplasmic
TgeneSCARB1chr12:124979693chr12:125302253ENST00000261693-01333_44342734Topological domainExtracellular
TgeneSCARB1chr12:124979693chr12:125302253ENST00000415380-0121_1142553Topological domainCytoplasmic
TgeneSCARB1chr12:124979693chr12:125302253ENST00000415380-01233_44342553Topological domainExtracellular
TgeneSCARB1chr12:124882665chr12:125263132ENST00000261693-111312_32510734TransmembraneHelical
TgeneSCARB1chr12:124882665chr12:125263132ENST00000261693-1113444_464510734TransmembraneHelical
TgeneSCARB1chr12:124882665chr12:125263132ENST00000376788-91112_32410616TransmembraneHelical
TgeneSCARB1chr12:124882665chr12:125263132ENST00000415380-101212_32550553TransmembraneHelical
TgeneSCARB1chr12:124882665chr12:125263132ENST00000415380-1012444_464550553TransmembraneHelical
TgeneSCARB1chr12:124904503chr12:125302253ENST00000261693-01312_3242734TransmembraneHelical
TgeneSCARB1chr12:124904503chr12:125302253ENST00000415380-01212_3242553TransmembraneHelical
TgeneSCARB1chr12:124979693chr12:125302253ENST00000261693-01312_3242734TransmembraneHelical
TgeneSCARB1chr12:124979693chr12:125302253ENST00000415380-01212_3242553TransmembraneHelical


Top

FusionGeneSequence for NCOR2_SCARB1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NCOR2_ENST00000405201_chr12_124882665_-_SCARB1_ENST00000339570_chr12_125263132_-_665aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENI
KINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN
FGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVEN
DKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQSAELASMELNESSRWTEEEMETAKKGSXGH

>In-frame_NCOR2_ENST00000405201_chr12_124882665_-_SCARB1_ENST00000415380_chr12_125263132_-_628aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENI
KINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN
FGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVEN

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000339570_chr12_125302253_-_959aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENI
KINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN
FGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRE
RGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGE
IMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTP
ESSLEFYSPEACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAV
TGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVL

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000415380_chr12_125302253_-_1005aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENI
KINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN
FGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRE
RGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGE
IMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTP
ESSLEFYSPEACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAV
TGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVL
LALGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGASDRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPV

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000261693_chr12_125302253_-_494aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENI
KINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000339570_chr12_125302253_-_959aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENI
KINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN
FGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRE
RGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGE
IMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTP
ESSLEFYSPEACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAV
TGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVL

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000415380_chr12_125302253_-_1005aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENI
KINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN
FGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRE
RGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGE
IMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTP
ESSLEFYSPEACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAV
TGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVL
LALGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGASDRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPV

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000261693_chr12_125302253_-_494aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENI
KINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN

>In-frame_NCOR2_ENST00000405201_chr12_124979693_-_SCARB1_ENST00000339570_chr12_125302253_-_500aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREF
RHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPL
VNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSP
EACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEA
HSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLL

>In-frame_NCOR2_ENST00000405201_chr12_124979693_-_SCARB1_ENST00000415380_chr12_125302253_-_546aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREF
RHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPL
VNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSP
EACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEA
HSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLL
VPVICQIRSQVGAGQRAARADSHSLACWGKGASDRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPVLEGLGPSLG

>In-frame_NCOR2_ENST00000405201_chr12_124979693_-_SCARB1_ENST00000261693_chr12_125302253_-_35aa


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NCOR2_ENST00000405201_chr12_124882665_-_SCARB1_ENST00000339570_chr12_125263132_-_1996nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACATC
AAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGC
GAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCGC
CAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG
AGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CCCATGCCCCGCAGCAGCCAGGAGGAGAAAGATGAGAAGGAGAAGGAAAAGGAGGCGGAGAAGGAGGAGGAGAAGCCGGAGGTGGAGAAC
GACAAGGAAGACCTCCTCAAGGAGAAGACAGACGACACCTCAGGGGAGGACAACGACGAGAAGGAGGCTGTGGCCTCCAAAGGCCGCAAA
ACTGCCAACAGCCAGGGAAGACGCAAAGGCCGCATCACCCGCTCAATGGCTAATGAGGCCAACAGCGAGGAGGCCATCACCCCCCAGCAG
AGCGCCGAGCTGGCCTCCATGGAGCTGAATGAGAGTTCTCGCTGGACAGAAGAAGAAATGGAAACAGCCAAGAAAGGGTCCTGAGGACAC
CGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGCCCCCCAGCCCCTACACCCCGCTTCTCCCGGACTCTCCCAGCGGACAGCCCCC

>In-frame_NCOR2_ENST00000405201_chr12_124882665_-_SCARB1_ENST00000415380_chr12_125263132_-_1884nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACATC
AAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGC
GAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCGC
CAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG
AGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CCCATGCCCCGCAGCAGCCAGGAGGAGAAAGATGAGAAGGAGAAGGAAAAGGAGGCGGAGAAGGAGGAGGAGAAGCCGGAGGTGGAGAAC
GACAAGGAAGACCTCCTCAAGGAGAAGACAGACGACACCTCAGGGGAGGACAACGACGAGAAGGAGGCTGTGGCCTCCAAAGGCCGCAAA
ACTGCCAACAGCCAGGGAAGACGCAAAGGCCGCATCACCCGCTCAATGGCTAATGAGGCCAACAGCGAGGAGGCCATCACCCCCCAGCAG

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000339570_chr12_125302253_-_2877nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACATC
AAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGC
GAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCGC
CAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG
AGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAG
ATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAG
CGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCACC
TTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGATG
GAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAG
ATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTT
GCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAAC
GGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCCT
GAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACC
TATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAATT
CAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGTG
ACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTG
CAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAG
AGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCTC
CTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGGTCCTGAGGACACCGTGAGCCAGCCAGGCCTG

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000415380_chr12_125302253_-_3015nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACATC
AAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGC
GAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCGC
CAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG
AGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAG
ATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAG
CGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCACC
TTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGATG
GAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAG
ATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTT
GCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAAC
GGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCCT
GAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACC
TATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAATT
CAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGTG
ACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTG
CAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAG
AGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCTC
CTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGTAGGTGCTGGCCAGAGGGCAGCCCGGGCTGAC
AGCCATTCGCTTGCCTGCTGGGGGAAAGGGGCCTCAGATCGGACCCTCTGGCCAACCGCAGCCTGGAGCCCACCTCCAGCAGCAGTCCTG
CGTCTCTGCCGGAGTGGGAGCGGTCACTGCTGGGGGCTGCGCAGCACGCTTGCGTCTTTTGCATGCCGCGTTGCCACTACTCTGCCTGTT

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000261693_chr12_125302253_-_1482nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACATC
AAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGC
GAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCGC
CAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000339570_chr12_125302253_-_2877nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACATC
AAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGC
GAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCGC
CAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG
AGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAG
ATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAG
CGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCACC
TTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGATG
GAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAG
ATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTT
GCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAAC
GGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCCT
GAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACC
TATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAATT
CAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGTG
ACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTG
CAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAG
AGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCTC
CTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGGTCCTGAGGACACCGTGAGCCAGCCAGGCCTG

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000415380_chr12_125302253_-_3015nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACATC
AAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGC
GAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCGC
CAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG
AGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAG
ATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAG
CGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCACC
TTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGATG
GAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAG
ATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTT
GCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAAC
GGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCCT
GAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACC
TATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAATT
CAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGTG
ACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTG
CAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAG
AGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCTC
CTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGTAGGTGCTGGCCAGAGGGCAGCCCGGGCTGAC
AGCCATTCGCTTGCCTGCTGGGGGAAAGGGGCCTCAGATCGGACCCTCTGGCCAACCGCAGCCTGGAGCCCACCTCCAGCAGCAGTCCTG
CGTCTCTGCCGGAGTGGGAGCGGTCACTGCTGGGGGCTGCGCAGCACGCTTGCGTCTTTTGCATGCCGCGTTGCCACTACTCTGCCTGTT

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000261693_chr12_125302253_-_1482nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACATC
AAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGC
GAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCGC
CAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG

>In-frame_NCOR2_ENST00000405201_chr12_124979693_-_SCARB1_ENST00000339570_chr12_125302253_-_1500nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAGATCCCTATCCCCTTCTATCTCTCCGTC
TACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAGCGCGGGCCCTACGTGTACAGGGAGTTC
AGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCACCTTCCAGTTCCAGCCCTCCAAGTCCCAC
GGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGATGGAGAATAAGCCCATGACCCTGAAGCTC
ATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAGATCATGTGGGGCTACAAGGACCCCCTT
GTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTTGCTGAGCTCAACAACTCCGACTCTGGG
CTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAACGGGCTGAGCAAGGTTGACTTCTGGCAT
TCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCCTGAGTCCTCGCTGGAGTTCTACAGCCCG
GAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACCTATCGCTTCGTGGCTCCCAAAACCCTG
TTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAATTCAGAACGTCAGCACCTGCAGGTTCAGT
GCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGTGACTGGCCTGCACCCTAACCAGGAGGCA
CACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTGCAGCTGAGCCTCTACATGAAATCTGTC
GCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAGAGCGGGGCCATGGAGGGGGAGACTCTT
CACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCTCCTGGCGCTGGGCTGCGTCCTGCTGCTG
GTCCCTGTCATCTGCCAAATCCGGAGCCAAGGTCCTGAGGACACCGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGCCCCCCAGC

>In-frame_NCOR2_ENST00000405201_chr12_124979693_-_SCARB1_ENST00000415380_chr12_125302253_-_1638nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAGATCCCTATCCCCTTCTATCTCTCCGTC
TACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAGCGCGGGCCCTACGTGTACAGGGAGTTC
AGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCACCTTCCAGTTCCAGCCCTCCAAGTCCCAC
GGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGATGGAGAATAAGCCCATGACCCTGAAGCTC
ATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAGATCATGTGGGGCTACAAGGACCCCCTT
GTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTTGCTGAGCTCAACAACTCCGACTCTGGG
CTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAACGGGCTGAGCAAGGTTGACTTCTGGCAT
TCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCCTGAGTCCTCGCTGGAGTTCTACAGCCCG
GAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACCTATCGCTTCGTGGCTCCCAAAACCCTG
TTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAATTCAGAACGTCAGCACCTGCAGGTTCAGT
GCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGTGACTGGCCTGCACCCTAACCAGGAGGCA
CACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTGCAGCTGAGCCTCTACATGAAATCTGTC
GCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAGAGCGGGGCCATGGAGGGGGAGACTCTT
CACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCTCCTGGCGCTGGGCTGCGTCCTGCTGCTG
GTCCCTGTCATCTGCCAAATCCGGAGCCAAGTAGGTGCTGGCCAGAGGGCAGCCCGGGCTGACAGCCATTCGCTTGCCTGCTGGGGGAAA
GGGGCCTCAGATCGGACCCTCTGGCCAACCGCAGCCTGGAGCCCACCTCCAGCAGCAGTCCTGCGTCTCTGCCGGAGTGGGAGCGGTCAC
TGCTGGGGGCTGCGCAGCACGCTTGCGTCTTTTGCATGCCGCGTTGCCACTACTCTGCCTGTTCTGGAAGGCCTGGGACCCTCCCTTGGA

>In-frame_NCOR2_ENST00000405201_chr12_124979693_-_SCARB1_ENST00000261693_chr12_125302253_-_105nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NCOR2_ENST00000405201_chr12_124882665_-_SCARB1_ENST00000339570_chr12_125263132_-_3608nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGC
TGCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACAT
CAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCA
GCGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCG
CGAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGG
GCTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCG
CCAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCAT
GAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAA
CTTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAA
GAGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCA
GCCCATGCCCCGCAGCAGCCAGGAGGAGAAAGATGAGAAGGAGAAGGAAAAGGAGGCGGAGAAGGAGGAGGAGAAGCCGGAGGTGGAGAA
CGACAAGGAAGACCTCCTCAAGGAGAAGACAGACGACACCTCAGGGGAGGACAACGACGAGAAGGAGGCTGTGGCCTCCAAAGGCCGCAA
AACTGCCAACAGCCAGGGAAGACGCAAAGGCCGCATCACCCGCTCAATGGCTAATGAGGCCAACAGCGAGGAGGCCATCACCCCCCAGCA
GAGCGCCGAGCTGGCCTCCATGGAGCTGAATGAGAGTTCTCGCTGGACAGAAGAAGAAATGGAAACAGCCAAGAAAGGGTCCTGAGGACA
CCGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGCCCCCCAGCCCCTACACCCCGCTTCTCCCGGACTCTCCCAGCGGACAGCCCC
CCAGCCCCACAGCCTGAGCCTCCCAGCTGCCATGTGCCTGTTGCACACCTGCACACACGCCCTGGCACACATACACACATGCGTGCAGGC
TTGTGCAGACACTCAGGGATGGAGCTGCTGCTGAAGGGACTTGTAGGGAGAGGCTCGTCAACAAGCACTGTTCTGGAACCTTCTCTCCAC
GTGGCCCACAGGCCTGACCACAGGGGCTGTGGGTCCTGCGTCCCCTTCCTCGGGTGAGCCTGGCCTGTCCCGTTCAGCCGTTGGGCCCAG
GCTTCCTCCCCTCCAAGGTGAAACACTGCAGTCCCGGTGTGGTGGCTCCCCATGCAGGACGGGCCAGGCTGGGAGTGCCGCCTTCCTGTG
CCAAATTCAGTGGGGACTCAGTGCCCAGGCCCTGGCCACGAGCTTTGGCCTTGGTCTACCTGCCAGGCCAGGCAAAGCGCCTTTACACAG
GCCTCGGAAAACAATGGAGTGAGCACAAGATGCCCTGTGCAGCTGCCCGAGGGTCTCCGCCCACCCCGGCCGGACTTTGATCCCCCCGAA
GTCTTCACAGGCACTGCATCGGGTTGTCTGGCGCCCTTTTCCTCCAGCCTAAACTGACATCATCCTATGGACTGAGCCGGCCACTCTCTG
GCCGAAGTGGCCGCAGGCTGTGCCCCCGAGCTGCCCCCACCCCCTCACAGGGTCCCTCAGATTATAGGTGCCCAGGCTGAGGTGAAGAGG
CCTGGGGGCCCTGCCTTCCGGGCGCTCCTGGACCCTGGGGCAAACCTGTGACCCTTTTCTACTGGAATAGAAATGAGTTTTATCATCTTT
GAAAAATAATTCACTCTTGAAGTAATAAACGTTTAAAAAAATGGGATGCCTGCCTCTGTGACAGCCTTGTTTGCTGAGGTCGTGGGGGTG
GGGGCCTCTGGGAAGTTCCGGGCTCCTCTTCTCTTGGTCAATAGCTCCTTTCTGGTGGCTGCCAAGAGCGTCTCTCCCAGGGCCGGGCTG
CTGGCTTACCTTCCTGTTGTTTTCAAATTTCAACCTTGTGCAATGTTGAGTTTCATAGAAATACTGCATGAGTACGCCCTTGTTTAGAAG
CAGCAGGGTCTGAGTCCCATCCCACAGCCCCCAGTGCAGACGCTTTTGCCACTTTTGCATGGGGCCCCCTGGATGTGTTTCTGTGCATTT
ATCTACAAATCCTGGTGCCCATAGGACATGCCCCGTGTTGTTCTAGGCCTTTGCTTTCTGCTCGTTACATAAATGGTGAAGAAGAGAAGC
GGGTAAGAGAACAGATTGGAGCCATCTAAAAGTTCTCATCTTAAGTGTAGATCATTGCAAAGGATGGAATTTTCTCCGATTGTCATCATC
GTTGATGTTTGAATATGAGACCATTTCATCAGTATTTAAGTGTGCCCGCTGGGATCTAACTAGGAGAGGAGAGGGTATTCACTGCCGAAC
ATTTCAAAGAATATACGAACAAGCTCTTTTATGGTCAGAAATGTTAGCCCTTTTCCCCTTAAACTTGTATTTCCTTTCTTCTTCCCTCCT
AAAATTTTATCTAAATGATATTTATATTTGATGCTTTTAAGCCTTTTATTAATCACTCCTATACTTGCCTGCAACATAAATATATAAGTT

>In-frame_NCOR2_ENST00000405201_chr12_124882665_-_SCARB1_ENST00000415380_chr12_125263132_-_2831nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGC
TGCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACAT
CAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCA
GCGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCG
CGAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGG
GCTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCG
CCAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCAT
GAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAA
CTTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAA
GAGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCA
GCCCATGCCCCGCAGCAGCCAGGAGGAGAAAGATGAGAAGGAGAAGGAAAAGGAGGCGGAGAAGGAGGAGGAGAAGCCGGAGGTGGAGAA
CGACAAGGAAGACCTCCTCAAGGAGAAGACAGACGACACCTCAGGGGAGGACAACGACGAGAAGGAGGCTGTGGCCTCCAAAGGCCGCAA
AACTGCCAACAGCCAGGGAAGACGCAAAGGCCGCATCACCCGCTCAATGGCTAATGAGGCCAACAGCGAGGAGGCCATCACCCCCCAGCA
GAGCGCCGAGCTGGCCTCCATGGAGCTGAATGAGAGTTCTCGCTGGACAGAAGAAGAAATGGAAACAGCCAAGAAAGGGTCCTGAGGACA
CCGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGCCCCCCAGCCCCTACACCCCGCTTCTCCCGGACTCTCCCAGCGGACAGCCCC
CCAGCCCCACAGCCTGAGCCTCCCAGCTGCCATGTGCCTGTTGCACACCTGCACACACGCCCTGGCACACATACACACATGCGTGCAGGC
TTGTGCAGACACTCAGGGATGGAGCTGCTGCTGAAGGGACTTGTAGGGAGAGGCTCGTCAACAAGCACTGTTCTGGAACCTTCTCTCCAC
GTGGCCCACAGGCCTGACCACAGGGGCTGTGGGTCCTGCGTCCCCTTCCTCGGGTGAGCCTGGCCTGTCCCGTTCAGCCGTTGGGCCCAG
GCTTCCTCCCCTCCAAGGTGAAACACTGCAGTCCCGGTGTGGTGGCTCCCCATGCAGGACGGGCCAGGCTGGGAGTGCCGCCTTCCTGTG
CCAAATTCAGTGGGGACTCAGTGCCCAGGCCCTGGCCACGAGCTTTGGCCTTGGTCTACCTGCCAGGCCAGGCAAAGCGCCTTTACACAG
GCCTCGGAAAACAATGGAGTGAGCACAAGATGCCCTGTGCAGCTGCCCGAGGGTCTCCGCCCACCCCGGCCGGACTTTGATCCCCCCGAA
GTCTTCACAGGCACTGCATCGGGTTGTCTGGCGCCCTTTTCCTCCAGCCTAAACTGACATCATCCTATGGACTGAGCCGGCCACTCTCTG
GCCGAAGTGGCCGCAGGCTGTGCCCCCGAGCTGCCCCCACCCCCTCACAGGGTCCCTCAGATTATAGGTGCCCAGGCTGAGGTGAAGAGG
CCTGGGGGCCCTGCCTTCCGGGCGCTCCTGGACCCTGGGGCAAACCTGTGACCCTTTTCTACTGGAATAGAAATGAGTTTTATCATCTTT

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000339570_chr12_125302253_-_4489nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGC
TGCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACAT
CAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCA
GCGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCG
CGAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGG
GCTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCG
CCAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCAT
GAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAA
CTTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAA
GAGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGA
GATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGA
GCGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCAC
CTTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGAT
GGAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGA
GATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATT
TGCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAA
CGGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCC
TGAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCAC
CTATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAAT
TCAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGT
GACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACT
GCAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGA
GAGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCT
CCTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGGTCCTGAGGACACCGTGAGCCAGCCAGGCCT
GGCCGCTGGGCCTGACCGGCCCCCCAGCCCCTACACCCCGCTTCTCCCGGACTCTCCCAGCGGACAGCCCCCCAGCCCCACAGCCTGAGC
CTCCCAGCTGCCATGTGCCTGTTGCACACCTGCACACACGCCCTGGCACACATACACACATGCGTGCAGGCTTGTGCAGACACTCAGGGA
TGGAGCTGCTGCTGAAGGGACTTGTAGGGAGAGGCTCGTCAACAAGCACTGTTCTGGAACCTTCTCTCCACGTGGCCCACAGGCCTGACC
ACAGGGGCTGTGGGTCCTGCGTCCCCTTCCTCGGGTGAGCCTGGCCTGTCCCGTTCAGCCGTTGGGCCCAGGCTTCCTCCCCTCCAAGGT
GAAACACTGCAGTCCCGGTGTGGTGGCTCCCCATGCAGGACGGGCCAGGCTGGGAGTGCCGCCTTCCTGTGCCAAATTCAGTGGGGACTC
AGTGCCCAGGCCCTGGCCACGAGCTTTGGCCTTGGTCTACCTGCCAGGCCAGGCAAAGCGCCTTTACACAGGCCTCGGAAAACAATGGAG
TGAGCACAAGATGCCCTGTGCAGCTGCCCGAGGGTCTCCGCCCACCCCGGCCGGACTTTGATCCCCCCGAAGTCTTCACAGGCACTGCAT
CGGGTTGTCTGGCGCCCTTTTCCTCCAGCCTAAACTGACATCATCCTATGGACTGAGCCGGCCACTCTCTGGCCGAAGTGGCCGCAGGCT
GTGCCCCCGAGCTGCCCCCACCCCCTCACAGGGTCCCTCAGATTATAGGTGCCCAGGCTGAGGTGAAGAGGCCTGGGGGCCCTGCCTTCC
GGGCGCTCCTGGACCCTGGGGCAAACCTGTGACCCTTTTCTACTGGAATAGAAATGAGTTTTATCATCTTTGAAAAATAATTCACTCTTG
AAGTAATAAACGTTTAAAAAAATGGGATGCCTGCCTCTGTGACAGCCTTGTTTGCTGAGGTCGTGGGGGTGGGGGCCTCTGGGAAGTTCC
GGGCTCCTCTTCTCTTGGTCAATAGCTCCTTTCTGGTGGCTGCCAAGAGCGTCTCTCCCAGGGCCGGGCTGCTGGCTTACCTTCCTGTTG
TTTTCAAATTTCAACCTTGTGCAATGTTGAGTTTCATAGAAATACTGCATGAGTACGCCCTTGTTTAGAAGCAGCAGGGTCTGAGTCCCA
TCCCACAGCCCCCAGTGCAGACGCTTTTGCCACTTTTGCATGGGGCCCCCTGGATGTGTTTCTGTGCATTTATCTACAAATCCTGGTGCC
CATAGGACATGCCCCGTGTTGTTCTAGGCCTTTGCTTTCTGCTCGTTACATAAATGGTGAAGAAGAGAAGCGGGTAAGAGAACAGATTGG
AGCCATCTAAAAGTTCTCATCTTAAGTGTAGATCATTGCAAAGGATGGAATTTTCTCCGATTGTCATCATCGTTGATGTTTGAATATGAG
ACCATTTCATCAGTATTTAAGTGTGCCCGCTGGGATCTAACTAGGAGAGGAGAGGGTATTCACTGCCGAACATTTCAAAGAATATACGAA
CAAGCTCTTTTATGGTCAGAAATGTTAGCCCTTTTCCCCTTAAACTTGTATTTCCTTTCTTCTTCCCTCCTAAAATTTTATCTAAATGAT

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000415380_chr12_125302253_-_3962nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGC
TGCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACAT
CAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCA
GCGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCG
CGAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGG
GCTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCG
CCAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCAT
GAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAA
CTTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAA
GAGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGA
GATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGA
GCGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCAC
CTTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGAT
GGAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGA
GATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATT
TGCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAA
CGGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCC
TGAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCAC
CTATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAAT
TCAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGT
GACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACT
GCAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGA
GAGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCT
CCTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGTAGGTGCTGGCCAGAGGGCAGCCCGGGCTGA
CAGCCATTCGCTTGCCTGCTGGGGGAAAGGGGCCTCAGATCGGACCCTCTGGCCAACCGCAGCCTGGAGCCCACCTCCAGCAGCAGTCCT
GCGTCTCTGCCGGAGTGGGAGCGGTCACTGCTGGGGGCTGCGCAGCACGCTTGCGTCTTTTGCATGCCGCGTTGCCACTACTCTGCCTGT
TCTGGAAGGCCTGGGACCCTCCCTTGGAGGGGGCACAGGGTCCTGAGGACACCGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGC
CCCCCAGCCCCTACACCCCGCTTCTCCCGGACTCTCCCAGCGGACAGCCCCCCAGCCCCACAGCCTGAGCCTCCCAGCTGCCATGTGCCT
GTTGCACACCTGCACACACGCCCTGGCACACATACACACATGCGTGCAGGCTTGTGCAGACACTCAGGGATGGAGCTGCTGCTGAAGGGA
CTTGTAGGGAGAGGCTCGTCAACAAGCACTGTTCTGGAACCTTCTCTCCACGTGGCCCACAGGCCTGACCACAGGGGCTGTGGGTCCTGC
GTCCCCTTCCTCGGGTGAGCCTGGCCTGTCCCGTTCAGCCGTTGGGCCCAGGCTTCCTCCCCTCCAAGGTGAAACACTGCAGTCCCGGTG
TGGTGGCTCCCCATGCAGGACGGGCCAGGCTGGGAGTGCCGCCTTCCTGTGCCAAATTCAGTGGGGACTCAGTGCCCAGGCCCTGGCCAC
GAGCTTTGGCCTTGGTCTACCTGCCAGGCCAGGCAAAGCGCCTTTACACAGGCCTCGGAAAACAATGGAGTGAGCACAAGATGCCCTGTG
CAGCTGCCCGAGGGTCTCCGCCCACCCCGGCCGGACTTTGATCCCCCCGAAGTCTTCACAGGCACTGCATCGGGTTGTCTGGCGCCCTTT
TCCTCCAGCCTAAACTGACATCATCCTATGGACTGAGCCGGCCACTCTCTGGCCGAAGTGGCCGCAGGCTGTGCCCCCGAGCTGCCCCCA
CCCCCTCACAGGGTCCCTCAGATTATAGGTGCCCAGGCTGAGGTGAAGAGGCCTGGGGGCCCTGCCTTCCGGGCGCTCCTGGACCCTGGG
GCAAACCTGTGACCCTTTTCTACTGGAATAGAAATGAGTTTTATCATCTTTGAAAAATAATTCACTCTTGAAGTAATAAACGTTTAAAAA

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000261693_chr12_125302253_-_3841nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGC
TGCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACAT
CAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCA
GCGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCG
CGAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGG
GCTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCG
CCAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCAT
GAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAA
CTTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAA
GAGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGA
GATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGA
GCGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCAC
CTTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGAT
GGAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGA
GATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATT
TGCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAA
CGGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCC
TGAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCAC
CTATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAAT
TCAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGT
GACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACT
GCAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGA
GAGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCT
CCTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGAGAAATGCTATTTATTTTGGAGTAGTAGTAA
AAAGGGCTCAAAGGATAAGGAGGCCATTCAGGCCTATTCTGAATCCCTGATGACATCAGCTCCCAAGGGCTCTGTGCTGCAGGAAGCAAA
ACTGTAGGGTCCTGAGGACACCGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGCCCCCCAGCCCCTACACCCCGCTTCTCCCGGA
CTCTCCCAGCGGACAGCCCCCCAGCCCCACAGCCTGAGCCTCCCAGCTGCCATGTGCCTGTTGCACACCTGCACACACGCCCTGGCACAC
ATACACACATGCGTGCAGGCTTGTGCAGACACTCAGGGATGGAGCTGCTGCTGAAGGGACTTGTAGGGAGAGGCTCGTCAACAAGCACTG
TTCTGGAACCTTCTCTCCACGTGGCCCACAGGCCTGACCACAGGGGCTGTGGGTCCTGCGTCCCCTTCCTCGGGTGAGCCTGGCCTGTCC
CGTTCAGCCGTTGGGCCCAGGCTTCCTCCCCTCCAAGGTGAAACACTGCAGTCCCGGTGTGGTGGCTCCCCATGCAGGACGGGCCAGGCT
GGGAGTGCCGCCTTCCTGTGCCAAATTCAGTGGGGACTCAGTGCCCAGGCCCTGGCCACGAGCTTTGGCCTTGGTCTACCTGCCAGGCCA
GGCAAAGCGCCTTTACACAGGCCTCGGAAAACAATGGAGTGAGCACAAGATGCCCTGTGCAGCTGCCCGAGGGTCTCCGCCCACCCCGGC
CGGACTTTGATCCCCCCGAAGTCTTCACAGGCACTGCATCGGGTTGTCTGGCGCCCTTTTCCTCCAGCCTAAACTGACATCATCCTATGG
ACTGAGCCGGCCACTCTCTGGCCGAAGTGGCCGCAGGCTGTGCCCCCGAGCTGCCCCCACCCCCTCACAGGGTCCCTCAGATTATAGGTG
CCCAGGCTGAGGTGAAGAGGCCTGGGGGCCCTGCCTTCCGGGCGCTCCTGGACCCTGGGGCAAACCTGTGACCCTTTTCTACTGGAATAG

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000339570_chr12_125302253_-_4489nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGC
TGCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACAT
CAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCA
GCGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCG
CGAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGG
GCTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCG
CCAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCAT
GAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAA
CTTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAA
GAGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGA
GATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGA
GCGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCAC
CTTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGAT
GGAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGA
GATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATT
TGCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAA
CGGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCC
TGAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCAC
CTATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAAT
TCAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGT
GACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACT
GCAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGA
GAGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCT
CCTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGGTCCTGAGGACACCGTGAGCCAGCCAGGCCT
GGCCGCTGGGCCTGACCGGCCCCCCAGCCCCTACACCCCGCTTCTCCCGGACTCTCCCAGCGGACAGCCCCCCAGCCCCACAGCCTGAGC
CTCCCAGCTGCCATGTGCCTGTTGCACACCTGCACACACGCCCTGGCACACATACACACATGCGTGCAGGCTTGTGCAGACACTCAGGGA
TGGAGCTGCTGCTGAAGGGACTTGTAGGGAGAGGCTCGTCAACAAGCACTGTTCTGGAACCTTCTCTCCACGTGGCCCACAGGCCTGACC
ACAGGGGCTGTGGGTCCTGCGTCCCCTTCCTCGGGTGAGCCTGGCCTGTCCCGTTCAGCCGTTGGGCCCAGGCTTCCTCCCCTCCAAGGT
GAAACACTGCAGTCCCGGTGTGGTGGCTCCCCATGCAGGACGGGCCAGGCTGGGAGTGCCGCCTTCCTGTGCCAAATTCAGTGGGGACTC
AGTGCCCAGGCCCTGGCCACGAGCTTTGGCCTTGGTCTACCTGCCAGGCCAGGCAAAGCGCCTTTACACAGGCCTCGGAAAACAATGGAG
TGAGCACAAGATGCCCTGTGCAGCTGCCCGAGGGTCTCCGCCCACCCCGGCCGGACTTTGATCCCCCCGAAGTCTTCACAGGCACTGCAT
CGGGTTGTCTGGCGCCCTTTTCCTCCAGCCTAAACTGACATCATCCTATGGACTGAGCCGGCCACTCTCTGGCCGAAGTGGCCGCAGGCT
GTGCCCCCGAGCTGCCCCCACCCCCTCACAGGGTCCCTCAGATTATAGGTGCCCAGGCTGAGGTGAAGAGGCCTGGGGGCCCTGCCTTCC
GGGCGCTCCTGGACCCTGGGGCAAACCTGTGACCCTTTTCTACTGGAATAGAAATGAGTTTTATCATCTTTGAAAAATAATTCACTCTTG
AAGTAATAAACGTTTAAAAAAATGGGATGCCTGCCTCTGTGACAGCCTTGTTTGCTGAGGTCGTGGGGGTGGGGGCCTCTGGGAAGTTCC
GGGCTCCTCTTCTCTTGGTCAATAGCTCCTTTCTGGTGGCTGCCAAGAGCGTCTCTCCCAGGGCCGGGCTGCTGGCTTACCTTCCTGTTG
TTTTCAAATTTCAACCTTGTGCAATGTTGAGTTTCATAGAAATACTGCATGAGTACGCCCTTGTTTAGAAGCAGCAGGGTCTGAGTCCCA
TCCCACAGCCCCCAGTGCAGACGCTTTTGCCACTTTTGCATGGGGCCCCCTGGATGTGTTTCTGTGCATTTATCTACAAATCCTGGTGCC
CATAGGACATGCCCCGTGTTGTTCTAGGCCTTTGCTTTCTGCTCGTTACATAAATGGTGAAGAAGAGAAGCGGGTAAGAGAACAGATTGG
AGCCATCTAAAAGTTCTCATCTTAAGTGTAGATCATTGCAAAGGATGGAATTTTCTCCGATTGTCATCATCGTTGATGTTTGAATATGAG
ACCATTTCATCAGTATTTAAGTGTGCCCGCTGGGATCTAACTAGGAGAGGAGAGGGTATTCACTGCCGAACATTTCAAAGAATATACGAA
CAAGCTCTTTTATGGTCAGAAATGTTAGCCCTTTTCCCCTTAAACTTGTATTTCCTTTCTTCTTCCCTCCTAAAATTTTATCTAAATGAT

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000415380_chr12_125302253_-_3962nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGC
TGCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACAT
CAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCA
GCGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCG
CGAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGG
GCTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCG
CCAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCAT
GAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAA
CTTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAA
GAGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGA
GATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGA
GCGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCAC
CTTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGAT
GGAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGA
GATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATT
TGCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAA
CGGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCC
TGAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCAC
CTATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAAT
TCAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGT
GACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACT
GCAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGA
GAGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCT
CCTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGTAGGTGCTGGCCAGAGGGCAGCCCGGGCTGA
CAGCCATTCGCTTGCCTGCTGGGGGAAAGGGGCCTCAGATCGGACCCTCTGGCCAACCGCAGCCTGGAGCCCACCTCCAGCAGCAGTCCT
GCGTCTCTGCCGGAGTGGGAGCGGTCACTGCTGGGGGCTGCGCAGCACGCTTGCGTCTTTTGCATGCCGCGTTGCCACTACTCTGCCTGT
TCTGGAAGGCCTGGGACCCTCCCTTGGAGGGGGCACAGGGTCCTGAGGACACCGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGC
CCCCCAGCCCCTACACCCCGCTTCTCCCGGACTCTCCCAGCGGACAGCCCCCCAGCCCCACAGCCTGAGCCTCCCAGCTGCCATGTGCCT
GTTGCACACCTGCACACACGCCCTGGCACACATACACACATGCGTGCAGGCTTGTGCAGACACTCAGGGATGGAGCTGCTGCTGAAGGGA
CTTGTAGGGAGAGGCTCGTCAACAAGCACTGTTCTGGAACCTTCTCTCCACGTGGCCCACAGGCCTGACCACAGGGGCTGTGGGTCCTGC
GTCCCCTTCCTCGGGTGAGCCTGGCCTGTCCCGTTCAGCCGTTGGGCCCAGGCTTCCTCCCCTCCAAGGTGAAACACTGCAGTCCCGGTG
TGGTGGCTCCCCATGCAGGACGGGCCAGGCTGGGAGTGCCGCCTTCCTGTGCCAAATTCAGTGGGGACTCAGTGCCCAGGCCCTGGCCAC
GAGCTTTGGCCTTGGTCTACCTGCCAGGCCAGGCAAAGCGCCTTTACACAGGCCTCGGAAAACAATGGAGTGAGCACAAGATGCCCTGTG
CAGCTGCCCGAGGGTCTCCGCCCACCCCGGCCGGACTTTGATCCCCCCGAAGTCTTCACAGGCACTGCATCGGGTTGTCTGGCGCCCTTT
TCCTCCAGCCTAAACTGACATCATCCTATGGACTGAGCCGGCCACTCTCTGGCCGAAGTGGCCGCAGGCTGTGCCCCCGAGCTGCCCCCA
CCCCCTCACAGGGTCCCTCAGATTATAGGTGCCCAGGCTGAGGTGAAGAGGCCTGGGGGCCCTGCCTTCCGGGCGCTCCTGGACCCTGGG
GCAAACCTGTGACCCTTTTCTACTGGAATAGAAATGAGTTTTATCATCTTTGAAAAATAATTCACTCTTGAAGTAATAAACGTTTAAAAA

>In-frame_NCOR2_ENST00000405201_chr12_124904503_-_SCARB1_ENST00000261693_chr12_125302253_-_3841nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGC
TGCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACAT
CAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCA
GCGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCG
CGAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGG
GCTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCG
CCAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCAT
GAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAA
CTTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAA
GAGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGA
GATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGA
GCGCGGGCCCTACGTGTACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCAC
CTTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGAT
GGAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGA
GATCATGTGGGGCTACAAGGACCCCCTTGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATT
TGCTGAGCTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAA
CGGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCC
TGAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCAC
CTATCGCTTCGTGGCTCCCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAAT
TCAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGT
GACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACT
GCAGCTGAGCCTCTACATGAAATCTGTCGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGA
GAGCGGGGCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCT
CCTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCAAGAGAAATGCTATTTATTTTGGAGTAGTAGTAA
AAAGGGCTCAAAGGATAAGGAGGCCATTCAGGCCTATTCTGAATCCCTGATGACATCAGCTCCCAAGGGCTCTGTGCTGCAGGAAGCAAA
ACTGTAGGGTCCTGAGGACACCGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGCCCCCCAGCCCCTACACCCCGCTTCTCCCGGA
CTCTCCCAGCGGACAGCCCCCCAGCCCCACAGCCTGAGCCTCCCAGCTGCCATGTGCCTGTTGCACACCTGCACACACGCCCTGGCACAC
ATACACACATGCGTGCAGGCTTGTGCAGACACTCAGGGATGGAGCTGCTGCTGAAGGGACTTGTAGGGAGAGGCTCGTCAACAAGCACTG
TTCTGGAACCTTCTCTCCACGTGGCCCACAGGCCTGACCACAGGGGCTGTGGGTCCTGCGTCCCCTTCCTCGGGTGAGCCTGGCCTGTCC
CGTTCAGCCGTTGGGCCCAGGCTTCCTCCCCTCCAAGGTGAAACACTGCAGTCCCGGTGTGGTGGCTCCCCATGCAGGACGGGCCAGGCT
GGGAGTGCCGCCTTCCTGTGCCAAATTCAGTGGGGACTCAGTGCCCAGGCCCTGGCCACGAGCTTTGGCCTTGGTCTACCTGCCAGGCCA
GGCAAAGCGCCTTTACACAGGCCTCGGAAAACAATGGAGTGAGCACAAGATGCCCTGTGCAGCTGCCCGAGGGTCTCCGCCCACCCCGGC
CGGACTTTGATCCCCCCGAAGTCTTCACAGGCACTGCATCGGGTTGTCTGGCGCCCTTTTCCTCCAGCCTAAACTGACATCATCCTATGG
ACTGAGCCGGCCACTCTCTGGCCGAAGTGGCCGCAGGCTGTGCCCCCGAGCTGCCCCCACCCCCTCACAGGGTCCCTCAGATTATAGGTG
CCCAGGCTGAGGTGAAGAGGCCTGGGGGCCCTGCCTTCCGGGCGCTCCTGGACCCTGGGGCAAACCTGTGACCCTTTTCTACTGGAATAG

>In-frame_NCOR2_ENST00000405201_chr12_124979693_-_SCARB1_ENST00000339570_chr12_125302253_-_3112nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAGATCCCTATCCCCTTCTATCTCTCCGT
CTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAGCGCGGGCCCTACGTGTACAGGGAGTT
CAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCACCTTCCAGTTCCAGCCCTCCAAGTCCCA
CGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGATGGAGAATAAGCCCATGACCCTGAAGCT
CATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAGATCATGTGGGGCTACAAGGACCCCCT
TGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTTGCTGAGCTCAACAACTCCGACTCTGG
GCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAACGGGCTGAGCAAGGTTGACTTCTGGCA
TTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCCTGAGTCCTCGCTGGAGTTCTACAGCCC
GGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACCTATCGCTTCGTGGCTCCCAAAACCCT
GTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAATTCAGAACGTCAGCACCTGCAGGTTCAG
TGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGTGACTGGCCTGCACCCTAACCAGGAGGC
ACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTGCAGCTGAGCCTCTACATGAAATCTGT
CGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAGAGCGGGGCCATGGAGGGGGAGACTCT
TCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCTCCTGGCGCTGGGCTGCGTCCTGCTGCT
GGTCCCTGTCATCTGCCAAATCCGGAGCCAAGGTCCTGAGGACACCGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGCCCCCCAG
CCCCTACACCCCGCTTCTCCCGGACTCTCCCAGCGGACAGCCCCCCAGCCCCACAGCCTGAGCCTCCCAGCTGCCATGTGCCTGTTGCAC
ACCTGCACACACGCCCTGGCACACATACACACATGCGTGCAGGCTTGTGCAGACACTCAGGGATGGAGCTGCTGCTGAAGGGACTTGTAG
GGAGAGGCTCGTCAACAAGCACTGTTCTGGAACCTTCTCTCCACGTGGCCCACAGGCCTGACCACAGGGGCTGTGGGTCCTGCGTCCCCT
TCCTCGGGTGAGCCTGGCCTGTCCCGTTCAGCCGTTGGGCCCAGGCTTCCTCCCCTCCAAGGTGAAACACTGCAGTCCCGGTGTGGTGGC
TCCCCATGCAGGACGGGCCAGGCTGGGAGTGCCGCCTTCCTGTGCCAAATTCAGTGGGGACTCAGTGCCCAGGCCCTGGCCACGAGCTTT
GGCCTTGGTCTACCTGCCAGGCCAGGCAAAGCGCCTTTACACAGGCCTCGGAAAACAATGGAGTGAGCACAAGATGCCCTGTGCAGCTGC
CCGAGGGTCTCCGCCCACCCCGGCCGGACTTTGATCCCCCCGAAGTCTTCACAGGCACTGCATCGGGTTGTCTGGCGCCCTTTTCCTCCA
GCCTAAACTGACATCATCCTATGGACTGAGCCGGCCACTCTCTGGCCGAAGTGGCCGCAGGCTGTGCCCCCGAGCTGCCCCCACCCCCTC
ACAGGGTCCCTCAGATTATAGGTGCCCAGGCTGAGGTGAAGAGGCCTGGGGGCCCTGCCTTCCGGGCGCTCCTGGACCCTGGGGCAAACC
TGTGACCCTTTTCTACTGGAATAGAAATGAGTTTTATCATCTTTGAAAAATAATTCACTCTTGAAGTAATAAACGTTTAAAAAAATGGGA
TGCCTGCCTCTGTGACAGCCTTGTTTGCTGAGGTCGTGGGGGTGGGGGCCTCTGGGAAGTTCCGGGCTCCTCTTCTCTTGGTCAATAGCT
CCTTTCTGGTGGCTGCCAAGAGCGTCTCTCCCAGGGCCGGGCTGCTGGCTTACCTTCCTGTTGTTTTCAAATTTCAACCTTGTGCAATGT
TGAGTTTCATAGAAATACTGCATGAGTACGCCCTTGTTTAGAAGCAGCAGGGTCTGAGTCCCATCCCACAGCCCCCAGTGCAGACGCTTT
TGCCACTTTTGCATGGGGCCCCCTGGATGTGTTTCTGTGCATTTATCTACAAATCCTGGTGCCCATAGGACATGCCCCGTGTTGTTCTAG
GCCTTTGCTTTCTGCTCGTTACATAAATGGTGAAGAAGAGAAGCGGGTAAGAGAACAGATTGGAGCCATCTAAAAGTTCTCATCTTAAGT
GTAGATCATTGCAAAGGATGGAATTTTCTCCGATTGTCATCATCGTTGATGTTTGAATATGAGACCATTTCATCAGTATTTAAGTGTGCC
CGCTGGGATCTAACTAGGAGAGGAGAGGGTATTCACTGCCGAACATTTCAAAGAATATACGAACAAGCTCTTTTATGGTCAGAAATGTTA
GCCCTTTTCCCCTTAAACTTGTATTTCCTTTCTTCTTCCCTCCTAAAATTTTATCTAAATGATATTTATATTTGATGCTTTTAAGCCTTT

>In-frame_NCOR2_ENST00000405201_chr12_124979693_-_SCARB1_ENST00000415380_chr12_125302253_-_2585nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAGATCCCTATCCCCTTCTATCTCTCCGT
CTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAGCGCGGGCCCTACGTGTACAGGGAGTT
CAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCACCTTCCAGTTCCAGCCCTCCAAGTCCCA
CGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGATGGAGAATAAGCCCATGACCCTGAAGCT
CATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAGATCATGTGGGGCTACAAGGACCCCCT
TGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTTGCTGAGCTCAACAACTCCGACTCTGG
GCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAACGGGCTGAGCAAGGTTGACTTCTGGCA
TTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCCTGAGTCCTCGCTGGAGTTCTACAGCCC
GGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACCTATCGCTTCGTGGCTCCCAAAACCCT
GTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAATTCAGAACGTCAGCACCTGCAGGTTCAG
TGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGTGACTGGCCTGCACCCTAACCAGGAGGC
ACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTGCAGCTGAGCCTCTACATGAAATCTGT
CGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAGAGCGGGGCCATGGAGGGGGAGACTCT
TCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCTCCTGGCGCTGGGCTGCGTCCTGCTGCT
GGTCCCTGTCATCTGCCAAATCCGGAGCCAAGTAGGTGCTGGCCAGAGGGCAGCCCGGGCTGACAGCCATTCGCTTGCCTGCTGGGGGAA
AGGGGCCTCAGATCGGACCCTCTGGCCAACCGCAGCCTGGAGCCCACCTCCAGCAGCAGTCCTGCGTCTCTGCCGGAGTGGGAGCGGTCA
CTGCTGGGGGCTGCGCAGCACGCTTGCGTCTTTTGCATGCCGCGTTGCCACTACTCTGCCTGTTCTGGAAGGCCTGGGACCCTCCCTTGG
AGGGGGCACAGGGTCCTGAGGACACCGTGAGCCAGCCAGGCCTGGCCGCTGGGCCTGACCGGCCCCCCAGCCCCTACACCCCGCTTCTCC
CGGACTCTCCCAGCGGACAGCCCCCCAGCCCCACAGCCTGAGCCTCCCAGCTGCCATGTGCCTGTTGCACACCTGCACACACGCCCTGGC
ACACATACACACATGCGTGCAGGCTTGTGCAGACACTCAGGGATGGAGCTGCTGCTGAAGGGACTTGTAGGGAGAGGCTCGTCAACAAGC
ACTGTTCTGGAACCTTCTCTCCACGTGGCCCACAGGCCTGACCACAGGGGCTGTGGGTCCTGCGTCCCCTTCCTCGGGTGAGCCTGGCCT
GTCCCGTTCAGCCGTTGGGCCCAGGCTTCCTCCCCTCCAAGGTGAAACACTGCAGTCCCGGTGTGGTGGCTCCCCATGCAGGACGGGCCA
GGCTGGGAGTGCCGCCTTCCTGTGCCAAATTCAGTGGGGACTCAGTGCCCAGGCCCTGGCCACGAGCTTTGGCCTTGGTCTACCTGCCAG
GCCAGGCAAAGCGCCTTTACACAGGCCTCGGAAAACAATGGAGTGAGCACAAGATGCCCTGTGCAGCTGCCCGAGGGTCTCCGCCCACCC
CGGCCGGACTTTGATCCCCCCGAAGTCTTCACAGGCACTGCATCGGGTTGTCTGGCGCCCTTTTCCTCCAGCCTAAACTGACATCATCCT
ATGGACTGAGCCGGCCACTCTCTGGCCGAAGTGGCCGCAGGCTGTGCCCCCGAGCTGCCCCCACCCCCTCACAGGGTCCCTCAGATTATA
GGTGCCCAGGCTGAGGTGAAGAGGCCTGGGGGCCCTGCCTTCCGGGCGCTCCTGGACCCTGGGGCAAACCTGTGACCCTTTTCTACTGGA

>In-frame_NCOR2_ENST00000405201_chr12_124979693_-_SCARB1_ENST00000261693_chr12_125302253_-_2464nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGAACGTGCGCATCGACCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAGATCCCTATCCCCTTCTATCTCTCCGT
CTACTTCTTTGACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAGCGCGGGCCCTACGTGTACAGGGAGTT
CAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCGCACCTTCCAGTTCCAGCCCTCCAAGTCCCA
CGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTGGTCTTGGGTGCGGCGGTGATGATGGAGAATAAGCCCATGACCCTGAAGCT
CATCATGACCTTGGCATTCACCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAGATCATGTGGGGCTACAAGGACCCCCT
TGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTTGCTGAGCTCAACAACTCCGACTCTGG
GCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCGTGGACAAGTGGAACGGGCTGAGCAAGGTTGACTTCTGGCA
TTCCGATCAGTGCAACATGATCAATGGAACTTCTGGGCAAATGTGGCCGCCCTTCATGACTCCTGAGTCCTCGCTGGAGTTCTACAGCCC
GGAGGCCTGCCGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACCTATCGCTTCGTGGCTCCCAAAACCCT
GTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGGAATTCAGAACGTCAGCACCTGCAGGTTCAG
TGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCTGACCCGGTTCTGGCAGAAGCGGTGACTGGCCTGCACCCTAACCAGGAGGC
ACACTCCTTGTTCCTGGACATCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTGCAGCTGAGCCTCTACATGAAATCTGT
CGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAGAGCGGGGCCATGGAGGGGGAGACTCT
TCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATGCCCAGTACGTCCTCCTGGCGCTGGGCTGCGTCCTGCTGCT
GGTCCCTGTCATCTGCCAAATCCGGAGCCAAGAGAAATGCTATTTATTTTGGAGTAGTAGTAAAAAGGGCTCAAAGGATAAGGAGGCCAT
TCAGGCCTATTCTGAATCCCTGATGACATCAGCTCCCAAGGGCTCTGTGCTGCAGGAAGCAAAACTGTAGGGTCCTGAGGACACCGTGAG
CCAGCCAGGCCTGGCCGCTGGGCCTGACCGGCCCCCCAGCCCCTACACCCCGCTTCTCCCGGACTCTCCCAGCGGACAGCCCCCCAGCCC
CACAGCCTGAGCCTCCCAGCTGCCATGTGCCTGTTGCACACCTGCACACACGCCCTGGCACACATACACACATGCGTGCAGGCTTGTGCA
GACACTCAGGGATGGAGCTGCTGCTGAAGGGACTTGTAGGGAGAGGCTCGTCAACAAGCACTGTTCTGGAACCTTCTCTCCACGTGGCCC
ACAGGCCTGACCACAGGGGCTGTGGGTCCTGCGTCCCCTTCCTCGGGTGAGCCTGGCCTGTCCCGTTCAGCCGTTGGGCCCAGGCTTCCT
CCCCTCCAAGGTGAAACACTGCAGTCCCGGTGTGGTGGCTCCCCATGCAGGACGGGCCAGGCTGGGAGTGCCGCCTTCCTGTGCCAAATT
CAGTGGGGACTCAGTGCCCAGGCCCTGGCCACGAGCTTTGGCCTTGGTCTACCTGCCAGGCCAGGCAAAGCGCCTTTACACAGGCCTCGG
AAAACAATGGAGTGAGCACAAGATGCCCTGTGCAGCTGCCCGAGGGTCTCCGCCCACCCCGGCCGGACTTTGATCCCCCCGAAGTCTTCA
CAGGCACTGCATCGGGTTGTCTGGCGCCCTTTTCCTCCAGCCTAAACTGACATCATCCTATGGACTGAGCCGGCCACTCTCTGGCCGAAG
TGGCCGCAGGCTGTGCCCCCGAGCTGCCCCCACCCCCTCACAGGGTCCCTCAGATTATAGGTGCCCAGGCTGAGGTGAAGAGGCCTGGGG
GCCCTGCCTTCCGGGCGCTCCTGGACCCTGGGGCAAACCTGTGACCCTTTTCTACTGGAATAGAAATGAGTTTTATCATCTTTGAAAAAT


Top

FusionGenePPI for NCOR2_SCARB1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NCOR2SPEN, ZBTB16, AR, IKZF1, RUNX1T1, HDAC3, TBL1X, RELA, NFKBIA, HDAC4, HDAC7, SNW1, HDAC1, HDAC10, PML, PPARD, BCL6, NCOR1, SMARCA4, SIN3A, HDAC2, SAP30, HDAC5, RBPJ, POU2F1, RARA, INPP5K, CIR1, JUN, FOS, SRF, NR3C1, PPARA, THRB, VDR, NR4A1, PGR, RXRA, NCOA6, ZBTB7A, NR4A2, EP300, CREBBP, CNOT2, AKT1, CHUK, HIST1H4A, NR1I2, HNF4A, ATXN1, ATXN1L, SF1, SP1, CEBPB, NFE2L2, PPARG, FOXP1, NFKBIB, NFKBIE, NFKB1, SKIL, THRA, ESR1, ESR2, BACH2, NCOA3, GPS2, SUMO1, UBE2I, IRF5, CDKN1A, RARB, RARG, AP2M1, RANBP9, RXRG, NR1H2, TNIP2, CEP63, TNIK, SOX2, E2F4, NRD1, CTBP1, ARNT, AHR, NR1D1, NR1H4, C1D, RUNX1, CBX6, BTRC, E2F1, BCOR, AURKA, HMGA1, KLF5, HSPA5, SEC16A, FBXO22, RGMA, FOXK2, NANOG, POU5F1, ITGAV, EYA2, TBL1Y, ZSCAN5A, LASP1, USP44, TRIM25SCARB1PDZK1, APOA1, APOA2, CUL1, CAND1, FBXO6, KRTAP5-9, KRTAP10-9, HLA-DRA, HLA-DPA1, ATP1B3, HLA-C, BTNL8, PTPRK, NAAA, PON2, TMEM17, TMEM216, CDH1, TMEM30B, CLDN7, SFTPC, DEFA1, SCGB1D4, BTNL3, NCEH1, TMPRSS11B, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneNCOR2chr12:124882665chr12:125263132ENST00000356219-1748254_3126252522SIN3A/B
HgeneNCOR2chr12:124904503chr12:125302253ENST00000356219-1448254_3124942522SIN3A/B


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneNCOR2chr12:124979693chr12:125302253ENST00000356219-248254_312352522SIN3A/B


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NCOR2_SCARB1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NCOR2_SCARB1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNCOR2C0005586Bipolar Disorder1PSYGENET
HgeneNCOR2C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneSCARB1C0007134Renal Cell Carcinoma1CTD_human
TgeneSCARB1C0016427Follicular cyst1CTD_human
TgeneSCARB1C0019196Hepatitis C1CTD_human
TgeneSCARB1C0022661Kidney Failure, Chronic1CTD_human
TgeneSCARB1C0024667Animal Mammary Neoplasms1CTD_human
TgeneSCARB1C0024668Mammary Neoplasms, Experimental1CTD_human
TgeneSCARB1C0024809Marijuana Abuse1CTD_human
TgeneSCARB1C0031391Phencyclidine Abuse1CTD_human
TgeneSCARB1C0236736Cocaine-Related Disorders1CTD_human
TgeneSCARB1C0400966Non-alcoholic Fatty Liver Disease1CTD_human