FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23733

FusionGeneSummary for NCOR2_FMR1NB

check button Fusion gene summary
Fusion gene informationFusion gene name: NCOR2_FMR1NB
Fusion gene ID: 23733
HgeneTgene
Gene symbol

NCOR2

FMR1NB

Gene ID

9612

158521

Gene namenuclear receptor corepressor 2FMR1 neighbor
SynonymsCTG26|N-CoR2|SMAP270|SMRT|SMRTE|SMRTE-tau|TNRC14|TRAC|TRAC-1|TRAC1CT37|NY-SAR-35|NYSAR35
Cytomap

12q24.31

Xq27.3-q28

Type of geneprotein-codingprotein-coding
Descriptionnuclear receptor corepressor 2CTG repeat protein 26T3 receptor-associating factorsilencing mediator for retinoid and thyroid hormone receptorsthyroid-, retinoic-acid-receptor-associated corepressorfragile X mental retardation 1 neighbor proteincancer/testis antigen 37sarcoma antigen NY-SAR-35
Modification date2018052720180519
UniProtAcc

Q9Y618

Q8N0W7

Ensembl transtripts involved in fusion geneENST00000405201, ENST00000404621, 
ENST00000404121, ENST00000356219, 
ENST00000397355, ENST00000429285, 
ENST00000370467, 
Fusion gene scores* DoF score18 X 20 X 15=54001 X 1 X 1=1
# samples 301
** MAII scorelog2(30/5400*10)=-4.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: NCOR2 [Title/Abstract] AND FMR1NB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRCTCGA-B0-4699-01ANCOR2chr12

124882665

-FMR1NBchrX

147084721

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000405201ENST00000370467NCOR2chr12

124882665

-FMR1NBchrX

147084721

+
Frame-shiftENST00000404621ENST00000370467NCOR2chr12

124882665

-FMR1NBchrX

147084721

+
Frame-shiftENST00000404121ENST00000370467NCOR2chr12

124882665

-FMR1NBchrX

147084721

+
Frame-shiftENST00000356219ENST00000370467NCOR2chr12

124882665

-FMR1NBchrX

147084721

+
Frame-shiftENST00000397355ENST00000370467NCOR2chr12

124882665

-FMR1NBchrX

147084721

+
Frame-shiftENST00000429285ENST00000370467NCOR2chr12

124882665

-FMR1NBchrX

147084721

+

Top

FusionProtFeatures for NCOR2_FMR1NB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NCOR2

Q9Y618

FMR1NB

Q8N0W7

Transcriptional corepressor. Mediates thetranscriptional repression activity of some nuclear receptors bypromoting chromatin condensation, thus preventing access of thebasal transcription. Isoform 1 and isoform 5 have differentaffinities for different nuclear receptors. Involved in theregulation BCL6-dependent of the germinal center (GC) reactions,mainly through the control of the GC B-cells proliferation andsurvival. {ECO:0000269|PubMed:18212045,ECO:0000269|PubMed:23911289}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-1748174_2156252522Coiled coilOntology_term=ECO:0000255
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-1748522_5616252522Coiled coilOntology_term=ECO:0000255
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-1748494_5106252522Compositional biasNote=Poly-Gln
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-1748427_4786252522DomainSANT 1
TgeneFMR1NBchr12:124882665chrX:147084721ENST00000370467+06125_18492194DomainNote=P-type
TgeneFMR1NBchr12:124882665chrX:147084721ENST00000370467+06205_25592194Topological domainCytoplasmic
TgeneFMR1NBchr12:124882665chrX:147084721ENST00000370467+0690_18392194Topological domainExtracellular
TgeneFMR1NBchr12:124882665chrX:147084721ENST00000370467+06184_20492194TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-17481392_13976252522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-17481850_18546252522Compositional biasNote=Poly-Gly
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-17482487_24906252522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-1748682_6856252522Compositional biasNote=Poly-Lys
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-1748778_8206252522Compositional biasNote=Pro-rich
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-1748995_10036252522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-1748610_6616252522DomainSANT 2
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-17482147_21516252522MotifNote=CORNR box of ID1
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-17482350_23546252522MotifNote=CORNR box of ID2
TgeneFMR1NBchr12:124882665chrX:147084721ENST00000370467+061_6892194Topological domainCytoplasmic
TgeneFMR1NBchr12:124882665chrX:147084721ENST00000370467+0669_8992194TransmembraneHelical


Top

FusionGeneSequence for NCOR2_FMR1NB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NCOR2_ENST00000405201_chr12_124882665_-_FMR1NB_ENST00000370467_chrX_147084721_+_789aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENI
KINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN
FGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVEN
DKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQSAELASMELNESSRWTEEEMETAKKGSSYF
VLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NCOR2_ENST00000405201_chr12_124882665_-_FMR1NB_ENST00000370467_chrX_147084721_+_2367nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACATC
AAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGC
GAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCGC
CAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG
AGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CCCATGCCCCGCAGCAGCCAGGAGGAGAAAGATGAGAAGGAGAAGGAAAAGGAGGCGGAGAAGGAGGAGGAGAAGCCGGAGGTGGAGAAC
GACAAGGAAGACCTCCTCAAGGAGAAGACAGACGACACCTCAGGGGAGGACAACGACGAGAAGGAGGCTGTGGCCTCCAAAGGCCGCAAA
ACTGCCAACAGCCAGGGAAGACGCAAAGGCCGCATCACCCGCTCAATGGCTAATGAGGCCAACAGCGAGGAGGCCATCACCCCCCAGCAG
AGCGCCGAGCTGGCCTCCATGGAGCTGAATGAGAGTTCTCGCTGGACAGAAGAAGAAATGGAAACAGCCAAGAAAGGGTCCTCATATTTT
GTGCTTGCAAATGGACATATCCTGCCCAACAGTGAAAATGCTCATGGCCAATCTCTGGAAGAAGATTCCGCATTGGAAGCTTTGCTGAAT
TTTTTCTTTCCAACAACTTGCAATCTGAGGGAAAATCAGGTGGCAAAGCCTTGTAATGAGCTGCAAGATCTTAGTGAGAGTGAATGTTTG
AGACACAAATGCTGTTTTTCATCATCGGGGACCACGAGCTTCAAATGTTTTGCTCCATTTAGAGATGTGCCTAAACAGATGATGCAAATG
TTTGGGCTTGGTGCGATCAGCCTTATCCTGGTATGTCTGCCCATTTATTGCCGCTCTCTTTTCTGGAGGAGCGAACCGGCCGATGATTTA
CAAAGGCAGGACAACAGAGTTGTAACGGGTTTGAAGAAACAAAGAAGGAAGCGAAAGAGGAAGTCTGAAATGTTACAGAAAGCAGCAAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NCOR2_ENST00000405201_chr12_124882665_-_FMR1NB_ENST00000370467_chrX_147084721_+_2547nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGC
TGCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCATGAGAACAT
CAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCA
GCGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCG
CGAGTACTACGAGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGG
GCTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGAACCTGGAGAAGCAGATGCG
CCAGCTGGCCGTGATCCCGCCCATGCTGTACGACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCAT
GAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAA
CTTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAA
GAGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCA
GCCCATGCCCCGCAGCAGCCAGGAGGAGAAAGATGAGAAGGAGAAGGAAAAGGAGGCGGAGAAGGAGGAGGAGAAGCCGGAGGTGGAGAA
CGACAAGGAAGACCTCCTCAAGGAGAAGACAGACGACACCTCAGGGGAGGACAACGACGAGAAGGAGGCTGTGGCCTCCAAAGGCCGCAA
AACTGCCAACAGCCAGGGAAGACGCAAAGGCCGCATCACCCGCTCAATGGCTAATGAGGCCAACAGCGAGGAGGCCATCACCCCCCAGCA
GAGCGCCGAGCTGGCCTCCATGGAGCTGAATGAGAGTTCTCGCTGGACAGAAGAAGAAATGGAAACAGCCAAGAAAGGGTCCTCATATTT
TGTGCTTGCAAATGGACATATCCTGCCCAACAGTGAAAATGCTCATGGCCAATCTCTGGAAGAAGATTCCGCATTGGAAGCTTTGCTGAA
TTTTTTCTTTCCAACAACTTGCAATCTGAGGGAAAATCAGGTGGCAAAGCCTTGTAATGAGCTGCAAGATCTTAGTGAGAGTGAATGTTT
GAGACACAAATGCTGTTTTTCATCATCGGGGACCACGAGCTTCAAATGTTTTGCTCCATTTAGAGATGTGCCTAAACAGATGATGCAAAT
GTTTGGGCTTGGTGCGATCAGCCTTATCCTGGTATGTCTGCCCATTTATTGCCGCTCTCTTTTCTGGAGGAGCGAACCGGCCGATGATTT
ACAAAGGCAGGACAACAGAGTTGTAACGGGTTTGAAGAAACAAAGAAGGAAGCGAAAGAGGAAGTCTGAAATGTTACAGAAAGCAGCAAG
AGGACGTGAGGAACATGGTGACGAGTAGCAAGAGACCAAAGCATTATTTTCCCCTCAAGACAACAGAAACCATTCAGAGCAGAGGGGACT
GTCTCAGCCATGCAAACCTCATGGAGCATTTTGGAAAGTTAAAAATTGATTCTTATTTTTGTCATGTTTACTTTCAAACATGAAATAAAA


Top

FusionGenePPI for NCOR2_FMR1NB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NCOR2SPEN, ZBTB16, AR, IKZF1, RUNX1T1, HDAC3, TBL1X, RELA, NFKBIA, HDAC4, HDAC7, SNW1, HDAC1, HDAC10, PML, PPARD, BCL6, NCOR1, SMARCA4, SIN3A, HDAC2, SAP30, HDAC5, RBPJ, POU2F1, RARA, INPP5K, CIR1, JUN, FOS, SRF, NR3C1, PPARA, THRB, VDR, NR4A1, PGR, RXRA, NCOA6, ZBTB7A, NR4A2, EP300, CREBBP, CNOT2, AKT1, CHUK, HIST1H4A, NR1I2, HNF4A, ATXN1, ATXN1L, SF1, SP1, CEBPB, NFE2L2, PPARG, FOXP1, NFKBIB, NFKBIE, NFKB1, SKIL, THRA, ESR1, ESR2, BACH2, NCOA3, GPS2, SUMO1, UBE2I, IRF5, CDKN1A, RARB, RARG, AP2M1, RANBP9, RXRG, NR1H2, TNIP2, CEP63, TNIK, SOX2, E2F4, NRD1, CTBP1, ARNT, AHR, NR1D1, NR1H4, C1D, RUNX1, CBX6, BTRC, E2F1, BCOR, AURKA, HMGA1, KLF5, HSPA5, SEC16A, FBXO22, RGMA, FOXK2, NANOG, POU5F1, ITGAV, EYA2, TBL1Y, ZSCAN5A, LASP1, USP44, TRIM25FMR1NBNOP56, CEBPZ, RRP12, RPL26L1, NRD1, CWC22, CHCHD2P9, PITHD1, BOP1, RPL5, WT1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneNCOR2chr12:124882665chrX:147084721ENST00000356219-1748254_3126252522SIN3A/B


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NCOR2_FMR1NB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NCOR2_FMR1NB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNCOR2C0005586Bipolar Disorder1PSYGENET
HgeneNCOR2C0023893Liver Cirrhosis, Experimental1CTD_human