FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23576

FusionGeneSummary for NCEH1_BCL2L1

check button Fusion gene summary
Fusion gene informationFusion gene name: NCEH1_BCL2L1
Fusion gene ID: 23576
HgeneTgene
Gene symbol

NCEH1

BCL2L1

Gene ID

57552

598

Gene nameneutral cholesterol ester hydrolase 1BCL2 like 1
SynonymsAADACL1|NCEHBCL-XL/S|BCL2L|BCLX|Bcl-X|PPP1R52
Cytomap

3q26.31

20q11.21

Type of geneprotein-codingprotein-coding
Descriptionneutral cholesterol ester hydrolase 1arylacetamide deacetylase-like 1bcl-2-like protein 1apoptosis regulator Bcl-Xprotein phosphatase 1, regulatory subunit 52
Modification date2018052320180527
UniProtAcc

Q6PIU2

Q07817

Ensembl transtripts involved in fusion geneENST00000475381, ENST00000273512, 
ENST00000538775, ENST00000543711, 
ENST00000376062, ENST00000376055, 
ENST00000307677, ENST00000420653, 
Fusion gene scores* DoF score6 X 3 X 6=1085 X 3 X 5=75
# samples 65
** MAII scorelog2(6/108*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NCEH1 [Title/Abstract] AND BCL2L1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneBCL2L1

GO:0001836

release of cytochrome c from mitochondria

9843949

TgeneBCL2L1

GO:0019050

suppression by virus of host apoptotic process

15231831

TgeneBCL2L1

GO:0034097

response to cytokine

9184696

TgeneBCL2L1

GO:0043066

negative regulation of apoptotic process

7650367|9388232

TgeneBCL2L1

GO:0046902

regulation of mitochondrial membrane permeability

9843949

TgeneBCL2L1

GO:0051881

regulation of mitochondrial membrane potential

9843949

TgeneBCL2L1

GO:1900118

negative regulation of execution phase of apoptosis

20673843

TgeneBCL2L1

GO:1902042

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

26582200

TgeneBCL2L1

GO:1902230

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

16608847

TgeneBCL2L1

GO:1903077

negative regulation of protein localization to plasma membrane

21041309

TgeneBCL2L1

GO:2001243

negative regulation of intrinsic apoptotic signaling pathway

12011449


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCESCTCGA-LP-A7HU-01ANCEH1chr3

172428637

-BCL2L1chr20

30253889

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000475381ENST00000376062NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
Frame-shitENST00000475381ENST00000376055NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
Frame-shitENST00000475381ENST00000307677NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
Frame-shitENST00000475381ENST00000420653NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
In-frameENST00000273512ENST00000376062NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
Frame-shitENST00000273512ENST00000376055NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
Frame-shitENST00000273512ENST00000307677NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
Frame-shitENST00000273512ENST00000420653NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
In-frameENST00000538775ENST00000376062NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
Frame-shitENST00000538775ENST00000376055NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
Frame-shitENST00000538775ENST00000307677NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
Frame-shitENST00000538775ENST00000420653NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
5UTR-3CDSENST00000543711ENST00000376062NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
5UTR-3CDSENST00000543711ENST00000376055NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
5UTR-3CDSENST00000543711ENST00000307677NCEH1chr3

172428637

-BCL2L1chr20

30253889

-
5UTR-3CDSENST00000543711ENST00000420653NCEH1chr3

172428637

-BCL2L1chr20

30253889

-

Top

FusionProtFeatures for NCEH1_BCL2L1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NCEH1

Q6PIU2

BCL2L1

Q07817

Potent inhibitor of cell death. Inhibits activation ofcaspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing therelease of the caspase activator, CYC1, from the mitochondrialmembrane. Also acts as a regulator of G2 checkpoint andprogression to cytokinesis during mitosis. Isoform Bcl-X(L) also regulates presynaptic plasticity,including neurotransmitter release and recovery, number of axonalmitochondria as well as size and number of synaptic vesicleclusters. During synaptic stimulation, increases ATP availabilityfrom mitochondria through regulation of mitochondrial membrane ATPsynthase F(1)F(0) activity and regulates endocytic vesicleretrieval in hippocampal neurons through association with DMN1Land stimulation of its GTPase activity in synaptic vesicles. Mayattenuate inflammation impairing NLRP1-inflammasome activation,hence CASP1 activation and IL1B release (PubMed:17418785).{ECO:0000269|PubMed:17418785}. Isoform Bcl-X(S) promotes apoptosis.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCEH1chr3:172428637chr20:30253889ENST00000475381-151_446409Topological domainCytoplasmic
HgeneNCEH1chr3:172428637chr20:30253889ENST00000475381-155_2546409TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376055-13129_148125171MotifNote=BH1
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376055-13180_195125171MotifNote=BH2
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000307677-13210_226188234TransmembraneHelical
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376055-13210_226125171TransmembraneHelical
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376062-02210_226188234TransmembraneHelical
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000420653-13210_226188234TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNCEH1chr3:172428637chr20:30253889ENST00000475381-15113_11546409MotifInvolved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole
HgeneNCEH1chr3:172428637chr20:30253889ENST00000543711-14113_115-11276MotifInvolved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole
HgeneNCEH1chr3:172428637chr20:30253889ENST00000475381-1526_40846409Topological domainLumenal
HgeneNCEH1chr3:172428637chr20:30253889ENST00000543711-141_4-11276Topological domainCytoplasmic
HgeneNCEH1chr3:172428637chr20:30253889ENST00000543711-1426_408-11276Topological domainLumenal
HgeneNCEH1chr3:172428637chr20:30253889ENST00000543711-145_25-11276TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000307677-13129_148188234MotifNote=BH1
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000307677-13180_195188234MotifNote=BH2
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000307677-134_24188234MotifNote=BH4
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000307677-1386_100188234MotifNote=BH3
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376055-134_24125171MotifNote=BH4
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376055-1386_100125171MotifNote=BH3
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376062-02129_148188234MotifNote=BH1
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376062-02180_195188234MotifNote=BH2
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376062-024_24188234MotifNote=BH4
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000376062-0286_100188234MotifNote=BH3
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000420653-13129_148188234MotifNote=BH1
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000420653-13180_195188234MotifNote=BH2
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000420653-134_24188234MotifNote=BH4
TgeneBCL2L1chr3:172428637chr20:30253889ENST00000420653-1386_100188234MotifNote=BH3


Top

FusionGeneSequence for NCEH1_BCL2L1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NCEH1_ENST00000475381_chr3_172428637_-_BCL2L1_ENST00000376062_chr20_30253889_-_92aa
MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSR

>In-frame_NCEH1_ENST00000273512_chr3_172428637_-_BCL2L1_ENST00000376062_chr20_30253889_-_124aa
MSSCRGQKVAGGLRVVSPFPLCQPAGEPSQGKMRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVDTFVELYGNNAA

>In-frame_NCEH1_ENST00000538775_chr3_172428637_-_BCL2L1_ENST00000376062_chr20_30253889_-_124aa
MSSCRGQKVAGGLRVVSPFPLCQPAGEPSQGKMRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVDTFVELYGNNAA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NCEH1_ENST00000475381_chr3_172428637_-_BCL2L1_ENST00000376062_chr20_30253889_-_276nt
ATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTGGCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCCGACCCC
TGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGTGCACAGCAAGTGGATACTTTTGTGGAACTCTATGGGAACAATGCAGCAGCCGAG
AGCCGAAAGGGCCAGGAACGCTTCAACCGCTGGTTCCTGACGGGCATGACTGTGGCCGGCGTGGTTCTGCTGGGCTCACTCTTCAGTCGG

>In-frame_NCEH1_ENST00000273512_chr3_172428637_-_BCL2L1_ENST00000376062_chr20_30253889_-_372nt
ATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGGGTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAG
GGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTGGCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCC
GACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGTGCACAGCAAGTGGATACTTTTGTGGAACTCTATGGGAACAATGCAGCA
GCCGAGAGCCGAAAGGGCCAGGAACGCTTCAACCGCTGGTTCCTGACGGGCATGACTGTGGCCGGCGTGGTTCTGCTGGGCTCACTCTTC

>In-frame_NCEH1_ENST00000538775_chr3_172428637_-_BCL2L1_ENST00000376062_chr20_30253889_-_372nt
ATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGGGTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAG
GGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTGGCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCC
GACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGTGCACAGCAAGTGGATACTTTTGTGGAACTCTATGGGAACAATGCAGCA
GCCGAGAGCCGAAAGGGCCAGGAACGCTTCAACCGCTGGTTCCTGACGGGCATGACTGTGGCCGGCGTGGTTCTGCTGGGCTCACTCTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NCEH1_ENST00000475381_chr3_172428637_-_BCL2L1_ENST00000376062_chr20_30253889_-_2007nt
AGAGCAGCGACAGAGCCTTCCTCAAACCTGTAGTGACTGCCACACTTTGCAAGGACACCGTAGAGGGGGCATGTCCGCGCTCCAACTTCC
TCCCGACGCAGCCTCTGATTGGCTCCTGGGCTTATAAGAAACGCGTGAATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGG
GTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAGGGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTG
GCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCCGACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGT
GCACAGCAAGTGGATACTTTTGTGGAACTCTATGGGAACAATGCAGCAGCCGAGAGCCGAAAGGGCCAGGAACGCTTCAACCGCTGGTTC
CTGACGGGCATGACTGTGGCCGGCGTGGTTCTGCTGGGCTCACTCTTCAGTCGGAAATGACCAGACACTGACCATCCACTCTACCCTCCC
ACCCCCTTCTCTGCTCCACCACATCCTCCGTCCAGCCGCCATTGCCACCAGGAGAACCACTACATGCAGCCCATGCCCACCTGCCCATCA
CAGGGTTGGGCCCAGATCTGGTCCCTTGCAGCTAGTTTTCTAGAATTTATCACACTTCTGTGAGACCCCCACACCTCAGTTCCCTTGGCC
TCAGAATTCACAAAATTTCCACAAAATCTGTCCAAAGGAGGCTGGCAGGTATGGAAGGGTTTGTGGCTGGGGGCAGGAGGGCCCTACCTG
ATTGGTGCAACCCTTACCCCTTAGCCTCCCTGAAAATGTTTTTCTGCCAGGGAGCTTGAAAGTTTTCAGAACCTCTTCCCCAGAAAGGAG
ACTAGATTGCCTTTGTTTTGATGTTTGTGGCCTCAGAATTGATCATTTTCCCCCCACTCTCCCCACACTAACCTGGGTTCCCTTTCCTTC
CATCCCTACCCCCTAAGAGCCATTTAGGGGCCACTTTTGACTAGGGATTCAGGCTGCTTGGGATAAAGATGCAAGGACCAGGACTCCCTC
CTCACCTCTGGACTGGCTAGAGTCCTCACTCCCAGTCCAAATGTCCTCCAGAAGCCTCTGGCTAGAGGCCAGCCCCACCCAGGAGGGAGG
GGGCTATAGCTACAGGAAGCACCCCATGCCAAAGCTAGGGTGGCCCTTGCAGTTCAGCACCACCCTAGTCCCTTCCCCTCCCTGGCTCCC
ATGACCATACTGAGGGACCAACTGGGCCCAAGACAGATGCCCCAGAGCTGTTTATGGCCTCAGCTGCCTCACTTCCTACAAGAGCAGCCT
GTGGCATCTTTGCCTTGGGCTGCTCCTCATGGTGGGTTCAGGGGACTCAGCCCTGAGGTGAAAGGGAGCTATCAGGAACAGCTATGGGAG
CCCCAGGGTCTTCCCTACCTCAGGCAGGAAGGGCAGGAAGGAGAGCCTGCTGCATGGGGTGGGGTAGGGCTGACTAGAAGGGCCAGTCCT
GCCTGGCCAGGCAGATCTGTGCCCCATGCCTGTCCAGCCTGGGCAGCCAGGCTGCCAAGGCCAGAGTGGCCTGGCCAGGAGCTCTTCAGG
CCTCCCTCTCTCTTCTGCTCCACCCTTGGCCTGTCTCATCCCCAGGGGTCCCAGCCACCCCGGGCTCTCTGCTGTACATATTTGAGACTA
GTTTTTATTCCTTGTGAAGATGATATACTATTTTTGTTAAGCGTGTCTGTATTTATGTGTGAGGAGCTGCTGGCTTGCAGTGCGCGTGCA
CGTGGAGAGCTGGTGCCCGGAGATTGGACGGCCTGATGCTCCCTCCCCTGCCCTGGTCCAGGGAAGCTGGCCGAGGGTCCTGGCTCCTGA
GGGGCATCTGCCCCTCCCCCAACCCCCACCCCACACTTGTTCCAGCTCTTTGAAATAGTCTGTGTGAAGGTGAAAGTGCAGTTCAGTAAT

>In-frame_NCEH1_ENST00000273512_chr3_172428637_-_BCL2L1_ENST00000376062_chr20_30253889_-_2007nt
AGAGCAGCGACAGAGCCTTCCTCAAACCTGTAGTGACTGCCACACTTTGCAAGGACACCGTAGAGGGGGCATGTCCGCGCTCCAACTTCC
TCCCGACGCAGCCTCTGATTGGCTCCTGGGCTTATAAGAAACGCGTGAATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGG
GTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAGGGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTG
GCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCCGACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGT
GCACAGCAAGTGGATACTTTTGTGGAACTCTATGGGAACAATGCAGCAGCCGAGAGCCGAAAGGGCCAGGAACGCTTCAACCGCTGGTTC
CTGACGGGCATGACTGTGGCCGGCGTGGTTCTGCTGGGCTCACTCTTCAGTCGGAAATGACCAGACACTGACCATCCACTCTACCCTCCC
ACCCCCTTCTCTGCTCCACCACATCCTCCGTCCAGCCGCCATTGCCACCAGGAGAACCACTACATGCAGCCCATGCCCACCTGCCCATCA
CAGGGTTGGGCCCAGATCTGGTCCCTTGCAGCTAGTTTTCTAGAATTTATCACACTTCTGTGAGACCCCCACACCTCAGTTCCCTTGGCC
TCAGAATTCACAAAATTTCCACAAAATCTGTCCAAAGGAGGCTGGCAGGTATGGAAGGGTTTGTGGCTGGGGGCAGGAGGGCCCTACCTG
ATTGGTGCAACCCTTACCCCTTAGCCTCCCTGAAAATGTTTTTCTGCCAGGGAGCTTGAAAGTTTTCAGAACCTCTTCCCCAGAAAGGAG
ACTAGATTGCCTTTGTTTTGATGTTTGTGGCCTCAGAATTGATCATTTTCCCCCCACTCTCCCCACACTAACCTGGGTTCCCTTTCCTTC
CATCCCTACCCCCTAAGAGCCATTTAGGGGCCACTTTTGACTAGGGATTCAGGCTGCTTGGGATAAAGATGCAAGGACCAGGACTCCCTC
CTCACCTCTGGACTGGCTAGAGTCCTCACTCCCAGTCCAAATGTCCTCCAGAAGCCTCTGGCTAGAGGCCAGCCCCACCCAGGAGGGAGG
GGGCTATAGCTACAGGAAGCACCCCATGCCAAAGCTAGGGTGGCCCTTGCAGTTCAGCACCACCCTAGTCCCTTCCCCTCCCTGGCTCCC
ATGACCATACTGAGGGACCAACTGGGCCCAAGACAGATGCCCCAGAGCTGTTTATGGCCTCAGCTGCCTCACTTCCTACAAGAGCAGCCT
GTGGCATCTTTGCCTTGGGCTGCTCCTCATGGTGGGTTCAGGGGACTCAGCCCTGAGGTGAAAGGGAGCTATCAGGAACAGCTATGGGAG
CCCCAGGGTCTTCCCTACCTCAGGCAGGAAGGGCAGGAAGGAGAGCCTGCTGCATGGGGTGGGGTAGGGCTGACTAGAAGGGCCAGTCCT
GCCTGGCCAGGCAGATCTGTGCCCCATGCCTGTCCAGCCTGGGCAGCCAGGCTGCCAAGGCCAGAGTGGCCTGGCCAGGAGCTCTTCAGG
CCTCCCTCTCTCTTCTGCTCCACCCTTGGCCTGTCTCATCCCCAGGGGTCCCAGCCACCCCGGGCTCTCTGCTGTACATATTTGAGACTA
GTTTTTATTCCTTGTGAAGATGATATACTATTTTTGTTAAGCGTGTCTGTATTTATGTGTGAGGAGCTGCTGGCTTGCAGTGCGCGTGCA
CGTGGAGAGCTGGTGCCCGGAGATTGGACGGCCTGATGCTCCCTCCCCTGCCCTGGTCCAGGGAAGCTGGCCGAGGGTCCTGGCTCCTGA
GGGGCATCTGCCCCTCCCCCAACCCCCACCCCACACTTGTTCCAGCTCTTTGAAATAGTCTGTGTGAAGGTGAAAGTGCAGTTCAGTAAT

>In-frame_NCEH1_ENST00000538775_chr3_172428637_-_BCL2L1_ENST00000376062_chr20_30253889_-_2007nt
AGAGCAGCGACAGAGCCTTCCTCAAACCTGTAGTGACTGCCACACTTTGCAAGGACACCGTAGAGGGGGCATGTCCGCGCTCCAACTTCC
TCCCGACGCAGCCTCTGATTGGCTCCTGGGCTTATAAGAAACGCGTGAATGAGCAGCTGCCGCGGGCAGAAAGTTGCCGGAGGTCTCCGG
GTGGTATCGCCCTTTCCTCTTTGCCAGCCCGCTGGCGAGCCGAGCCAGGGCAAGATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTG
GCGCTGGCCGCCTATTACGTCTACATCCCGCTGCCTGGCTCCGTGTCCGACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTCCGGGGT
GCACAGCAAGTGGATACTTTTGTGGAACTCTATGGGAACAATGCAGCAGCCGAGAGCCGAAAGGGCCAGGAACGCTTCAACCGCTGGTTC
CTGACGGGCATGACTGTGGCCGGCGTGGTTCTGCTGGGCTCACTCTTCAGTCGGAAATGACCAGACACTGACCATCCACTCTACCCTCCC
ACCCCCTTCTCTGCTCCACCACATCCTCCGTCCAGCCGCCATTGCCACCAGGAGAACCACTACATGCAGCCCATGCCCACCTGCCCATCA
CAGGGTTGGGCCCAGATCTGGTCCCTTGCAGCTAGTTTTCTAGAATTTATCACACTTCTGTGAGACCCCCACACCTCAGTTCCCTTGGCC
TCAGAATTCACAAAATTTCCACAAAATCTGTCCAAAGGAGGCTGGCAGGTATGGAAGGGTTTGTGGCTGGGGGCAGGAGGGCCCTACCTG
ATTGGTGCAACCCTTACCCCTTAGCCTCCCTGAAAATGTTTTTCTGCCAGGGAGCTTGAAAGTTTTCAGAACCTCTTCCCCAGAAAGGAG
ACTAGATTGCCTTTGTTTTGATGTTTGTGGCCTCAGAATTGATCATTTTCCCCCCACTCTCCCCACACTAACCTGGGTTCCCTTTCCTTC
CATCCCTACCCCCTAAGAGCCATTTAGGGGCCACTTTTGACTAGGGATTCAGGCTGCTTGGGATAAAGATGCAAGGACCAGGACTCCCTC
CTCACCTCTGGACTGGCTAGAGTCCTCACTCCCAGTCCAAATGTCCTCCAGAAGCCTCTGGCTAGAGGCCAGCCCCACCCAGGAGGGAGG
GGGCTATAGCTACAGGAAGCACCCCATGCCAAAGCTAGGGTGGCCCTTGCAGTTCAGCACCACCCTAGTCCCTTCCCCTCCCTGGCTCCC
ATGACCATACTGAGGGACCAACTGGGCCCAAGACAGATGCCCCAGAGCTGTTTATGGCCTCAGCTGCCTCACTTCCTACAAGAGCAGCCT
GTGGCATCTTTGCCTTGGGCTGCTCCTCATGGTGGGTTCAGGGGACTCAGCCCTGAGGTGAAAGGGAGCTATCAGGAACAGCTATGGGAG
CCCCAGGGTCTTCCCTACCTCAGGCAGGAAGGGCAGGAAGGAGAGCCTGCTGCATGGGGTGGGGTAGGGCTGACTAGAAGGGCCAGTCCT
GCCTGGCCAGGCAGATCTGTGCCCCATGCCTGTCCAGCCTGGGCAGCCAGGCTGCCAAGGCCAGAGTGGCCTGGCCAGGAGCTCTTCAGG
CCTCCCTCTCTCTTCTGCTCCACCCTTGGCCTGTCTCATCCCCAGGGGTCCCAGCCACCCCGGGCTCTCTGCTGTACATATTTGAGACTA
GTTTTTATTCCTTGTGAAGATGATATACTATTTTTGTTAAGCGTGTCTGTATTTATGTGTGAGGAGCTGCTGGCTTGCAGTGCGCGTGCA
CGTGGAGAGCTGGTGCCCGGAGATTGGACGGCCTGATGCTCCCTCCCCTGCCCTGGTCCAGGGAAGCTGGCCGAGGGTCCTGGCTCCTGA
GGGGCATCTGCCCCTCCCCCAACCCCCACCCCACACTTGTTCCAGCTCTTTGAAATAGTCTGTGTGAAGGTGAAAGTGCAGTTCAGTAAT


Top

FusionGenePPI for NCEH1_BCL2L1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NCEH1LYPD3, EVI2A, TMEM38A, ZNRF1, SGTB, COQ9, UGT3A2, NRN1, LRRC3, TMEM231, ST3GAL6, CANT1, AMIGO1, ALG9, LMF2, STAM, BTN2A2, GLB1L2, UGT8, POMT1, C1QL1, EIF2AK3, CD1E, ITPRIP, FAM69A, TMTC3, CANX, CD151, GALNT7, CCPG1, ITGA7, FAM177A1, HYAL2, SCARB1, ST6GALNAC3, PGAP1, MTFP1BCL2L1AVEN, BNIP3, RTN1, RTN4, BIK, BAK1, RAD9A, BID, PMAIP1, BCL2L11, BBC3, BAD, BAX, BCL2, HRK, VDAC1, BNIPL, SPNS1, BCL2L14, PPP1CA, CYCS, RAF1, BECN1, BLK, BCAP31, IRS1, CASP9, APAF1, MOAP1, MCL1, IKZF3, CFLAR, PSEN2, PSEN1, CASP2, CASP8, FKBP8, DYNLL1, BNIP1, PGAM5, BLID, UHRF2, PARK7, ZFYVE1, TP53, METTL23, PPHLN1, ZNF219, EDRF1, PDIA4, GLOD4, RBM5, PLD3, DOCK7, ZHX1, UBR1, FBP1, TLE1, ACTB, TP53BP2, LARP1, PTN, PPP1CC, BFAR, CLU, BMF, CRYAA, CRYAB, ATXN3, AKT1, PARK2, PINK1, TPT1, CDKN2A, CASP1, CASP8AP2, BCL2L1, MTOR, GIMAP5, ABL1, ATG5, PDS5A, HNRNPA1, BNIP3L, CREB3, MAPK8, USP14, MTNR1B, PLK1, MAPK9, GSK3A, GSK3B, MAPKAPK2, MAPK14, CDK1, CHEK1, AURKA, PLK3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NCEH1_BCL2L1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NCEH1_BCL2L1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneBCL2L1C2239176Liver carcinoma2CTD_human
TgeneBCL2L1C0001430Adenoma1CTD_human
TgeneBCL2L1C0010417Cryptorchidism1CTD_human
TgeneBCL2L1C0011853Diabetes Mellitus, Experimental1CTD_human
TgeneBCL2L1C0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
TgeneBCL2L1C0018671Head and Neck Neoplasms1CTD_human
TgeneBCL2L1C0023895Liver diseases1CTD_human
TgeneBCL2L1C0023904Liver Neoplasms, Experimental1CTD_human
TgeneBCL2L1C0024121Lung Neoplasms1CTD_human
TgeneBCL2L1C0026764Multiple Myeloma1CTD_human
TgeneBCL2L1C0027051Myocardial Infarction1CTD_human
TgeneBCL2L1C0030297Pancreatic Neoplasm1CTD_human
TgeneBCL2L1C0038356Stomach Neoplasms1CTD_human
TgeneBCL2L1C0235032Neurotoxicity Syndromes1CTD_human
TgeneBCL2L1C0242350Erectile dysfunction1CTD_human
TgeneBCL2L1C1384666hearing impairment1CTD_human
TgeneBCL2L1C1862939AMYOTROPHIC LATERAL SCLEROSIS 11CTD_human
TgeneBCL2L1C2937358Cerebral Hemorrhage1CTD_human