FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2360

FusionGeneSummary for ARGLU1_CXCR4

check button Fusion gene summary
Fusion gene informationFusion gene name: ARGLU1_CXCR4
Fusion gene ID: 2360
HgeneTgene
Gene symbol

ARGLU1

CXCR4

Gene ID

55082

7852

Gene namearginine and glutamate rich 1C-X-C motif chemokine receptor 4
Synonyms-CD184|D2S201E|FB22|HM89|HSY3RR|LAP-3|LAP3|LCR1|LESTR|NPY3R|NPYR|NPYRL|NPYY3R|WHIM|WHIMS
Cytomap

13q33.3

2q22.1

Type of geneprotein-codingprotein-coding
Descriptionarginine and glutamate-rich protein 1C-X-C chemokine receptor type 4CD184 antigenLPS-associated protein 3SDF-1 receptorchemokine (C-X-C motif) receptor 4chemokine receptorfusinleukocyte-derived seven transmembrane domain receptorlipopolysaccharide-associated protein 3neuropeptide Y
Modification date2018052220180527
UniProtAcc

Q9NWB6

P61073

Ensembl transtripts involved in fusion geneENST00000400198, ENST00000472226, 
ENST00000375926, 
ENST00000409817, 
ENST00000241393, ENST00000466288, 
Fusion gene scores* DoF score4 X 4 X 2=323 X 3 X 2=18
# samples 53
** MAII scorelog2(5/32*10)=0.643856189774725
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ARGLU1 [Title/Abstract] AND CXCR4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCXCR4

GO:0007186

G-protein coupled receptor signaling pathway

10644702

TgeneCXCR4

GO:0071345

cellular response to cytokine stimulus

21540189


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-KK-A59X-01AARGLU1chr13

107219921

-CXCR4chr2

136873482

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000400198ENST00000409817ARGLU1chr13

107219921

-CXCR4chr2

136873482

-
In-frameENST00000400198ENST00000241393ARGLU1chr13

107219921

-CXCR4chr2

136873482

-
5CDS-5UTRENST00000400198ENST00000466288ARGLU1chr13

107219921

-CXCR4chr2

136873482

-
intron-3CDSENST00000472226ENST00000409817ARGLU1chr13

107219921

-CXCR4chr2

136873482

-
intron-3CDSENST00000472226ENST00000241393ARGLU1chr13

107219921

-CXCR4chr2

136873482

-
intron-5UTRENST00000472226ENST00000466288ARGLU1chr13

107219921

-CXCR4chr2

136873482

-
intron-3CDSENST00000375926ENST00000409817ARGLU1chr13

107219921

-CXCR4chr2

136873482

-
intron-3CDSENST00000375926ENST00000241393ARGLU1chr13

107219921

-CXCR4chr2

136873482

-
intron-5UTRENST00000375926ENST00000466288ARGLU1chr13

107219921

-CXCR4chr2

136873482

-

Top

FusionProtFeatures for ARGLU1_CXCR4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARGLU1

Q9NWB6

CXCR4

P61073

Required for the estrogen-dependent expression of ESR1target genes. Can act in cooperation with MED1.{ECO:0000269|PubMed:21454576}. Receptor for the C-X-C chemokine CXCL12/SDF-1 thattransduces a signal by increasing intracellular calcium ion levelsand enhancing MAPK1/MAPK3 activation. Acts as a receptor forextracellular ubiquitin; leading to enhanced intracellular calciumions and reduced cellular cAMP levels. Involved in hematopoiesisand in cardiac ventricular septum formation. Also plays anessential role in vascularization of the gastrointestinal tract,probably by regulating vascular branching and/or remodelingprocesses in endothelial cells. Involved in cerebellardevelopment. In the CNS, could mediate hippocampal-neuronsurvival. {ECO:0000269|PubMed:10074102,ECO:0000269|PubMed:10644702, ECO:0000269|PubMed:10825158,ECO:0000269|PubMed:11276205, ECO:0000269|PubMed:17197449,ECO:0000269|PubMed:20048153, ECO:0000269|PubMed:20228059,ECO:0000269|PubMed:20505072, ECO:0000269|PubMed:8752280,ECO:0000269|PubMed:8752281}. (Microbial infection) Acts as a coreceptor (CD4 beingthe primary receptor) for human immunodeficiency virus-1/HIV-1 X4isolates and as a primary receptor for some HIV-2 isolates.Promotes Env-mediated fusion of the virus (PubMed:9427609,PubMed:10074122, PubMed:10756055). {ECO:0000269|PubMed:10074122,ECO:0000269|PubMed:10756055, ECO:0000269|PubMed:9427609}. (Microbial infection) Binds bacterial lipopolysaccharide(LPS) et mediates LPS-induced inflammatory response, including TNFsecretion by monocytes. {ECO:0000269|PubMed:11276205}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ARGLU1_CXCR4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARGLU1_ENST00000400198_chr13_107219921_-_CXCR4_ENST00000241393_chr2_136873482_-_463aa
MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNTAVSRRERDRERASSPPDRIDIFGRTVS
KRSSLDEKQKREEEEKKAEFERQRKITTLQITTPRKWAQGTMTP_RNPVSVKKMLISIKSSCPPSTPSSS_LALWAMDWSSWSWVTRRN_
EA_RTSTGCTCQWPTSSLSSRFPSGQLMPWQTGTLGTSTARQSMSSTQSTSTAVSSSWPSSVWTATWPSSTPPTVRGQGSCWLKRWSMLA
SGSLPSC_LFPTSSLPTSVRQMTDISVTASTPMTCGWLCSSFSTSWLALSCLVLSSCPAIALSSPSCHTPRATRSARPSRPQSSSSWLSS
PVGCLTTLGSASTPSSSWKSSSKGVSLRTLCTSGFPSPRP_LSSTVV_TPSSMLSLEPNLKPLPSTHSPL_AEGPASRSSPKESEVDIHL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARGLU1_ENST00000400198_chr13_107219921_-_CXCR4_ENST00000241393_chr2_136873482_-_1391nt
ATGGGCCGGTCTCGGAGCCGGAGCTCGTCCCGCTCCAAGCACACCAAGAGCAGCAAGCACAACAAGAAGCGCAGCCGGTCCCGGTCGCGA
TCCCGGGACAAGGAGCGCGTGCGGAAGCGTTCCAAATCTCGGGAAAGTAAACGGAACCGGCGGCGGGAGTCGCGGTCCCGTTCGCGCTCC
ACCAACACGGCCGTGTCCCGGCGCGAGCGGGACCGGGAGCGCGCCTCGTCCCCGCCCGACCGCATCGACATCTTCGGGCGCACGGTGAGC
AAGCGCAGCAGCCTGGACGAGAAGCAGAAGCGAGAGGAGGAGGAGAAGAAAGCGGAGTTCGAGCGGCAGCGAAAAATATATACACTTCAG
ATAACTACACCGAGGAAATGGGCTCAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATGCTAATTTCAATAAAATCT
TCCTGCCCACCATCTACTCCATCATCTTCTTAACTGGCATTGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACTGA
GAAGCATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCCGACCTCCTCTTTGTCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGG
CAAACTGGTACTTTGGGAACTTCCTATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCTACAGCAGTGTCCTCATCCTGGCCTTCA
TCAGTCTGGACCGCTACCTGGCCATCGTCCACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTGGTCTATGTTGGCG
TCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATCTTTGCCAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCT
ACCCCAATGACTTGTGGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTATCCTGCCTGGTATTGTCATCCTGTCCTGCTATT
GCATTATCATCTCCAAGCTGTCACACTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCTCATCCTGGCTTTCTTCG
CCTGTTGGCTGCCTTACTACATTGGGATCAGCATCGACTCCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACTG
TGCACAAGTGGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTGTTGTCTGAACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTA
AAACCTCTGCCCAGCACGCACTCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAAAGCGAGGTGGACATTCATCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARGLU1_ENST00000400198_chr13_107219921_-_CXCR4_ENST00000241393_chr2_136873482_-_2154nt
ATTGTGGGAAGGGCGGCCGGTGCAGCCGCAGCTGCCATCTTAGGGGCGCCTGGCGCTACGGGTTTCTCGTTGGAGGCGGCCTTCGTGGCA
GCTGTAGACGCCGGGAAAAGGCATAAAGTCCGTTGGCCGACACCTTTCTTTCCTCCGGCCTCGGTAGAACCGCCAGCCCGCGTCCGAAGG
CGGAGGCGAGGGGAACTGGCCGCGTGAGGGGCCTGAGGCGAGCGGTTAGAGCGTCTCCCGGAAGGATGGGCCGGTCTCGGAGCCGGAGCT
CGTCCCGCTCCAAGCACACCAAGAGCAGCAAGCACAACAAGAAGCGCAGCCGGTCCCGGTCGCGATCCCGGGACAAGGAGCGCGTGCGGA
AGCGTTCCAAATCTCGGGAAAGTAAACGGAACCGGCGGCGGGAGTCGCGGTCCCGTTCGCGCTCCACCAACACGGCCGTGTCCCGGCGCG
AGCGGGACCGGGAGCGCGCCTCGTCCCCGCCCGACCGCATCGACATCTTCGGGCGCACGGTGAGCAAGCGCAGCAGCCTGGACGAGAAGC
AGAAGCGAGAGGAGGAGGAGAAGAAAGCGGAGTTCGAGCGGCAGCGAAAAATATATACACTTCAGATAACTACACCGAGGAAATGGGCTC
AGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATGCTAATTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCAT
CTTCTTAACTGGCATTGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACTGAGAAGCATGACGGACAAGTACAGGCT
GCACCTGTCAGTGGCCGACCTCCTCTTTGTCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTACTTTGGGAACTTCCT
ATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCTACAGCAGTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCAT
CGTCCACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTGGTCTATGTTGGCGTCTGGATCCCTGCCCTCCTGCTGAC
TATTCCCGACTTCATCTTTGCCAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCCCAATGACTTGTGGGTGGTTGT
GTTCCAGTTTCAGCACATCATGGTTGGCCTTATCCTGCCTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGTCACA
CTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCTCATCCTGGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGG
GATCAGCATCGACTCCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACTGTGCACAAGTGGATTTCCATCACCGA
GGCCCTAGCTTTCTTCCACTGTTGTCTGAACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGCACGCACTCAC
CTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAAAGCGAGGTGGACATTCATCTGTTTCCACTGAGTCTGAGTCTTCAAG
TTTTCACTCCAGCTAACACAGATGTAAAAGACTTTTTTTTATACGATAAATAACTTTTTTTTAAGTTACACATTTTTCAGATATAAAAGA
CTGACCAATATTGTACAGTTTTTATTGCTTGTTGGATTTTTGTCTTGTGTTTCTTTAGTTTTTGTGAAGTTTAATTGACTTATTTATATA
AATTTTTTTTGTTTCATATTGATGTGTGTCTAGGCAGGACCTGTGGCCAAGTTCTTAGTTGCTGTATGTCTCGTGGTAGGACTGTAGAAA
AGGGAACTGAACATTCCAGAGCGTGTAGTGAATCACGTAAAGCTAGAAATGATCCCCAGCTGTTTATGCATAGATAATCTCTCCATTCCC
GTGGAACGTTTTTCCTGTTCTTAAGACGTGATTTTGCTGTAGAAGATGGCACTTATAACCAAAGCCCAAAGTGGTATAGAAATGCTGGTT


Top

FusionGenePPI for ARGLU1_CXCR4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARGLU1IKBKG, ELAVL1, SF3A2, CDK2, APP, CHERP, ARGLU1, PRMT5, ZCCHC10, SRPK2, SRPK1, CUL7, EED, RPL14, NIFK, NPM3, SNRNP27, SNRNP70, SRSF11, PUF60, SUB1, NTRK1, EWSR1, DYNLT1, TMEM132A, CDC5L, NANOG, CDH1, JMJD6CXCR4CCR5, JAK3, JAK2, PTPN6, ADRBK2, PTK2, SOCS3, CD4, ITCH, USP14, STAM, CAV1, PTPN11, CXCL12, ATP13A2, ST13, P4HB, MYBL2, CXCR5, GNA13, B2M, HLA-B, GOLT1B, TMEM63B, CD79B, LPAR1, IPPK, VIPR2, GCNT3, B4GAT1, TMEM171, CCDC107, NTRK3, NT5E, SLC1A1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARGLU1_CXCR4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneCXCR4P61073DB00452FramycetinC-X-C chemokine receptor type 4small moleculeapproved
TgeneCXCR4P61073DB06809PlerixaforC-X-C chemokine receptor type 4small moleculeapproved

Top

RelatedDiseases for ARGLU1_CXCR4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCXCR4C0027627Neoplasm Metastasis2CTD_human
TgeneCXCR4C3495559Juvenile arthritis2CTD_human
TgeneCXCR4C0003873Rheumatoid Arthritis1CTD_human
TgeneCXCR4C0007621Neoplastic Cell Transformation1CTD_human
TgeneCXCR4C0027626Neoplasm Invasiveness1CTD_human
TgeneCXCR4C0027796Neuralgia1CTD_human
TgeneCXCR4C0472817WHIM syndrome1CTD_human;ORPHANET
TgeneCXCR4C1458155Mammary Neoplasms1CTD_human