FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23731

FusionGeneSummary for NCOR2_DHX37

check button Fusion gene summary
Fusion gene informationFusion gene name: NCOR2_DHX37
Fusion gene ID: 23731
HgeneTgene
Gene symbol

NCOR2

DHX37

Gene ID

9612

57647

Gene namenuclear receptor corepressor 2DEAH-box helicase 37
SynonymsCTG26|N-CoR2|SMAP270|SMRT|SMRTE|SMRTE-tau|TNRC14|TRAC|TRAC-1|TRAC1DDX37|Dhr1
Cytomap

12q24.31

12q24.31

Type of geneprotein-codingprotein-coding
Descriptionnuclear receptor corepressor 2CTG repeat protein 26T3 receptor-associating factorsilencing mediator for retinoid and thyroid hormone receptorsthyroid-, retinoic-acid-receptor-associated corepressorprobable ATP-dependent RNA helicase DHX37DEAD/DEAH box helicase DDX37DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 37DEAH (Asp-Glu-Ala-His) box polypeptide 37DEAH box protein 37
Modification date2018052720180523
UniProtAcc

Q9Y618

Q8IY37

Ensembl transtripts involved in fusion geneENST00000405201, ENST00000404621, 
ENST00000404121, ENST00000356219, 
ENST00000397355, ENST00000429285, 
ENST00000308736, ENST00000544745, 
Fusion gene scores* DoF score18 X 20 X 15=54003 X 5 X 5=75
# samples 305
** MAII scorelog2(30/5400*10)=-4.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NCOR2 [Title/Abstract] AND DHX37 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-06-0878-01ANCOR2chr12

124950719

-DHX37chr12

125450358

-
TCGARVOVTCGA-13-A5FT-01ANCOR2chr12

124970987

-DHX37chr12

125470811

-
TCGARVSTADTCGA-CG-4449-01ANCOR2chr12

124846672

-DHX37chr12

125435350

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000405201ENST00000308736NCOR2chr12

124950719

-DHX37chr12

125450358

-
In-frameENST00000405201ENST00000544745NCOR2chr12

124950719

-DHX37chr12

125450358

-
Frame-shiftENST00000404621ENST00000308736NCOR2chr12

124950719

-DHX37chr12

125450358

-
Frame-shiftENST00000404621ENST00000544745NCOR2chr12

124950719

-DHX37chr12

125450358

-
5UTR-3CDSENST00000404121ENST00000308736NCOR2chr12

124950719

-DHX37chr12

125450358

-
5UTR-3CDSENST00000404121ENST00000544745NCOR2chr12

124950719

-DHX37chr12

125450358

-
Frame-shiftENST00000356219ENST00000308736NCOR2chr12

124950719

-DHX37chr12

125450358

-
Frame-shiftENST00000356219ENST00000544745NCOR2chr12

124950719

-DHX37chr12

125450358

-
Frame-shiftENST00000397355ENST00000308736NCOR2chr12

124950719

-DHX37chr12

125450358

-
Frame-shiftENST00000397355ENST00000544745NCOR2chr12

124950719

-DHX37chr12

125450358

-
Frame-shiftENST00000429285ENST00000308736NCOR2chr12

124950719

-DHX37chr12

125450358

-
Frame-shiftENST00000429285ENST00000544745NCOR2chr12

124950719

-DHX37chr12

125450358

-
Frame-shiftENST00000405201ENST00000308736NCOR2chr12

124970987

-DHX37chr12

125470811

-
5CDS-intronENST00000405201ENST00000544745NCOR2chr12

124970987

-DHX37chr12

125470811

-
Frame-shiftENST00000404621ENST00000308736NCOR2chr12

124970987

-DHX37chr12

125470811

-
5CDS-intronENST00000404621ENST00000544745NCOR2chr12

124970987

-DHX37chr12

125470811

-
5UTR-3CDSENST00000404121ENST00000308736NCOR2chr12

124970987

-DHX37chr12

125470811

-
5UTR-intronENST00000404121ENST00000544745NCOR2chr12

124970987

-DHX37chr12

125470811

-
Frame-shiftENST00000356219ENST00000308736NCOR2chr12

124970987

-DHX37chr12

125470811

-
5CDS-intronENST00000356219ENST00000544745NCOR2chr12

124970987

-DHX37chr12

125470811

-
Frame-shiftENST00000397355ENST00000308736NCOR2chr12

124970987

-DHX37chr12

125470811

-
5CDS-intronENST00000397355ENST00000544745NCOR2chr12

124970987

-DHX37chr12

125470811

-
Frame-shiftENST00000429285ENST00000308736NCOR2chr12

124970987

-DHX37chr12

125470811

-
5CDS-intronENST00000429285ENST00000544745NCOR2chr12

124970987

-DHX37chr12

125470811

-
Frame-shiftENST00000405201ENST00000308736NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000405201ENST00000544745NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000404621ENST00000308736NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000404621ENST00000544745NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000404121ENST00000308736NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000404121ENST00000544745NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000356219ENST00000308736NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000356219ENST00000544745NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000397355ENST00000308736NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000397355ENST00000544745NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000429285ENST00000308736NCOR2chr12

124846672

-DHX37chr12

125435350

-
Frame-shiftENST00000429285ENST00000544745NCOR2chr12

124846672

-DHX37chr12

125435350

-

Top

FusionProtFeatures for NCOR2_DHX37


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NCOR2

Q9Y618

DHX37

Q8IY37

Transcriptional corepressor. Mediates thetranscriptional repression activity of some nuclear receptors bypromoting chromatin condensation, thus preventing access of thebasal transcription. Isoform 1 and isoform 5 have differentaffinities for different nuclear receptors. Involved in theregulation BCL6-dependent of the germinal center (GC) reactions,mainly through the control of the GC B-cells proliferation andsurvival. {ECO:0000269|PubMed:18212045,ECO:0000269|PubMed:23911289}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-648174_2152352522Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-648522_5612352522Coiled coilOntology_term=ECO:0000255
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-6481392_13972352522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-6481850_18542352522Compositional biasNote=Poly-Gly
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-6482487_24902352522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-648494_5102352522Compositional biasNote=Poly-Gln
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-648682_6852352522Compositional biasNote=Poly-Lys
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-648778_8202352522Compositional biasNote=Pro-rich
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-648995_10032352522Compositional biasNote=Poly-Pro
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-648427_4782352522DomainSANT 1
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-648610_6612352522DomainSANT 2
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-6482147_21512352522MotifNote=CORNR box of ID1
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-6482350_23542352522MotifNote=CORNR box of ID2
TgeneDHX37chr12:124950719chr12:125450358ENST00000308736-1127262_4295301158DomainHelicase ATP-binding
TgeneDHX37chr12:124950719chr12:125450358ENST00000308736-1127459_7165301158DomainHelicase C-terminal
TgeneDHX37chr12:124950719chr12:125450358ENST00000308736-1127372_3755301158MotifNote=DEAH box
TgeneDHX37chr12:124950719chr12:125450358ENST00000308736-1127275_2825301158Nucleotide bindingATP


Top

FusionGeneSequence for NCOR2_DHX37


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NCOR2_ENST00000405201_chr12_124950719_-_DHX37_ENST00000308736_chr12_125450358_-_863aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRVLPQINLDHYSVLPAGEGDEDREAEVDEEEGALDS
DLDLDLGDGGQDGGEQPDASLPLHVLPLYSLLAPEKQAQVFKPPPEGTRLCVVATNVAETSLTIPGIKYVVDCGKVKKRYYDRVTGVSSF
RVTWVSQASADQRAGRAGRTEPGHCYRLYSSAVFGDFEQFPPPEITRRPVEDLILQMKALNVEKVINFPFPTPPSVEALLAAEELLIALG
ALQPPQKAERVKQLQENRLSCPITALGRTMATFPVAPRYAKMLALSRQHGCLPYAITIVASMTVRELFEELDRPAASDEELTRLKSKRAR
VAQMKRTWAGQGASLKLGDLMVLLGAVGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVNAVCPEAELFVDPKMQPPTESQVTYL
RQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLLDDPVFIHPSSVLFKELPEFVVYQEIVETTKMYMKGVSSVEVQWIPALLPSYCQFD
KPLEEPAPTYCPERGRVLCHRASVFYRVGWPLPAIEVDFPEGIDRYKHFARFLLEGQVFRKLASYRSCLLSSPGTMLKTWARLQPRTESL

>In-frame_NCOR2_ENST00000405201_chr12_124950719_-_DHX37_ENST00000544745_chr12_125450358_-_881aa
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHS
YLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRVLPQINLDHYSVLPAGEGDEDREAEVDEEEGALDS
DLDLDLGDGGQDGGEQPDASLPLHVLPLYSLLAPEKQAQVFKPPPEGTRLCVVATNVAETSLTIPGIKYVVDCGKVKKRYYDRVTGVSSF
RVTWVSQASADQRAGRAGRTEPGHCYRLYSSAVFGDFEQFPPPEITRRPVEDLILQMKALNVEKVINFPFPTPPSVEALLAAEELLIALG
ALQPPQKAERVKQLQENRLSCPITALGRTMATFPVAPRYAKMLALSRQHGCLPYAITIVASMTVRELFEELDRPAASDEELTRLKSKRAR
VAQMKRTWAGQGASLKLGDLMVLLGAVGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVNAVCPEAELFVDPKMQPPTESQVTYL
RQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLLDDPVFIHPSSVLFKELPEFVVYQEIVETTKMYMKGVSSVEVQWIPALLPSYCQFD
KPLEEPAPTYCPERGRVLCHRASVFYRVGWPLPAIEVDFPEGIDRYKHFARFLLEGQVFRKLASYRSCLLSSPGTMLKTWARLQPRTESL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NCOR2_ENST00000405201_chr12_124950719_-_DHX37_ENST00000308736_chr12_125450358_-_2589nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGGTGCTGCCCCAGATC
AACTTGGATCATTACTCGGTGTTACCGGCAGGCGAAGGCGATGAGGACAGGGAGGCAGAAGTGGATGAGGAAGAGGGGGCCCTGGACTCC
GACCTCGATCTGGACCTGGGGGATGGCGGGCAAGATGGAGGTGAGCAGCCGGATGCCTCCCTCCCGCTCCACGTGCTCCCGCTGTACTCT
CTGCTGGCCCCAGAGAAGCAAGCACAGGTCTTTAAGCCTCCACCGGAGGGGACTCGGTTGTGTGTTGTGGCCACCAATGTGGCCGAGACG
TCGCTTACCATCCCTGGCATCAAGTACGTGGTGGACTGTGGGAAGGTCAAGAAACGCTACTACGACCGCGTCACTGGCGTATCCTCCTTC
CGTGTCACCTGGGTCTCCCAGGCATCAGCTGACCAGCGAGCGGGCAGAGCAGGACGGACGGAGCCCGGCCACTGCTACAGGCTGTATTCA
TCTGCGGTTTTTGGTGACTTCGAGCAGTTTCCTCCTCCAGAAATCACCCGGAGGCCTGTTGAAGACTTAATCCTTCAAATGAAGGCGCTC
AACGTTGAAAAGGTCATCAACTTCCCCTTCCCGACGCCCCCCTCCGTGGAAGCCCTTCTTGCCGCCGAGGAGCTGTTGATCGCACTGGGT
GCCCTGCAACCGCCCCAGAAAGCAGAAAGGGTGAAGCAACTGCAGGAGAACCGGCTGAGCTGCCCCATCACTGCGCTGGGCCGGACAATG
GCCACATTCCCCGTGGCACCCCGCTACGCTAAGATGCTGGCACTGAGCCGACAACACGGCTGCCTGCCCTATGCCATCACCATCGTGGCC
AGCATGACGGTGCGGGAGCTGTTTGAGGAGCTGGACAGACCAGCGGCCAGTGACGAGGAGCTCACCAGGCTGAAGAGCAAGCGGGCCCGG
GTGGCCCAGATGAAGAGGACCTGGGCAGGGCAGGGGGCTTCTCTGAAGCTCGGCGACCTCATGGTGCTGCTGGGCGCCGTGGGAGCCTGT
GAGTATGCCAGCTGCACACCCCAGTTTTGCGAAGCCAACGGGCTGCGGTACAAAGCCATGATGGAGATCCGGCGCCTGCGGGGCCAGCTG
ACCACCGCAGTCAATGCCGTGTGCCCCGAGGCTGAGCTCTTCGTGGATCCCAAGATGCAGCCGCCCACCGAGAGCCAGGTGACCTACCTG
CGACAGATCGTGACGGCAGGCCTGGGGGACCACTTGGCCCGCAGGGTCCAGAGCGAGGAGATGCTGGAGGACAAGTGGAGGAACGCCTAC
AAGACCCCTCTCCTCGACGACCCTGTCTTCATCCACCCCAGCTCCGTCCTTTTCAAAGAGCTCCCCGAGTTTGTGGTCTACCAGGAAATC
GTGGAGACCACTAAGATGTACATGAAAGGCGTCTCTAGCGTGGAGGTCCAGTGGATCCCGGCCCTGCTGCCCTCTTACTGCCAGTTTGAC
AAGCCCCTGGAGGAACCAGCCCCTACATACTGCCCCGAGCGGGGGCGGGTGCTGTGTCACCGGGCCAGCGTGTTCTATCGCGTGGGCTGG
CCGCTCCCCGCCATCGAGGTGGATTTTCCAGAGGGGATTGACCGCTACAAGCACTTTGCCCGGTTCCTGCTGGAAGGGCAGGTCTTCCGC
AAGCTGGCCTCATACCGGAGCTGTCTGCTGTCCAGCCCCGGCACCATGCTGAAGACGTGGGCCAGGCTGCAGCCCCGTACGGAGAGCCTT
CTGCGAGCCCTGGTTGCAGAGAAGGCTGACTGCCATGAAGCCTTGCTGGCTGCTTGGAAGAAAAACCCCAAATACCTGCTGGCTGAGTAC

>In-frame_NCOR2_ENST00000405201_chr12_124950719_-_DHX37_ENST00000544745_chr12_125450358_-_2643nt
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATC
GCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTCA
TACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCCT
GAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGGTGCTGCCCCAGATC
AACTTGGATCATTACTCGGTGTTACCGGCAGGCGAAGGCGATGAGGACAGGGAGGCAGAAGTGGATGAGGAAGAGGGGGCCCTGGACTCC
GACCTCGATCTGGACCTGGGGGATGGCGGGCAAGATGGAGGTGAGCAGCCGGATGCCTCCCTCCCGCTCCACGTGCTCCCGCTGTACTCT
CTGCTGGCCCCAGAGAAGCAAGCACAGGTCTTTAAGCCTCCACCGGAGGGGACTCGGTTGTGTGTTGTGGCCACCAATGTGGCCGAGACG
TCGCTTACCATCCCTGGCATCAAGTACGTGGTGGACTGTGGGAAGGTCAAGAAACGCTACTACGACCGCGTCACTGGCGTATCCTCCTTC
CGTGTCACCTGGGTCTCCCAGGCATCAGCTGACCAGCGAGCGGGCAGAGCAGGACGGACGGAGCCCGGCCACTGCTACAGGCTGTATTCA
TCTGCGGTTTTTGGTGACTTCGAGCAGTTTCCTCCTCCAGAAATCACCCGGAGGCCTGTTGAAGACTTAATCCTTCAAATGAAGGCGCTC
AACGTTGAAAAGGTCATCAACTTCCCCTTCCCGACGCCCCCCTCCGTGGAAGCCCTTCTTGCCGCCGAGGAGCTGTTGATCGCACTGGGT
GCCCTGCAACCGCCCCAGAAAGCAGAAAGGGTGAAGCAACTGCAGGAGAACCGGCTGAGCTGCCCCATCACTGCGCTGGGCCGGACAATG
GCCACATTCCCCGTGGCACCCCGCTACGCTAAGATGCTGGCACTGAGCCGACAACACGGCTGCCTGCCCTATGCCATCACCATCGTGGCC
AGCATGACGGTGCGGGAGCTGTTTGAGGAGCTGGACAGACCAGCGGCCAGTGACGAGGAGCTCACCAGGCTGAAGAGCAAGCGGGCCCGG
GTGGCCCAGATGAAGAGGACCTGGGCAGGGCAGGGGGCTTCTCTGAAGCTCGGCGACCTCATGGTGCTGCTGGGCGCCGTGGGAGCCTGT
GAGTATGCCAGCTGCACACCCCAGTTTTGCGAAGCCAACGGGCTGCGGTACAAAGCCATGATGGAGATCCGGCGCCTGCGGGGCCAGCTG
ACCACCGCAGTCAATGCCGTGTGCCCCGAGGCTGAGCTCTTCGTGGATCCCAAGATGCAGCCGCCCACCGAGAGCCAGGTGACCTACCTG
CGACAGATCGTGACGGCAGGCCTGGGGGACCACTTGGCCCGCAGGGTCCAGAGCGAGGAGATGCTGGAGGACAAGTGGAGGAACGCCTAC
AAGACCCCTCTCCTCGACGACCCTGTCTTCATCCACCCCAGCTCCGTCCTTTTCAAAGAGCTCCCCGAGTTTGTGGTCTACCAGGAAATC
GTGGAGACCACTAAGATGTACATGAAAGGCGTCTCTAGCGTGGAGGTCCAGTGGATCCCGGCCCTGCTGCCCTCTTACTGCCAGTTTGAC
AAGCCCCTGGAGGAACCAGCCCCTACATACTGCCCCGAGCGGGGGCGGGTGCTGTGTCACCGGGCCAGCGTGTTCTATCGCGTGGGCTGG
CCGCTCCCCGCCATCGAGGTGGATTTTCCAGAGGGGATTGACCGCTACAAGCACTTTGCCCGGTTCCTGCTGGAAGGGCAGGTCTTCCGC
AAGCTGGCCTCATACCGGAGCTGTCTGCTGTCCAGCCCCGGCACCATGCTGAAGACGTGGGCCAGGCTGCAGCCCCGTACGGAGAGCCTT
CTGCGAGCCCTGGTTGCAGAGAAGGCTGACTGCCATGAAGCCTTGCTGGCTGCTTGGAAGAAAAACCCCAAATGTGAGTTTGACCAGGGC
CAGGGGGTGGGAGTAGACAGGATGGGGTCACTGAGGCAGGGGCTTTGTGCTTTGTGCACGGTCAGCCCTGGCTTGGCAGAAGGATCTGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NCOR2_ENST00000405201_chr12_124950719_-_DHX37_ENST00000308736_chr12_125450358_-_3565nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGGTGCTGCCCCAGAT
CAACTTGGATCATTACTCGGTGTTACCGGCAGGCGAAGGCGATGAGGACAGGGAGGCAGAAGTGGATGAGGAAGAGGGGGCCCTGGACTC
CGACCTCGATCTGGACCTGGGGGATGGCGGGCAAGATGGAGGTGAGCAGCCGGATGCCTCCCTCCCGCTCCACGTGCTCCCGCTGTACTC
TCTGCTGGCCCCAGAGAAGCAAGCACAGGTCTTTAAGCCTCCACCGGAGGGGACTCGGTTGTGTGTTGTGGCCACCAATGTGGCCGAGAC
GTCGCTTACCATCCCTGGCATCAAGTACGTGGTGGACTGTGGGAAGGTCAAGAAACGCTACTACGACCGCGTCACTGGCGTATCCTCCTT
CCGTGTCACCTGGGTCTCCCAGGCATCAGCTGACCAGCGAGCGGGCAGAGCAGGACGGACGGAGCCCGGCCACTGCTACAGGCTGTATTC
ATCTGCGGTTTTTGGTGACTTCGAGCAGTTTCCTCCTCCAGAAATCACCCGGAGGCCTGTTGAAGACTTAATCCTTCAAATGAAGGCGCT
CAACGTTGAAAAGGTCATCAACTTCCCCTTCCCGACGCCCCCCTCCGTGGAAGCCCTTCTTGCCGCCGAGGAGCTGTTGATCGCACTGGG
TGCCCTGCAACCGCCCCAGAAAGCAGAAAGGGTGAAGCAACTGCAGGAGAACCGGCTGAGCTGCCCCATCACTGCGCTGGGCCGGACAAT
GGCCACATTCCCCGTGGCACCCCGCTACGCTAAGATGCTGGCACTGAGCCGACAACACGGCTGCCTGCCCTATGCCATCACCATCGTGGC
CAGCATGACGGTGCGGGAGCTGTTTGAGGAGCTGGACAGACCAGCGGCCAGTGACGAGGAGCTCACCAGGCTGAAGAGCAAGCGGGCCCG
GGTGGCCCAGATGAAGAGGACCTGGGCAGGGCAGGGGGCTTCTCTGAAGCTCGGCGACCTCATGGTGCTGCTGGGCGCCGTGGGAGCCTG
TGAGTATGCCAGCTGCACACCCCAGTTTTGCGAAGCCAACGGGCTGCGGTACAAAGCCATGATGGAGATCCGGCGCCTGCGGGGCCAGCT
GACCACCGCAGTCAATGCCGTGTGCCCCGAGGCTGAGCTCTTCGTGGATCCCAAGATGCAGCCGCCCACCGAGAGCCAGGTGACCTACCT
GCGACAGATCGTGACGGCAGGCCTGGGGGACCACTTGGCCCGCAGGGTCCAGAGCGAGGAGATGCTGGAGGACAAGTGGAGGAACGCCTA
CAAGACCCCTCTCCTCGACGACCCTGTCTTCATCCACCCCAGCTCCGTCCTTTTCAAAGAGCTCCCCGAGTTTGTGGTCTACCAGGAAAT
CGTGGAGACCACTAAGATGTACATGAAAGGCGTCTCTAGCGTGGAGGTCCAGTGGATCCCGGCCCTGCTGCCCTCTTACTGCCAGTTTGA
CAAGCCCCTGGAGGAACCAGCCCCTACATACTGCCCCGAGCGGGGGCGGGTGCTGTGTCACCGGGCCAGCGTGTTCTATCGCGTGGGCTG
GCCGCTCCCCGCCATCGAGGTGGATTTTCCAGAGGGGATTGACCGCTACAAGCACTTTGCCCGGTTCCTGCTGGAAGGGCAGGTCTTCCG
CAAGCTGGCCTCATACCGGAGCTGTCTGCTGTCCAGCCCCGGCACCATGCTGAAGACGTGGGCCAGGCTGCAGCCCCGTACGGAGAGCCT
TCTGCGAGCCCTGGTTGCAGAGAAGGCTGACTGCCATGAAGCCTTGCTGGCTGCTTGGAAGAAAAACCCCAAATACCTGCTGGCTGAGTA
CTGTGAGTGGCTTCCACAGGCCATGCACCCCGATATCGAGAAAGCCTGGCCCCCCACCACTGTCCACTGACCAGAAACCTGGCTGCAGGG
CCGAGGACTGGTTTGGGGACTGGAGGGCTGGCAGCAGCCTGTCACCGTGCGACCGTGACCACCTGGCATGGGCTTCGTGGCCTGCTCTCA
GGAAGTGGGTCAAGCCCTGGGAACCCTCATCCATGAGAGCTCGATCCCGTATGAAGGGTGCTGCCGCCCGTGCCATCTGGCCCGGGGGTG
ACTTTTTGAACTGTTTATTATATGGTGGATGATGATTTCATCTCACGTGCTGGACGCTGTTCTGTTCAGTGTGCTCTTTGGACTACATTA
GTCCCCTGTGGAGCAGCAGGGCTGGAGATCTCTGCAGTCCCTTCCCCGCCCGCCCTGCCAGAAGGCCGAGGAGGCACGTGGAGGGCCTCC
TTCCTGCAATTCTTCCCTCTCCAGAGTCAGGGAGGGCTGCCCAGCCCTGGCCTCACAGCCGTCCCAGATGTTAGGTGAGCCACTGAGCTC
TGTGTTGACCTTGAGGGGCCTGGCTGGGGGCCCCCAGGCTCCATGCCTTCTTGGGAGGGTGGCCGCCAACGCCTTTCCTGTGTTATGGCA
ACAGGGAGTGGGCATCTCATCTGCCTGTGGTCAGCTCTCAGACGGCAGGGAGCGGAGCTGACGTTGGCTGTGCTTGGTCACCGCTGCCAT
GCCGCAGAGGATGCGCCTAGCTGGGCTGGGGCCACACGACTATTATGTTGGCCTTGAACGGGGACTGCAGAGCCCTCAGTTTGTCTCCCT
TGTTCCTCTGTGGCTGAGGTGGGAGGGGGAGGGTGGGGTAGGTCCCCCAGCAAGAAAGAGGGACAGGAGCACCCCAGGCAGGACCAAGGA
GTCGGGAGGCCCCTGCCTTCTGTCCTCCATGGTGAGGGCACAGATGTCTCCCCAGAGCCCAGCGCTGGCAGAATGGATTCTGCTCCTGGC

>In-frame_NCOR2_ENST00000405201_chr12_124950719_-_DHX37_ENST00000544745_chr12_125450358_-_3757nt
CATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGAT
CGCCCGGACGCACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCA
GCCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACCTGCGGCCAGAGTCCCACTC
ATACCTGCCCGAGCTGGGGAAGTCAGAGATGGAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACC
GTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCC
CCCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGA
CCGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTGGAGGAGGAGGCTGCCAAGCCGCCCGAGCC
TGAGAAGCCCGTGTCACCGCCGCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGGTGCTGCCCCAGAT
CAACTTGGATCATTACTCGGTGTTACCGGCAGGCGAAGGCGATGAGGACAGGGAGGCAGAAGTGGATGAGGAAGAGGGGGCCCTGGACTC
CGACCTCGATCTGGACCTGGGGGATGGCGGGCAAGATGGAGGTGAGCAGCCGGATGCCTCCCTCCCGCTCCACGTGCTCCCGCTGTACTC
TCTGCTGGCCCCAGAGAAGCAAGCACAGGTCTTTAAGCCTCCACCGGAGGGGACTCGGTTGTGTGTTGTGGCCACCAATGTGGCCGAGAC
GTCGCTTACCATCCCTGGCATCAAGTACGTGGTGGACTGTGGGAAGGTCAAGAAACGCTACTACGACCGCGTCACTGGCGTATCCTCCTT
CCGTGTCACCTGGGTCTCCCAGGCATCAGCTGACCAGCGAGCGGGCAGAGCAGGACGGACGGAGCCCGGCCACTGCTACAGGCTGTATTC
ATCTGCGGTTTTTGGTGACTTCGAGCAGTTTCCTCCTCCAGAAATCACCCGGAGGCCTGTTGAAGACTTAATCCTTCAAATGAAGGCGCT
CAACGTTGAAAAGGTCATCAACTTCCCCTTCCCGACGCCCCCCTCCGTGGAAGCCCTTCTTGCCGCCGAGGAGCTGTTGATCGCACTGGG
TGCCCTGCAACCGCCCCAGAAAGCAGAAAGGGTGAAGCAACTGCAGGAGAACCGGCTGAGCTGCCCCATCACTGCGCTGGGCCGGACAAT
GGCCACATTCCCCGTGGCACCCCGCTACGCTAAGATGCTGGCACTGAGCCGACAACACGGCTGCCTGCCCTATGCCATCACCATCGTGGC
CAGCATGACGGTGCGGGAGCTGTTTGAGGAGCTGGACAGACCAGCGGCCAGTGACGAGGAGCTCACCAGGCTGAAGAGCAAGCGGGCCCG
GGTGGCCCAGATGAAGAGGACCTGGGCAGGGCAGGGGGCTTCTCTGAAGCTCGGCGACCTCATGGTGCTGCTGGGCGCCGTGGGAGCCTG
TGAGTATGCCAGCTGCACACCCCAGTTTTGCGAAGCCAACGGGCTGCGGTACAAAGCCATGATGGAGATCCGGCGCCTGCGGGGCCAGCT
GACCACCGCAGTCAATGCCGTGTGCCCCGAGGCTGAGCTCTTCGTGGATCCCAAGATGCAGCCGCCCACCGAGAGCCAGGTGACCTACCT
GCGACAGATCGTGACGGCAGGCCTGGGGGACCACTTGGCCCGCAGGGTCCAGAGCGAGGAGATGCTGGAGGACAAGTGGAGGAACGCCTA
CAAGACCCCTCTCCTCGACGACCCTGTCTTCATCCACCCCAGCTCCGTCCTTTTCAAAGAGCTCCCCGAGTTTGTGGTCTACCAGGAAAT
CGTGGAGACCACTAAGATGTACATGAAAGGCGTCTCTAGCGTGGAGGTCCAGTGGATCCCGGCCCTGCTGCCCTCTTACTGCCAGTTTGA
CAAGCCCCTGGAGGAACCAGCCCCTACATACTGCCCCGAGCGGGGGCGGGTGCTGTGTCACCGGGCCAGCGTGTTCTATCGCGTGGGCTG
GCCGCTCCCCGCCATCGAGGTGGATTTTCCAGAGGGGATTGACCGCTACAAGCACTTTGCCCGGTTCCTGCTGGAAGGGCAGGTCTTCCG
CAAGCTGGCCTCATACCGGAGCTGTCTGCTGTCCAGCCCCGGCACCATGCTGAAGACGTGGGCCAGGCTGCAGCCCCGTACGGAGAGCCT
TCTGCGAGCCCTGGTTGCAGAGAAGGCTGACTGCCATGAAGCCTTGCTGGCTGCTTGGAAGAAAAACCCCAAATGTGAGTTTGACCAGGG
CCAGGGGGTGGGAGTAGACAGGATGGGGTCACTGAGGCAGGGGCTTTGTGCTTTGTGCACGGTCAGCCCTGGCTTGGCAGAAGGATCTGG
CCCCACGGCTGCTGGCCAGCTTTTTGCCACCTGAGGAGAGTCCCTGGGCCCAGGGTCACCCTGACACTGTCCTCCTTCCCTCCCCTGCAG
ACCTGCTGGCTGAGTACTGTGAGTGGCTTCCACAGGCCATGCACCCCGATATCGAGAAAGCCTGGCCCCCCACCACTGTCCACTGACCAG
AAACCTGGCTGCAGGGCCGAGGACTGGTTTGGGGACTGGAGGGCTGGCAGCAGCCTGTCACCGTGCGACCGTGACCACCTGGCATGGGCT
TCGTGGCCTGCTCTCAGGAAGTGGGTCAAGCCCTGGGAACCCTCATCCATGAGAGCTCGATCCCGTATGAAGGGTGCTGCCGCCCGTGCC
ATCTGGCCCGGGGGTGACTTTTTGAACTGTTTATTATATGGTGGATGATGATTTCATCTCACGTGCTGGACGCTGTTCTGTTCAGTGTGC
TCTTTGGACTACATTAGTCCCCTGTGGAGCAGCAGGGCTGGAGATCTCTGCAGTCCCTTCCCCGCCCGCCCTGCCAGAAGGCCGAGGAGG
CACGTGGAGGGCCTCCTTCCTGCAATTCTTCCCTCTCCAGAGTCAGGGAGGGCTGCCCAGCCCTGGCCTCACAGCCGTCCCAGATGTTAG
GTGAGCCACTGAGCTCTGTGTTGACCTTGAGGGGCCTGGCTGGGGGCCCCCAGGCTCCATGCCTTCTTGGGAGGGTGGCCGCCAACGCCT
TTCCTGTGTTATGGCAACAGGGAGTGGGCATCTCATCTGCCTGTGGTCAGCTCTCAGACGGCAGGGAGCGGAGCTGACGTTGGCTGTGCT
TGGTCACCGCTGCCATGCCGCAGAGGATGCGCCTAGCTGGGCTGGGGCCACACGACTATTATGTTGGCCTTGAACGGGGACTGCAGAGCC
CTCAGTTTGTCTCCCTTGTTCCTCTGTGGCTGAGGTGGGAGGGGGAGGGTGGGGTAGGTCCCCCAGCAAGAAAGAGGGACAGGAGCACCC
CAGGCAGGACCAAGGAGTCGGGAGGCCCCTGCCTTCTGTCCTCCATGGTGAGGGCACAGATGTCTCCCCAGAGCCCAGCGCTGGCAGAAT


Top

FusionGenePPI for NCOR2_DHX37


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NCOR2SPEN, ZBTB16, AR, IKZF1, RUNX1T1, HDAC3, TBL1X, RELA, NFKBIA, HDAC4, HDAC7, SNW1, HDAC1, HDAC10, PML, PPARD, BCL6, NCOR1, SMARCA4, SIN3A, HDAC2, SAP30, HDAC5, RBPJ, POU2F1, RARA, INPP5K, CIR1, JUN, FOS, SRF, NR3C1, PPARA, THRB, VDR, NR4A1, PGR, RXRA, NCOA6, ZBTB7A, NR4A2, EP300, CREBBP, CNOT2, AKT1, CHUK, HIST1H4A, NR1I2, HNF4A, ATXN1, ATXN1L, SF1, SP1, CEBPB, NFE2L2, PPARG, FOXP1, NFKBIB, NFKBIE, NFKB1, SKIL, THRA, ESR1, ESR2, BACH2, NCOA3, GPS2, SUMO1, UBE2I, IRF5, CDKN1A, RARB, RARG, AP2M1, RANBP9, RXRG, NR1H2, TNIP2, CEP63, TNIK, SOX2, E2F4, NRD1, CTBP1, ARNT, AHR, NR1D1, NR1H4, C1D, RUNX1, CBX6, BTRC, E2F1, BCOR, AURKA, HMGA1, KLF5, HSPA5, SEC16A, FBXO22, RGMA, FOXK2, NANOG, POU5F1, ITGAV, EYA2, TBL1Y, ZSCAN5A, LASP1, USP44, TRIM25DHX37DDX56, TERF2, SIRT7, NAT10, POLR1C, ATXN1, KRT31, TRIP6, RGS17, NIFK, DHX15, PRPF4, WDR74, RBM19, RPS3A, SCARNA22, NOP56, MEX3C, ZNF746, RSBN1, FOXA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneNCOR2chr12:124950719chr12:125450358ENST00000356219-648254_3122352522SIN3A/B


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NCOR2_DHX37


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NCOR2_DHX37


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNCOR2C0005586Bipolar Disorder1PSYGENET
HgeneNCOR2C0023893Liver Cirrhosis, Experimental1CTD_human