FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23577

FusionGeneSummary for NCEH1_EEF1G

check button Fusion gene summary
Fusion gene informationFusion gene name: NCEH1_EEF1G
Fusion gene ID: 23577
HgeneTgene
Gene symbol

NCEH1

EEF1G

Gene ID

57552

1937

Gene nameneutral cholesterol ester hydrolase 1eukaryotic translation elongation factor 1 gamma
SynonymsAADACL1|NCEHEF1G|GIG35
Cytomap

3q26.31

11q12.3

Type of geneprotein-codingprotein-coding
Descriptionneutral cholesterol ester hydrolase 1arylacetamide deacetylase-like 1elongation factor 1-gammaEF-1-gammaPRO1608eEF-1B gammapancreatic tumor-related proteintranslation elongation factor eEF-1 gamma chain
Modification date2018052320180523
UniProtAcc

Q6PIU2

P26641

Ensembl transtripts involved in fusion geneENST00000475381, ENST00000273512, 
ENST00000538775, ENST00000543711, 
ENST00000329251, ENST00000378019, 
ENST00000532986, 
Fusion gene scores* DoF score6 X 3 X 6=1083 X 4 X 4=48
# samples 64
** MAII scorelog2(6/108*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NCEH1 [Title/Abstract] AND EEF1G [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCOADTCGA-G4-6323-01ANCEH1chr3

172428637

-EEF1Gchr11

62327309

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000475381ENST00000329251NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
Frame-shitENST00000475381ENST00000378019NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
5CDS-intronENST00000475381ENST00000532986NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
In-frameENST00000273512ENST00000329251NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
Frame-shitENST00000273512ENST00000378019NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
5CDS-intronENST00000273512ENST00000532986NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
In-frameENST00000538775ENST00000329251NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
Frame-shitENST00000538775ENST00000378019NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
5CDS-intronENST00000538775ENST00000532986NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
5UTR-3CDSENST00000543711ENST00000329251NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
5UTR-3CDSENST00000543711ENST00000378019NCEH1chr3

172428637

-EEF1Gchr11

62327309

-
5UTR-intronENST00000543711ENST00000532986NCEH1chr3

172428637

-EEF1Gchr11

62327309

-

Top

FusionProtFeatures for NCEH1_EEF1G


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NCEH1

Q6PIU2

EEF1G

P26641

Probably plays a role in anchoring the complex to othercellular components.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCEH1chr3:172428637chr11:62327309ENST00000475381-151_446409Topological domainCytoplasmic
HgeneNCEH1chr3:172428637chr11:62327309ENST00000475381-155_2546409TransmembraneHelical%3B Signal-anchor for type II membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCEH1chr3:172428637chr11:62327309ENST00000475381-15113_11546409MotifInvolved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole
HgeneNCEH1chr3:172428637chr11:62327309ENST00000543711-14113_115-11276MotifInvolved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole
HgeneNCEH1chr3:172428637chr11:62327309ENST00000475381-1526_40846409Topological domainLumenal
HgeneNCEH1chr3:172428637chr11:62327309ENST00000543711-141_4-11276Topological domainCytoplasmic
HgeneNCEH1chr3:172428637chr11:62327309ENST00000543711-1426_408-11276Topological domainLumenal
HgeneNCEH1chr3:172428637chr11:62327309ENST00000543711-145_25-11276TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneEEF1Gchr3:172428637chr11:62327309ENST00000329251-810276_437385438DomainEF-1-gamma C-terminal
TgeneEEF1Gchr3:172428637chr11:62327309ENST00000329251-8102_87385438DomainNote=GST N-terminal
TgeneEEF1Gchr3:172428637chr11:62327309ENST00000329251-81088_216385438DomainNote=GST C-terminal


Top

FusionGeneSequence for NCEH1_EEF1G


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NCEH1_ENST00000475381_chr3_172428637_-_EEF1G_ENST00000329251_chr11_62327309_-_99aa
MRSSCVLLTALVALAATYVYIPLPGSVSDPWKLMLLDATFRGAQQVLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKA

>In-frame_NCEH1_ENST00000273512_chr3_172428637_-_EEF1G_ENST00000329251_chr11_62327309_-_131aa
MSSCRGQKVAGGLRVVSPFPLCQPAGEPSQGKMRSSCVLLTALVALAATYVYIPLPGSVSDPWKLMLLDATFRGAQQVLSPDWQVDYESY

>In-frame_NCEH1_ENST00000538775_chr3_172428637_-_EEF1G_ENST00000329251_chr11_62327309_-_131aa
MSSCRGQKVAGGLRVVSPFPLCQPAGEPSQGKMRSSCVLLTALVALAATYVYIPLPGSVSDPWKLMLLDATFRGAQQVLSPDWQVDYESY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NCEH1_ENST00000475381_chr3_172428637_-_EEF1G_ENST00000329251_chr11_62327309_-_297nt
ATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTGGCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCCGACCCC
TGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGTGCACAGCAAGTGCTGAGTCCAGATTGGCAGGTGGACTACGAGTCATACACATGG
CGGAAACTGGATCCTGGCAGCGAGGAGACCCAGACGCTGGTTCGAGAGTACTTTTCCTGGGAGGGGGCCTTCCAGCATGTGGGCAAAGCC

>In-frame_NCEH1_ENST00000273512_chr3_172428637_-_EEF1G_ENST00000329251_chr11_62327309_-_393nt
ATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGGGTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAG
GGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTGGCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCC
GACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGTGCACAGCAAGTGCTGAGTCCAGATTGGCAGGTGGACTACGAGTCATAC
ACATGGCGGAAACTGGATCCTGGCAGCGAGGAGACCCAGACGCTGGTTCGAGAGTACTTTTCCTGGGAGGGGGCCTTCCAGCATGTGGGC

>In-frame_NCEH1_ENST00000538775_chr3_172428637_-_EEF1G_ENST00000329251_chr11_62327309_-_393nt
ATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGGGTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAG
GGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTGGCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCC
GACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGTGCACAGCAAGTGCTGAGTCCAGATTGGCAGGTGGACTACGAGTCATAC
ACATGGCGGAAACTGGATCCTGGCAGCGAGGAGACCCAGACGCTGGTTCGAGAGTACTTTTCCTGGGAGGGGGCCTTCCAGCATGTGGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NCEH1_ENST00000475381_chr3_172428637_-_EEF1G_ENST00000329251_chr11_62327309_-_609nt
AGAGCAGCGACAGAGCCTTCCTCAAACCTGTAGTGACTGCCACACTTTGCAAGGACACCGTAGAGGGGGCATGTCCGCGCTCCAACTTCC
TCCCGACGCAGCCTCTGATTGGCTCCTGGGCTTATAAGAAACGCGTGAATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGG
GTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAGGGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTG
GCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCCGACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGT
GCACAGCAAGTGCTGAGTCCAGATTGGCAGGTGGACTACGAGTCATACACATGGCGGAAACTGGATCCTGGCAGCGAGGAGACCCAGACG
CTGGTTCGAGAGTACTTTTCCTGGGAGGGGGCCTTCCAGCATGTGGGCAAAGCCTTCAATCAGGGCAAGATCTTCAAGTGAACATCTCTT

>In-frame_NCEH1_ENST00000273512_chr3_172428637_-_EEF1G_ENST00000329251_chr11_62327309_-_609nt
AGAGCAGCGACAGAGCCTTCCTCAAACCTGTAGTGACTGCCACACTTTGCAAGGACACCGTAGAGGGGGCATGTCCGCGCTCCAACTTCC
TCCCGACGCAGCCTCTGATTGGCTCCTGGGCTTATAAGAAACGCGTGAATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGG
GTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAGGGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTG
GCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCCGACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGT
GCACAGCAAGTGCTGAGTCCAGATTGGCAGGTGGACTACGAGTCATACACATGGCGGAAACTGGATCCTGGCAGCGAGGAGACCCAGACG
CTGGTTCGAGAGTACTTTTCCTGGGAGGGGGCCTTCCAGCATGTGGGCAAAGCCTTCAATCAGGGCAAGATCTTCAAGTGAACATCTCTT

>In-frame_NCEH1_ENST00000538775_chr3_172428637_-_EEF1G_ENST00000329251_chr11_62327309_-_609nt
AGAGCAGCGACAGAGCCTTCCTCAAACCTGTAGTGACTGCCACACTTTGCAAGGACACCGTAGAGGGGGCATGTCCGCGCTCCAACTTCC
TCCCGACGCAGCCTCTGATTGGCTCCTGGGCTTATAAGAAACGCGTGAATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGG
GTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAGGGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTG
GCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCCGACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGT
GCACAGCAAGTGCTGAGTCCAGATTGGCAGGTGGACTACGAGTCATACACATGGCGGAAACTGGATCCTGGCAGCGAGGAGACCCAGACG
CTGGTTCGAGAGTACTTTTCCTGGGAGGGGGCCTTCCAGCATGTGGGCAAAGCCTTCAATCAGGGCAAGATCTTCAAGTGAACATCTCTT


Top

FusionGenePPI for NCEH1_EEF1G


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NCEH1LYPD3, EVI2A, TMEM38A, ZNRF1, SGTB, COQ9, UGT3A2, NRN1, LRRC3, TMEM231, ST3GAL6, CANT1, AMIGO1, ALG9, LMF2, STAM, BTN2A2, GLB1L2, UGT8, POMT1, C1QL1, EIF2AK3, CD1E, ITPRIP, FAM69A, TMTC3, CANX, CD151, GALNT7, CCPG1, ITGA7, FAM177A1, HYAL2, SCARB1, ST6GALNAC3, PGAP1, MTFP1EEF1GEEF1DP3, EEF1D, EEF1B2, ILF2, ABCC9, EEF1G, ADAP2, CHFR, CXCL13, HDAC5, FAM195A, MVD, EFNA1, OGFOD2, FOXG1, C1orf174, NUP85, PLEKHA4, PHACTR3, ARF1, CBX8, CRELD1, DKC1, FEN1, ENOX1, NADK, NCK2, RPS28, SNAPIN, SNRPD2, TP53I3, TRIB3, GET4, MED31, ECH1, RECQL5, GSTO1, HMOX2, KARS, RPL4P5, PDCD5, PSMD11, RGL2, WDR33, ARIH2, CCT7, CDC42, CDK5RAP2, CSTF2, DLEU1, HNRNPH3, CCDC106, PTPN4, PTPRS, SAT1, TUBB3, ZNF24, VARS, LZTS1, CARS, LARS, HARS, EGFR, MYC, UCHL5, SNW1, AGO4, YWHAG, SIRT1, NUDT21, GSK3B, ZBED8, NUDT3, PTK2, TNNT1, AKT1, CDK2AP2, GADD45A, C11orf58, NDRG1, ISG15, CUL3, CUL2, CDK2, CUL1, COPS5, CAND1, NEDD8, GADD45G, GRB2, EEF1A1, RPL5, RPL8, HNRNPA3, SNRPA1, SRSF9, PLOD3, FLNC, STRIP1, SMURF1, YWHAE, FN1, VCAM1, MTNR1A, SKIL, MLH1, PAN2, IGSF8, NPM1, RAD52, ADRB2, FBXO6, TARDBP, TRAP1, CCT3, SHFM1, STAU1, TRIM63, TRIM55, FUS, RBM6, KLHL18, PLGRKT, ZDHHC17, CUL7, OBSL1, CCDC8, EED, SUMO2, SIRT6, ABL1, KTN1, INPPL1, EEF1A2, MKKS, RPS6KB2, HNRNPA1, ATL3, GTF2E1, GTF2E2, NACA, NPM3, PABPC1, RANGAP1, RPL38, IPO4, PRPF38B, NTRK1, ERBB2, EXOSC9, PKN2, SLC33A1, KIF20B, CHMP4B, MCM2, CDC73, WWP2, CDH1, CYLD, DLD, DLST, DNM1L, HSD17B10, PARK7, PDHA1, SDHA, SOAT1, SOD1, VDAC1, TRIM25, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NCEH1_EEF1G


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NCEH1_EEF1G


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource