FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23503

FusionGeneSummary for NBEA_FNDC3A

check button Fusion gene summary
Fusion gene informationFusion gene name: NBEA_FNDC3A
Fusion gene ID: 23503
HgeneTgene
Gene symbol

NBEA

FNDC3A

Gene ID

26960

22862

Gene nameneurobeachinfibronectin type III domain containing 3A
SynonymsBCL8B|LYST2FNDC3|HUGO|bA203I16.1|bA203I16.5
Cytomap

13q13.3

13q14.2

Type of geneprotein-codingprotein-coding
Descriptionneurobeachinlysosomal-trafficking regulator 2fibronectin type-III domain-containing protein 3Ahuman gene expressed in odontoblasts
Modification date2018051920180519
UniProtAcc

Q8NFP9

Q9Y2H6

Ensembl transtripts involved in fusion geneENST00000540320, ENST00000400445, 
ENST00000310336, ENST00000379939, 
ENST00000537702, ENST00000379922, 
ENST00000461581, 
ENST00000492622, 
ENST00000541916, ENST00000398316, 
Fusion gene scores* DoF score7 X 7 X 6=2943 X 3 X 3=27
# samples 73
** MAII scorelog2(7/294*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: NBEA [Title/Abstract] AND FNDC3A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-HS-A5NA-01ANBEAchr13

35806756

+FNDC3Achr13

49688791

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000540320ENST00000492622NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000540320ENST00000541916NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000540320ENST00000398316NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000400445ENST00000492622NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000400445ENST00000541916NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000400445ENST00000398316NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000310336ENST00000492622NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000310336ENST00000541916NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000310336ENST00000398316NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000379939ENST00000492622NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000379939ENST00000541916NBEAchr13

35806756

+FNDC3Achr13

49688791

+
In-frameENST00000379939ENST00000398316NBEAchr13

35806756

+FNDC3Achr13

49688791

+
intron-3CDSENST00000537702ENST00000492622NBEAchr13

35806756

+FNDC3Achr13

49688791

+
intron-3CDSENST00000537702ENST00000541916NBEAchr13

35806756

+FNDC3Achr13

49688791

+
intron-3CDSENST00000537702ENST00000398316NBEAchr13

35806756

+FNDC3Achr13

49688791

+
intron-3CDSENST00000379922ENST00000492622NBEAchr13

35806756

+FNDC3Achr13

49688791

+
intron-3CDSENST00000379922ENST00000541916NBEAchr13

35806756

+FNDC3Achr13

49688791

+
intron-3CDSENST00000379922ENST00000398316NBEAchr13

35806756

+FNDC3Achr13

49688791

+
intron-3CDSENST00000461581ENST00000492622NBEAchr13

35806756

+FNDC3Achr13

49688791

+
intron-3CDSENST00000461581ENST00000541916NBEAchr13

35806756

+FNDC3Achr13

49688791

+
intron-3CDSENST00000461581ENST00000398316NBEAchr13

35806756

+FNDC3Achr13

49688791

+

Top

FusionProtFeatures for NBEA_FNDC3A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NBEA

Q8NFP9

FNDC3A

Q9Y2H6

Binds to type II regulatory subunits of protein kinase Aand anchors/targets them to the membrane. May anchor the kinase tocytoskeletal and/or organelle-associated proteins (By similarity).{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNBEAchr13:35806756chr13:49688791ENST00000400445+34581326_136819252947RepeatWD 1
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+02468_13321143Compositional biasNote=Pro-rich
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+22668_133581199Compositional biasNote=Pro-rich
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+22668_133581199Compositional biasNote=Pro-rich
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+0241046_115121143DomainFibronectin type-III 9
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+024268_36921143DomainFibronectin type-III 1
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+024373_46521143DomainFibronectin type-III 2
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+024469_56221143DomainFibronectin type-III 3
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+024566_66021143DomainFibronectin type-III 4
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+024664_75721143DomainFibronectin type-III 5
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+024761_85121143DomainFibronectin type-III 6
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+024861_95021143DomainFibronectin type-III 7
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+024951_104521143DomainFibronectin type-III 8
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+2261046_1151581199DomainFibronectin type-III 9
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+226268_369581199DomainFibronectin type-III 1
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+226373_465581199DomainFibronectin type-III 2
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+226469_562581199DomainFibronectin type-III 3
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+226566_660581199DomainFibronectin type-III 4
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+226664_757581199DomainFibronectin type-III 5
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+226761_851581199DomainFibronectin type-III 6
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+226861_950581199DomainFibronectin type-III 7
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+226951_1045581199DomainFibronectin type-III 8
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+2261046_1151581199DomainFibronectin type-III 9
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+226268_369581199DomainFibronectin type-III 1
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+226373_465581199DomainFibronectin type-III 2
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+226469_562581199DomainFibronectin type-III 3
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+226566_660581199DomainFibronectin type-III 4
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+226664_757581199DomainFibronectin type-III 5
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+226761_851581199DomainFibronectin type-III 6
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+226861_950581199DomainFibronectin type-III 7
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+226951_1045581199DomainFibronectin type-III 8
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000398316+0241177_119721143TransmembraneHelical
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000492622+2261177_1197581199TransmembraneHelical
TgeneFNDC3Achr13:35806756chr13:49688791ENST00000541916+2261177_1197581199TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNBEAchr13:35806756chr13:49688791ENST00000379922+1132147_2255-159525DomainBEACH-type PH
HgeneNBEAchr13:35806756chr13:49688791ENST00000379922+1132274_2563-159525DomainBEACH
HgeneNBEAchr13:35806756chr13:49688791ENST00000400445+34582147_225519252947DomainBEACH-type PH
HgeneNBEAchr13:35806756chr13:49688791ENST00000400445+34582274_256319252947DomainBEACH
HgeneNBEAchr13:35806756chr13:49688791ENST00000537702+1182147_2255-42740DomainBEACH-type PH
HgeneNBEAchr13:35806756chr13:49688791ENST00000537702+1182274_2563-42740DomainBEACH
HgeneNBEAchr13:35806756chr13:49688791ENST00000379922+1131326_1368-159525RepeatWD 1
HgeneNBEAchr13:35806756chr13:49688791ENST00000379922+1132718_2761-159525RepeatWD 2
HgeneNBEAchr13:35806756chr13:49688791ENST00000379922+1132778_2818-159525RepeatWD 3
HgeneNBEAchr13:35806756chr13:49688791ENST00000379922+1132860_2899-159525RepeatWD 4
HgeneNBEAchr13:35806756chr13:49688791ENST00000379922+1132902_2941-159525RepeatWD 5
HgeneNBEAchr13:35806756chr13:49688791ENST00000400445+34582718_276119252947RepeatWD 2
HgeneNBEAchr13:35806756chr13:49688791ENST00000400445+34582778_281819252947RepeatWD 3
HgeneNBEAchr13:35806756chr13:49688791ENST00000400445+34582860_289919252947RepeatWD 4
HgeneNBEAchr13:35806756chr13:49688791ENST00000400445+34582902_294119252947RepeatWD 5
HgeneNBEAchr13:35806756chr13:49688791ENST00000537702+1181326_1368-42740RepeatWD 1
HgeneNBEAchr13:35806756chr13:49688791ENST00000537702+1182718_2761-42740RepeatWD 2
HgeneNBEAchr13:35806756chr13:49688791ENST00000537702+1182778_2818-42740RepeatWD 3
HgeneNBEAchr13:35806756chr13:49688791ENST00000537702+1182860_2899-42740RepeatWD 4
HgeneNBEAchr13:35806756chr13:49688791ENST00000537702+1182902_2941-42740RepeatWD 5


Top

FusionGeneSequence for NBEA_FNDC3A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NBEA_ENST00000540320_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_3066aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTVSKTELENIEVTQGMSAETAVTFLSRLMA
MVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSE
VKKSQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPP
GSLAVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHR
SPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSS
PPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLI
NGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRT
KNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASP
VLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDK
PGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESL
LVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGF
GPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALS
VVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTT
YRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRL
NESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSF
RYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQ

>In-frame_NBEA_ENST00000540320_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_3066aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTVSKTELENIEVTQGMSAETAVTFLSRLMA
MVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSE
VKKSQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPP
GSLAVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHR
SPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSS
PPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLI
NGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRT
KNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASP
VLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDK
PGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESL
LVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGF
GPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALS
VVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTT
YRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRL
NESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSF
RYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQ

>In-frame_NBEA_ENST00000540320_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_3066aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTVSKTELENIEVTQGMSAETAVTFLSRLMA
MVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSE
VKKSQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPP
GSLAVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHR
SPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSS
PPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLI
NGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRT
KNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASP
VLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDK
PGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESL
LVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGF
GPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALS
VVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTT
YRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRL
NESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSF
RYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQ

>In-frame_NBEA_ENST00000400445_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_3066aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTGSKTELENIEVTQGMSAETAVTFLSRLMA
MVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSE
VKKSQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPP
GSLAVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHR
SPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSS
PPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLI
NGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRT
KNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASP
VLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDK
PGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESL
LVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGF
GPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALS
VVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTT
YRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRL
NESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSF
RYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQ

>In-frame_NBEA_ENST00000400445_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_3066aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTGSKTELENIEVTQGMSAETAVTFLSRLMA
MVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSE
VKKSQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPP
GSLAVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHR
SPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSS
PPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLI
NGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRT
KNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASP
VLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDK
PGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESL
LVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGF
GPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALS
VVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTT
YRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRL
NESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSF
RYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQ

>In-frame_NBEA_ENST00000400445_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_3066aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTGSKTELENIEVTQGMSAETAVTFLSRLMA
MVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSE
VKKSQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPP
GSLAVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHR
SPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSS
PPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLI
NGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRT
KNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASP
VLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDK
PGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESL
LVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGF
GPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALS
VVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTT
YRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRL
NESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSF
RYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQ

>In-frame_NBEA_ENST00000310336_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_3066aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTVSKTELENIEVTQGMSAETAVTFLSRLMA
MVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSE
VKKSQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPP
GSLAVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHR
SPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSS
PPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLI
NGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRT
KNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASP
VLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDK
PGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESL
LVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGF
GPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALS
VVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTT
YRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRL
NESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSF
RYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQ

>In-frame_NBEA_ENST00000310336_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_3066aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTVSKTELENIEVTQGMSAETAVTFLSRLMA
MVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSE
VKKSQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPP
GSLAVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHR
SPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSS
PPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLI
NGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRT
KNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASP
VLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDK
PGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESL
LVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGF
GPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALS
VVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTT
YRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRL
NESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSF
RYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQ

>In-frame_NBEA_ENST00000310336_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_3066aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTVSKTELENIEVTQGMSAETAVTFLSRLMA
MVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSE
VKKSQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPP
GSLAVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHR
SPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSS
PPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLI
NGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRT
KNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASP
VLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDK
PGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESL
LVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGF
GPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALS
VVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTT
YRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRL
NESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSF
RYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQ

>In-frame_NBEA_ENST00000379939_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_3063aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTTELENIEVTQGMSAETAVTFLSRLMAMVD
VLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSPIKD
PDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHPSLN
HGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSEVKK
SQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPPGSL
AVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLERALE
KVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHRSPH
PPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSSPPS
SPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLINGE
TDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRTKNS
LTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASPVLT
KAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDKPGI
PVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQ
TPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGFGPF
SEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVG
AGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTTYRI
RIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRLNES
TSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSFRYS
SLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQYFV

>In-frame_NBEA_ENST00000379939_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_3063aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTTELENIEVTQGMSAETAVTFLSRLMAMVD
VLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSPIKD
PDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHPSLN
HGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSEVKK
SQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPPGSL
AVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLERALE
KVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHRSPH
PPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSSPPS
SPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLINGE
TDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRTKNS
LTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASPVLT
KAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDKPGI
PVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQ
TPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGFGPF
SEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVG
AGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTTYRI
RIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRLNES
TSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSFRYS
SLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQYFV

>In-frame_NBEA_ENST00000379939_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_3063aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTTELENIEVTQGMSAETAVTFLSRLMAMVD
VLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEVPQSVTATAASKTPLENVPGNLSPIKD
PDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHPSLN
HGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSELLSTLSSEVKK
SQESLTENPSETLKPATSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKRETQAILPMQFHSFDRSVVVPVKKPPPGSL
AVTTVGATTAGSGLPTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLERALE
KVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGPAQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHRSPH
PPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSSPPS
SPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLINGE
TDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRTKNS
LTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASPVLT
KAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDKPGI
PVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQ
TPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGFGPF
SEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVG
AGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKVTSYIINNLQPDTTYRI
RIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRLNES
TSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSFRYS
SLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQYFV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NBEA_ENST00000540320_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_9198nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTGTAAGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCT
ATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAG
TGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGA
AGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCT
ATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCA
CAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACA
AGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCA
AGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGAC
ACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAG
CAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAA
GTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGC
ATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCA
GCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCA
GGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGA
GCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCT
ACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGA
GCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAA
GAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCA
CAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGT
TCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCT
GGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAAC
TTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGT
CCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGA
TCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAA
GCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATT
AATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGT
GTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCT
ATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACC
AAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGA
AATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTA
TCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCT
GTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTA
GAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGT
ACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAA
CCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGA
GCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACAT
CTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTA
CTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGG
GGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTAC
CAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTT
GGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACT
TGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATG
CAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGT
GTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGC
GATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTT
GCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACA
TACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGAT
CCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCT
ATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTT
AATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCA
AAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATG
AAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTC
CGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTC
GTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGG
ACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAG

>In-frame_NBEA_ENST00000540320_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_9198nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTGTAAGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCT
ATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAG
TGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGA
AGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCT
ATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCA
CAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACA
AGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCA
AGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGAC
ACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAG
CAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAA
GTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGC
ATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCA
GCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCA
GGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGA
GCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCT
ACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGA
GCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAA
GAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCA
CAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGT
TCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCT
GGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAAC
TTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGT
CCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGA
TCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAA
GCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATT
AATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGT
GTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCT
ATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACC
AAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGA
AATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTA
TCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCT
GTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTA
GAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGT
ACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAA
CCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGA
GCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACAT
CTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTA
CTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGG
GGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTAC
CAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTT
GGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACT
TGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATG
CAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGT
GTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGC
GATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTT
GCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACA
TACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGAT
CCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCT
ATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTT
AATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCA
AAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATG
AAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTC
CGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTC
GTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGG
ACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAG

>In-frame_NBEA_ENST00000540320_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_9198nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTGTAAGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCT
ATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAG
TGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGA
AGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCT
ATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCA
CAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACA
AGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCA
AGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGAC
ACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAG
CAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAA
GTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGC
ATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCA
GCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCA
GGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGA
GCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCT
ACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGA
GCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAA
GAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCA
CAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGT
TCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCT
GGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAAC
TTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGT
CCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGA
TCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAA
GCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATT
AATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGT
GTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCT
ATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACC
AAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGA
AATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTA
TCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCT
GTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTA
GAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGT
ACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAA
CCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGA
GCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACAT
CTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTA
CTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGG
GGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTAC
CAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTT
GGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACT
TGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATG
CAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGT
GTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGC
GATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTT
GCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACA
TACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGAT
CCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCT
ATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTT
AATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCA
AAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATG
AAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTC
CGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTC
GTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGG
ACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAG

>In-frame_NBEA_ENST00000400445_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_9198nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTGGTTCTAAGACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCT
ATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAG
TGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGA
AGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCT
ATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCA
CAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACA
AGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCA
AGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGAC
ACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAG
CAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAA
GTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGC
ATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCA
GCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCA
GGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGA
GCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCT
ACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGA
GCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAA
GAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCA
CAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGT
TCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCT
GGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAAC
TTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGT
CCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGA
TCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAA
GCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATT
AATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGT
GTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCT
ATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACC
AAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGA
AATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTA
TCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCT
GTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTA
GAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGT
ACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAA
CCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGA
GCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACAT
CTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTA
CTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGG
GGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTAC
CAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTT
GGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACT
TGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATG
CAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGT
GTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGC
GATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTT
GCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACA
TACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGAT
CCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCT
ATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTT
AATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCA
AAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATG
AAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTC
CGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTC
GTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGG
ACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAG

>In-frame_NBEA_ENST00000400445_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_9198nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTGGTTCTAAGACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCT
ATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAG
TGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGA
AGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCT
ATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCA
CAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACA
AGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCA
AGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGAC
ACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAG
CAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAA
GTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGC
ATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCA
GCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCA
GGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGA
GCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCT
ACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGA
GCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAA
GAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCA
CAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGT
TCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCT
GGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAAC
TTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGT
CCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGA
TCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAA
GCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATT
AATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGT
GTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCT
ATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACC
AAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGA
AATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTA
TCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCT
GTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTA
GAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGT
ACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAA
CCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGA
GCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACAT
CTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTA
CTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGG
GGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTAC
CAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTT
GGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACT
TGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATG
CAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGT
GTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGC
GATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTT
GCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACA
TACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGAT
CCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCT
ATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTT
AATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCA
AAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATG
AAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTC
CGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTC
GTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGG
ACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAG

>In-frame_NBEA_ENST00000400445_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_9198nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTGGTTCTAAGACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCT
ATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAG
TGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGA
AGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCT
ATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCA
CAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACA
AGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCA
AGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGAC
ACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAG
CAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAA
GTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGC
ATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCA
GCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCA
GGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGA
GCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCT
ACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGA
GCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAA
GAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCA
CAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGT
TCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCT
GGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAAC
TTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGT
CCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGA
TCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAA
GCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATT
AATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGT
GTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCT
ATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACC
AAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGA
AATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTA
TCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCT
GTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTA
GAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGT
ACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAA
CCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGA
GCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACAT
CTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTA
CTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGG
GGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTAC
CAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTT
GGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACT
TGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATG
CAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGT
GTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGC
GATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTT
GCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACA
TACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGAT
CCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCT
ATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTT
AATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCA
AAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATG
AAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTC
CGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTC
GTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGG
ACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAG

>In-frame_NBEA_ENST00000310336_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_9198nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTGTAAGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCT
ATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAG
TGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGA
AGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCT
ATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCA
CAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACA
AGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCA
AGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGAC
ACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAG
CAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAA
GTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGC
ATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCA
GCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCA
GGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGA
GCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCT
ACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGA
GCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAA
GAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCA
CAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGT
TCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCT
GGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAAC
TTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGT
CCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGA
TCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAA
GCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATT
AATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGT
GTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCT
ATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACC
AAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGA
AATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTA
TCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCT
GTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTA
GAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGT
ACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAA
CCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGA
GCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACAT
CTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTA
CTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGG
GGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTAC
CAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTT
GGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACT
TGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATG
CAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGT
GTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGC
GATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTT
GCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACA
TACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGAT
CCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCT
ATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTT
AATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCA
AAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATG
AAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTC
CGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTC
GTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGG
ACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAG

>In-frame_NBEA_ENST00000310336_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_9198nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTGTAAGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCT
ATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAG
TGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGA
AGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCT
ATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCA
CAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACA
AGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCA
AGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGAC
ACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAG
CAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAA
GTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGC
ATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCA
GCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCA
GGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGA
GCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCT
ACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGA
GCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAA
GAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCA
CAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGT
TCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCT
GGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAAC
TTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGT
CCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGA
TCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAA
GCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATT
AATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGT
GTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCT
ATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACC
AAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGA
AATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTA
TCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCT
GTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTA
GAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGT
ACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAA
CCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGA
GCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACAT
CTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTA
CTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGG
GGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTAC
CAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTT
GGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACT
TGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATG
CAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGT
GTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGC
GATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTT
GCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACA
TACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGAT
CCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCT
ATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTT
AATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCA
AAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATG
AAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTC
CGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTC
GTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGG
ACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAG

>In-frame_NBEA_ENST00000310336_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_9198nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTGTAAGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCT
ATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAG
TGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGA
AGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCT
ATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCA
CAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACA
AGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCA
AGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGAC
ACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAG
CAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAA
GTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGC
ATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCA
GCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCA
GGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGA
GCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCT
ACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGA
GCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAA
GAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCA
CAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGT
TCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCT
GGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAAC
TTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGT
CCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGA
TCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAA
GCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATT
AATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGT
GTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCT
ATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACC
AAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGA
AATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTA
TCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCT
GTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTA
GAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGT
ACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAA
CCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGA
GCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACAT
CTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTA
CTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGG
GGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTAC
CAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTT
GGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACT
TGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATG
CAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGT
GTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGC
GATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTT
GCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACA
TACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGAT
CCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCT
ATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTT
AATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCA
AAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATG
AAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTC
CGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTC
GTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGG
ACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAG

>In-frame_NBEA_ENST00000379939_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_9189nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTTGAT
GTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTAAGA
TTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGTAAA
CCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAGGAT
CCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTCTTA
GCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACTGGA
AGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTGAAC
CATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATAAAA
GAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTGGCT
AGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAGAAA
TCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAATGTG
AAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTGAAG
AGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGTTTA
GCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACACCA
AAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGCAAA
AACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTAGAA
AAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTATTG
ATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTTATT
GAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCACAT
CCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGACATG
ACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGAGAT
GAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCATCA
TCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCAAAA
ATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTTCTT
TCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGTGAA
ACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATATGTA
GGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAGGGA
ACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAATTCA
CTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGAGAA
TTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCCAGA
AATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTAACC
AAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATGGAG
GAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAGTAT
AAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGCATA
CCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACCATC
AATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGTGAT
CGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTGCAG
ACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCCCCT
CTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGTTCT
GAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCATTT
TCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCACAA
GTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATATGT
TACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTGGGT
GCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGATGAG
ATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTACAGC
ATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGAATA
CGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCTCGT
CTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAGTAC
CACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAGTCA
ACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCTGTC
CCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGTGAT
CCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTATTCC
AGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGTCCC
TACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGACGG
GCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTTGTA

>In-frame_NBEA_ENST00000379939_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_9189nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTTGAT
GTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTAAGA
TTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGTAAA
CCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAGGAT
CCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTCTTA
GCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACTGGA
AGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTGAAC
CATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATAAAA
GAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTGGCT
AGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAGAAA
TCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAATGTG
AAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTGAAG
AGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGTTTA
GCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACACCA
AAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGCAAA
AACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTAGAA
AAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTATTG
ATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTTATT
GAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCACAT
CCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGACATG
ACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGAGAT
GAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCATCA
TCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCAAAA
ATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTTCTT
TCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGTGAA
ACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATATGTA
GGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAGGGA
ACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAATTCA
CTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGAGAA
TTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCCAGA
AATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTAACC
AAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATGGAG
GAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAGTAT
AAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGCATA
CCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACCATC
AATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGTGAT
CGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTGCAG
ACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCCCCT
CTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGTTCT
GAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCATTT
TCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCACAA
GTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATATGT
TACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTGGGT
GCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGATGAG
ATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTACAGC
ATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGAATA
CGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCTCGT
CTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAGTAC
CACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAGTCA
ACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCTGTC
CCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGTGAT
CCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTATTCC
AGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGTCCC
TACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGACGG
GCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTTGTA

>In-frame_NBEA_ENST00000379939_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_9189nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGT
ATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAAT
TTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGAT
ATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCA
AGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCT
GCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAAT
ATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTA
ATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATT
GTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTT
AACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTG
TATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCT
GAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAG
GCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGAT
GTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGAT
AATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCC
ATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTC
CTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTT
AACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATC
TACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGT
GGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAG
CTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCAT
GATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATC
TACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGA
AAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATAC
AACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAG
AATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCT
GATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGC
TATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATAT
GAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAA
ATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAG
ACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTC
AGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTG
GAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACT
TTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAAT
GTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCC
AATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAAT
ATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCC
AGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAG
GGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATA
ATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAG
GGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTT
AGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCA
TTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACAT
AACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCA
ACTACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTTGAT
GTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTAAGA
TTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGTAAA
CCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAGGAT
CCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTCTTA
GCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACTGGA
AGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTGAAC
CATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATAAAA
GAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTGGCT
AGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAGAAA
TCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAATGTG
AAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTGAAG
AGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGTTTA
GCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACACCA
AAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGCAAA
AACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTAGAA
AAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTATTG
ATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTTATT
GAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCACAT
CCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGACATG
ACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGAGAT
GAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCATCA
TCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCAAAA
ATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTTCTT
TCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGTGAA
ACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATATGTA
GGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAGGGA
ACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAATTCA
CTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGAGAA
TTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCCAGA
AATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTAACC
AAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATGGAG
GAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAGTAT
AAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGCATA
CCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACCATC
AATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGTGAT
CGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTGCAG
ACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCCCCT
CTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGTTCT
GAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCATTT
TCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCACAA
GTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATATGT
TACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTGGGT
GCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGATGAG
ATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTACAGC
ATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGAATA
CGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCTCGT
CTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAGTAC
CACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAGTCA
ACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCTGTC
CCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGTGAT
CCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTATTCC
AGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGTCCC
TACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGACGG
GCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTTGTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NBEA_ENST00000540320_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_12116nt
AGGCAGGGGGCGGCAACATGGCGGAGTGAGCGGCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCGGCAGCAGCGTCA
ATAGCATCGGCCACAGCCTGAGCTTCAGCACCGGCCAGCGTCGTGGCCAGCTGCTCGCGTCCTCGGGCTTCTCGGAGCGGCTGCAGCATC
TCCGCGGGGGGCGGGCCGGGCCGGACAGACCGGGAGAGGGAGAGAGCAGAGGCAGCGGCGGCGGCAGCGGCAGCGGCAGCGGCACACCTG
CTGGGCGGGCACAGCCGCTTGCCCGGCAGCGGTTAGCGGTACCGCCACCGCCGAGAATAAGCCTGCGGATCCCCCGCCGCCTCCGCGGGG
GAGAGCGCCGGAGCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGG
CCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCT
AGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGC
GGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAAC
CCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTG
GAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGTATGACA
GAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAATTTACAG
ACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGATATGTTG
GGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCAAGACAT
GCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCTGCGGCA
ATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAATATTAAT
GTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTAATAGTC
ACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATTGTCCAC
ATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTTAACACA
AATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTGTATGTG
TTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCTGAGAGT
GATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAGGCCACT
GATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGATGTGAAA
GCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGATAATAGG
CAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCCATGCAA
GAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTCCTGGAG
CAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTTAACCCA
GCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATCTACACC
ACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGTGGCATT
ACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAGCTGATA
CTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCATGATGTG
CTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATCTACAAA
TTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGAAAAGTT
GAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATACAACACA
CTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAGAATCCA
ATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCTGATATG
ATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGCTATATC
AATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATATGAATGG
GGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAAATGTAT
GAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAGACAACA
GGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTCAGCACA
GATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTGGAAGTA
CATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACTTTAGTA
GGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAATGTACAT
GGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCCAATAGT
AGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAATATTCAG
GACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCCAGTATA
ATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAGGGGCTG
GAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATAATTTCA
GATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAGGGTCGG
TCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTTAGCCCA
GGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCATTAGAA
ACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACATAACACA
ATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCAACTGTA
AGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTT
GATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTA
AGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGT
AAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAG
GATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTC
TTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACT
GGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTG
AACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATA
AAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTG
GCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAG
AAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAAT
GTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTG
AAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGT
TTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACA
CCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGC
AAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTA
GAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTA
TTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTT
ATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCA
CATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGAC
ATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGA
GATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCA
TCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCA
AAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTT
CTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGT
GAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATAT
GTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAG
GGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAAT
TCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGA
GAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCC
AGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTA
ACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATG
GAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAG
TATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGC
ATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACC
ATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGT
GATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTG
CAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCC
CCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGT
TCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCA
TTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCA
CAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATA
TGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTG
GGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGAT
GAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTAC
AGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGA
ATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCT
CGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAG
TACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAG
TCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCT
GTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGT
GATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTAT
TCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGT
CCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGA
CGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTT
GTAATCAAGTGAAAATATAACTTTATTTTTTAACTCTATTACATTTTATTTTGTCATGTACTAAAATTATTTCTGTATTGCTTTTATAAA
AAACAGTGGCATTTAGCACTGGCATTGAGACTATAGCACATCATTTTTGCCATTTTCAGTGCTTATATTGTTAGGTAGAGGCTGGCACTT
TATTAGAATGCAAGCCACAAAAATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTCTTTTTTTCTTTCCCTCTCTCTTTTTTTAACAA
ATGCCTTCTTATAGAAAAACTTTCTAAGAGGCAACAATTTAGAATGGATATTTTGACGAATCGGCATGAGTGTAACAGTGATAACCTGAT
CTGTTTGTTTTAAAGATTATTACCAAGTGAAAAATTCAGAATGAATAGAATTTACACTAACATGCTATATAAAATGTTAAAGTCTGATGC
TGTGAAAGCAATCTAGTGCTATATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAAGTGGGATTATGATGAGTAACTGGAGGGGCTTA
GAAACAAAAACTGGATGAAAGAGTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGAGTTCTTCATTATAAATATATATTCATGAATTC
ACAGATAAGTACTTAAAGAACAGACAGTTTACTTGGCCTAAAAATATTTTGATGTTTACTCAAAAAGTACCTCTTCAGGTCTTGAGAACA
TGGAAAAGAATTGAGTGCTTTTAAATACTTTTTAGAAAGTAATCATAAAAGTAAATTGAATTTCAAACCTATTTGGCTTCTGTTTTGTGA
ACCTTTGAACTATATGTATGTGTATAAGGGTATACACATACATATATGGCATATAACAAGTGTACACATATACACATAACAAGTGTAGAA
GTATATATTACATACATACACTCACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCCCATAAGTTTCTGCTGCTTCTCCCATAACTGCT
GCCACCACCATCAGAATTCATAATCAAACCTAACCTTTTTGTTTGGGGCACCAAATCTGAAGACAAAATTAATTTGCACCAGTAAACTTC
AAGCTGCTTTCTTTCTTGAAAACTAAACGTTTAACGTATAATGTCTGTTTGGATACTGTTCCAAATTGTTGATTGCATGTGGTTAATGTT
GCATTAGAGCACTTTGCAATTGCATAATTCATTAATGTTTTGTGAGCTTGCATTTGTGAGTTATTGGATGATCAGACTGAATTTTGTCAA
GTATCACATTGTACATCTTGCCTAGATGTCGATGACTGCAAGTAATAATACAGTTTATAATGAAACTATCTACAATTCTTGTTTTAGCAC
ATCTGTTATCCGTAAAACACCTGTAACTAGCTTTTTTAATTTATTATTTGAATTTTAGGATAGCGAATCACTAATTTTTAGTTGCTGAGG
TTGGCATTTTAGTGATTATTAAGCACTTCTGTCAGTCTTTGAAAAAAGAACGTATTTTTTGTGCTTTGAAGATCTCTGAAGAATTTCTTT
TATAATAGAATGGGCATGTATTGTAACAGTTTTATGTCAAATGATCTGTGCTGTAGAAAAACATTAACCCTTGTTCAAAAAAGAAATGGA
TAAACTTGGCCTTTCTAAGTGGTAAGAATGACCTGTCACTATAATATACTGTATGTTTACATTTTATTTAAATTTAATCTCTTATGTATA
GGGTGATAACCTTCCCCAGAAACAACAGTGATTGCGATTGTTTTCTAGAAACTTCTTTAAAGTGCCACATTTGGCAGTACAAATGAGTCT
GAGTGTAATAGCCCAGAGATTTATATATAGTTGAATGTCTAAAATGGTAAAATGTGCCACTGTGTCAAGTTACAGTGGCTTATGTTTTTC
ATAGTAATTCAAATGAACTTCCTATTTTTGATAGTAAATGTCATTTAATAGTATACTTGCCATTTGAGCCTCACTGCAAAATTAGTGCAG
AGGAGAAAACAATTTTTAATGTAATCTTGATTTTACCTCATATACTGTACATTCCAAAAACTCTAAACTTTTTAAAGATTATAGATACAC
TACCAAACATATCACCTTAAAATTGTATAAGGCTGAATGAACTTCATACAAATGAAAAAAATCTCATAAAAATACATAAACTATGTAGCA
AAAGTATCTGTAAAATCCATGGAAAATAAAAGTTGTATCATTCTTTTTGAGATACGTTTATTGTATTCATATATATTCATTATTTGCTAC
CTGTTTAAGAAAGTGAAATGTTATGGTCTCCCCTCTTCCAATGAGCTTAAAACATTTTTCCCAACAGTATATAAATCTTCAACATGAGAG

>In-frame_NBEA_ENST00000540320_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_10711nt
AGGCAGGGGGCGGCAACATGGCGGAGTGAGCGGCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCGGCAGCAGCGTCA
ATAGCATCGGCCACAGCCTGAGCTTCAGCACCGGCCAGCGTCGTGGCCAGCTGCTCGCGTCCTCGGGCTTCTCGGAGCGGCTGCAGCATC
TCCGCGGGGGGCGGGCCGGGCCGGACAGACCGGGAGAGGGAGAGAGCAGAGGCAGCGGCGGCGGCAGCGGCAGCGGCAGCGGCACACCTG
CTGGGCGGGCACAGCCGCTTGCCCGGCAGCGGTTAGCGGTACCGCCACCGCCGAGAATAAGCCTGCGGATCCCCCGCCGCCTCCGCGGGG
GAGAGCGCCGGAGCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGG
CCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCT
AGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGC
GGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAAC
CCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTG
GAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGTATGACA
GAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAATTTACAG
ACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGATATGTTG
GGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCAAGACAT
GCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCTGCGGCA
ATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAATATTAAT
GTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTAATAGTC
ACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATTGTCCAC
ATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTTAACACA
AATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTGTATGTG
TTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCTGAGAGT
GATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAGGCCACT
GATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGATGTGAAA
GCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGATAATAGG
CAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCCATGCAA
GAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTCCTGGAG
CAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTTAACCCA
GCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATCTACACC
ACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGTGGCATT
ACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAGCTGATA
CTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCATGATGTG
CTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATCTACAAA
TTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGAAAAGTT
GAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATACAACACA
CTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAGAATCCA
ATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCTGATATG
ATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGCTATATC
AATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATATGAATGG
GGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAAATGTAT
GAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAGACAACA
GGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTCAGCACA
GATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTGGAAGTA
CATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACTTTAGTA
GGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAATGTACAT
GGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCCAATAGT
AGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAATATTCAG
GACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCCAGTATA
ATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAGGGGCTG
GAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATAATTTCA
GATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAGGGTCGG
TCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTTAGCCCA
GGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCATTAGAA
ACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACATAACACA
ATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCAACTGTA
AGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTT
GATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTA
AGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGT
AAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAG
GATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTC
TTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACT
GGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTG
AACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATA
AAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTG
GCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAG
AAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAAT
GTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTG
AAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGT
TTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACA
CCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGC
AAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTA
GAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTA
TTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTT
ATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCA
CATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGAC
ATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGA
GATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCA
TCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCA
AAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTT
CTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGT
GAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATAT
GTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAG
GGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAAT
TCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGA
GAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCC
AGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTA
ACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATG
GAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAG
TATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGC
ATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACC
ATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGT
GATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTG
CAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCC
CCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGT
TCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCA
TTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCA
CAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATA
TGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTG
GGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGAT
GAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTAC
AGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGA
ATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCT
CGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAG
TACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAG
TCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCT
GTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGT
GATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTAT
TCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGT
CCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGA
CGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTT
GTAATCAAGTGAAAATATAACTTTATTTTTTAACTCTATTACATTTTATTTTGTCATGTACTAAAATTATTTCTGTATTGCTTTTATAAA
AAACAGTGGCATTTAGCACTGGCATTGAGACTATAGCACATCATTTTTGCCATTTTCAGTGCTTATATTGTTAGGTAGAGGCTGGCACTT
TATTAGAATGCAAGCCACAAAAATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTCTTTTTTTCTTTCCCTCTCTCTTTTTTTAACAA
ATGCCTTCTTATAGAAAAACTTTCTAAGAGGCAACAATTTAGAATGGATATTTTGACGAATCGGCATGAGTGTAACAGTGATAACCTGAT
CTGTTTGTTTTAAAGATTATTACCAAGTGAAAAATTCAGAATGAATAGAATTTACACTAACATGCTATATAAAATGTTAAAGTCTGATGC
TGTGAAAGCAATCTAGTGCTATATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAAGTGGGATTATGATGAGTAACTGGAGGGGCTTA
GAAACAAAAACTGGATGAAAGAGTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGAGTTCTTCATTATAAATATATATTCATGAATTC
ACAGATAAGTACTTAAAGAACAGACAGTTTACTTGGCCTAAAAATATTTTGATGTTTACTCAAAAAGTACCTCTTCAGGTCTTGAGAACA
TGGAAAAGAATTGAGTGCTTTTAAATACTTTTTAGAAAGTAATCATAAAAGTAAATTGAATTTCAAACCTATTTGGCTTCTGTTTTGTGA
ACCTTTGAACTATATGTATGTGTATAAGGGTATACACATACATATATGGCATATAACAAGTGTACACATATACACATAACAAGTGTAGAA
GTATATATTACATACATACACTCACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCCCATAAGTTTCTGCTGCTTCTCCCATAACTGCT

>In-frame_NBEA_ENST00000540320_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_11930nt
AGGCAGGGGGCGGCAACATGGCGGAGTGAGCGGCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCGGCAGCAGCGTCA
ATAGCATCGGCCACAGCCTGAGCTTCAGCACCGGCCAGCGTCGTGGCCAGCTGCTCGCGTCCTCGGGCTTCTCGGAGCGGCTGCAGCATC
TCCGCGGGGGGCGGGCCGGGCCGGACAGACCGGGAGAGGGAGAGAGCAGAGGCAGCGGCGGCGGCAGCGGCAGCGGCAGCGGCACACCTG
CTGGGCGGGCACAGCCGCTTGCCCGGCAGCGGTTAGCGGTACCGCCACCGCCGAGAATAAGCCTGCGGATCCCCCGCCGCCTCCGCGGGG
GAGAGCGCCGGAGCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGG
CCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCT
AGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGC
GGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAAC
CCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTG
GAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGTATGACA
GAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAATTTACAG
ACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGATATGTTG
GGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCAAGACAT
GCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCTGCGGCA
ATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAATATTAAT
GTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTAATAGTC
ACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATTGTCCAC
ATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTTAACACA
AATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTGTATGTG
TTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCTGAGAGT
GATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAGGCCACT
GATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGATGTGAAA
GCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGATAATAGG
CAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCCATGCAA
GAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTCCTGGAG
CAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTTAACCCA
GCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATCTACACC
ACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGTGGCATT
ACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAGCTGATA
CTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCATGATGTG
CTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATCTACAAA
TTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGAAAAGTT
GAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATACAACACA
CTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAGAATCCA
ATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCTGATATG
ATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGCTATATC
AATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATATGAATGG
GGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAAATGTAT
GAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAGACAACA
GGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTCAGCACA
GATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTGGAAGTA
CATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACTTTAGTA
GGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAATGTACAT
GGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCCAATAGT
AGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAATATTCAG
GACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCCAGTATA
ATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAGGGGCTG
GAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATAATTTCA
GATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAGGGTCGG
TCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTTAGCCCA
GGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCATTAGAA
ACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACATAACACA
ATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCAACTGTA
AGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTT
GATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTA
AGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGT
AAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAG
GATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTC
TTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACT
GGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTG
AACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATA
AAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTG
GCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAG
AAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAAT
GTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTG
AAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGT
TTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACA
CCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGC
AAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTA
GAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTA
TTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTT
ATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCA
CATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGAC
ATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGA
GATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCA
TCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCA
AAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTT
CTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGT
GAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATAT
GTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAG
GGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAAT
TCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGA
GAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCC
AGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTA
ACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATG
GAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAG
TATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGC
ATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACC
ATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGT
GATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTG
CAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCC
CCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGT
TCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCA
TTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCA
CAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATA
TGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTG
GGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGAT
GAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTAC
AGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGA
ATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCT
CGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAG
TACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAG
TCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCT
GTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGT
GATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTAT
TCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGT
CCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGA
CGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTT
GTAATCAAGTGAAAATATAACTTTATTTTTTAACTCTATTACATTTTATTTTGTCATGTACTAAAATTATTTCTGTATTGCTTTTATAAA
AAACAGTGGCATTTAGCACTGGCATTGAGACTATAGCACATCATTTTTGCCATTTTCAGTGCTTATATTGTTAGGTAGAGGCTGGCACTT
TATTAGAATGCAAGCCACAAAAATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTCTTTTTTTCTTTCCCTCTCTCTTTTTTTAACAA
ATGCCTTCTTATAGAAAAACTTTCTAAGAGGCAACAATTTAGAATGGATATTTTGACGAATCGGCATGAGTGTAACAGTGATAACCTGAT
CTGTTTGTTTTAAAGATTATTACCAAGTGAAAAATTCAGAATGAATAGAATTTACACTAACATGCTATATAAAATGTTAAAGTCTGATGC
TGTGAAAGCAATCTAGTGCTATATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAAGTGGGATTATGATGAGTAACTGGAGGGGCTTA
GAAACAAAAACTGGATGAAAGAGTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGAGTTCTTCATTATAAATATATATTCATGAATTC
ACAGATAAGTACTTAAAGAACAGACAGTTTACTTGGCCTAAAAATATTTTGATGTTTACTCAAAAAGTACCTCTTCAGGTCTTGAGAACA
TGGAAAAGAATTGAGTGCTTTTAAATACTTTTTAGAAAGTAATCATAAAAGTAAATTGAATTTCAAACCTATTTGGCTTCTGTTTTGTGA
ACCTTTGAACTATATGTATGTGTATAAGGGTATACACATACATATATGGCATATAACAAGTGTACACATATACACATAACAAGTGTAGAA
GTATATATTACATACATACACTCACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCCCATAAGTTTCTGCTGCTTCTCCCATAACTGCT
GCCACCACCATCAGAATTCATAATCAAACCTAACCTTTTTGTTTGGGGCACCAAATCTGAAGACAAAATTAATTTGCACCAGTAAACTTC
AAGCTGCTTTCTTTCTTGAAAACTAAACGTTTAACGTATAATGTCTGTTTGGATACTGTTCCAAATTGTTGATTGCATGTGGTTAATGTT
GCATTAGAGCACTTTGCAATTGCATAATTCATTAATGTTTTGTGAGCTTGCATTTGTGAGTTATTGGATGATCAGACTGAATTTTGTCAA
GTATCACATTGTACATCTTGCCTAGATGTCGATGACTGCAAGTAATAATACAGTTTATAATGAAACTATCTACAATTCTTGTTTTAGCAC
ATCTGTTATCCGTAAAACACCTGTAACTAGCTTTTTTAATTTATTATTTGAATTTTAGGATAGCGAATCACTAATTTTTAGTTGCTGAGG
TTGGCATTTTAGTGATTATTAAGCACTTCTGTCAGTCTTTGAAAAAAGAACGTATTTTTTGTGCTTTGAAGATCTCTGAAGAATTTCTTT
TATAATAGAATGGGCATGTATTGTAACAGTTTTATGTCAAATGATCTGTGCTGTAGAAAAACATTAACCCTTGTTCAAAAAAGAAATGGA
TAAACTTGGCCTTTCTAAGTGGTAAGAATGACCTGTCACTATAATATACTGTATGTTTACATTTTATTTAAATTTAATCTCTTATGTATA
GGGTGATAACCTTCCCCAGAAACAACAGTGATTGCGATTGTTTTCTAGAAACTTCTTTAAAGTGCCACATTTGGCAGTACAAATGAGTCT
GAGTGTAATAGCCCAGAGATTTATATATAGTTGAATGTCTAAAATGGTAAAATGTGCCACTGTGTCAAGTTACAGTGGCTTATGTTTTTC
ATAGTAATTCAAATGAACTTCCTATTTTTGATAGTAAATGTCATTTAATAGTATACTTGCCATTTGAGCCTCACTGCAAAATTAGTGCAG
AGGAGAAAACAATTTTTAATGTAATCTTGATTTTACCTCATATACTGTACATTCCAAAAACTCTAAACTTTTTAAAGATTATAGATACAC
TACCAAACATATCACCTTAAAATTGTATAAGGCTGAATGAACTTCATACAAATGAAAAAAATCTCATAAAAATACATAAACTATGTAGCA

>In-frame_NBEA_ENST00000400445_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_12116nt
AGGCAGGGGGCGGCAACATGGCGGAGTGAGCGGCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCGGCAGCAGCGTCA
ATAGCATCGGCCACAGCCTGAGCTTCAGCACCGGCCAGCGTCGTGGCCAGCTGCTCGCGTCCTCGGGCTTCTCGGAGCGGCTGCAGCATC
TCCGCGGGGGGCGGGCCGGGCCGGACAGACCGGGAGAGGGAGAGAGCAGAGGCAGCGGCGGCGGCAGCGGCAGCGGCAGCGGCACACCTG
CTGGGCGGGCACAGCCGCTTGCCCGGCAGCGGTTAGCGGTACCGCCACCGCCGAGAATAAGCCTGCGGATCCCCCGCCGCCTCCGCGGGG
GAGAGCGCCGGAGCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGG
CCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCT
AGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGC
GGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAAC
CCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTG
GAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGTATGACA
GAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAATTTACAG
ACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGATATGTTG
GGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCAAGACAT
GCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCTGCGGCA
ATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAATATTAAT
GTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTAATAGTC
ACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATTGTCCAC
ATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTTAACACA
AATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTGTATGTG
TTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCTGAGAGT
GATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAGGCCACT
GATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGATGTGAAA
GCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGATAATAGG
CAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCCATGCAA
GAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTCCTGGAG
CAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTTAACCCA
GCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATCTACACC
ACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGTGGCATT
ACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAGCTGATA
CTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCATGATGTG
CTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATCTACAAA
TTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGAAAAGTT
GAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATACAACACA
CTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAGAATCCA
ATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCTGATATG
ATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGCTATATC
AATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATATGAATGG
GGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAAATGTAT
GAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAGACAACA
GGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTCAGCACA
GATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTGGAAGTA
CATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACTTTAGTA
GGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAATGTACAT
GGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCCAATAGT
AGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAATATTCAG
GACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCCAGTATA
ATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAGGGGCTG
GAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATAATTTCA
GATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAGGGTCGG
TCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTTAGCCCA
GGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCATTAGAA
ACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACATAACACA
ATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCAACTGGT
TCTAAGACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTT
GATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTA
AGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGT
AAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAG
GATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTC
TTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACT
GGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTG
AACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATA
AAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTG
GCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAG
AAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAAT
GTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTG
AAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGT
TTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACA
CCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGC
AAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTA
GAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTA
TTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTT
ATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCA
CATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGAC
ATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGA
GATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCA
TCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCA
AAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTT
CTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGT
GAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATAT
GTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAG
GGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAAT
TCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGA
GAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCC
AGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTA
ACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATG
GAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAG
TATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGC
ATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACC
ATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGT
GATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTG
CAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCC
CCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGT
TCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCA
TTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCA
CAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATA
TGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTG
GGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGAT
GAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTAC
AGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGA
ATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCT
CGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAG
TACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAG
TCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCT
GTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGT
GATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTAT
TCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGT
CCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGA
CGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTT
GTAATCAAGTGAAAATATAACTTTATTTTTTAACTCTATTACATTTTATTTTGTCATGTACTAAAATTATTTCTGTATTGCTTTTATAAA
AAACAGTGGCATTTAGCACTGGCATTGAGACTATAGCACATCATTTTTGCCATTTTCAGTGCTTATATTGTTAGGTAGAGGCTGGCACTT
TATTAGAATGCAAGCCACAAAAATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTCTTTTTTTCTTTCCCTCTCTCTTTTTTTAACAA
ATGCCTTCTTATAGAAAAACTTTCTAAGAGGCAACAATTTAGAATGGATATTTTGACGAATCGGCATGAGTGTAACAGTGATAACCTGAT
CTGTTTGTTTTAAAGATTATTACCAAGTGAAAAATTCAGAATGAATAGAATTTACACTAACATGCTATATAAAATGTTAAAGTCTGATGC
TGTGAAAGCAATCTAGTGCTATATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAAGTGGGATTATGATGAGTAACTGGAGGGGCTTA
GAAACAAAAACTGGATGAAAGAGTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGAGTTCTTCATTATAAATATATATTCATGAATTC
ACAGATAAGTACTTAAAGAACAGACAGTTTACTTGGCCTAAAAATATTTTGATGTTTACTCAAAAAGTACCTCTTCAGGTCTTGAGAACA
TGGAAAAGAATTGAGTGCTTTTAAATACTTTTTAGAAAGTAATCATAAAAGTAAATTGAATTTCAAACCTATTTGGCTTCTGTTTTGTGA
ACCTTTGAACTATATGTATGTGTATAAGGGTATACACATACATATATGGCATATAACAAGTGTACACATATACACATAACAAGTGTAGAA
GTATATATTACATACATACACTCACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCCCATAAGTTTCTGCTGCTTCTCCCATAACTGCT
GCCACCACCATCAGAATTCATAATCAAACCTAACCTTTTTGTTTGGGGCACCAAATCTGAAGACAAAATTAATTTGCACCAGTAAACTTC
AAGCTGCTTTCTTTCTTGAAAACTAAACGTTTAACGTATAATGTCTGTTTGGATACTGTTCCAAATTGTTGATTGCATGTGGTTAATGTT
GCATTAGAGCACTTTGCAATTGCATAATTCATTAATGTTTTGTGAGCTTGCATTTGTGAGTTATTGGATGATCAGACTGAATTTTGTCAA
GTATCACATTGTACATCTTGCCTAGATGTCGATGACTGCAAGTAATAATACAGTTTATAATGAAACTATCTACAATTCTTGTTTTAGCAC
ATCTGTTATCCGTAAAACACCTGTAACTAGCTTTTTTAATTTATTATTTGAATTTTAGGATAGCGAATCACTAATTTTTAGTTGCTGAGG
TTGGCATTTTAGTGATTATTAAGCACTTCTGTCAGTCTTTGAAAAAAGAACGTATTTTTTGTGCTTTGAAGATCTCTGAAGAATTTCTTT
TATAATAGAATGGGCATGTATTGTAACAGTTTTATGTCAAATGATCTGTGCTGTAGAAAAACATTAACCCTTGTTCAAAAAAGAAATGGA
TAAACTTGGCCTTTCTAAGTGGTAAGAATGACCTGTCACTATAATATACTGTATGTTTACATTTTATTTAAATTTAATCTCTTATGTATA
GGGTGATAACCTTCCCCAGAAACAACAGTGATTGCGATTGTTTTCTAGAAACTTCTTTAAAGTGCCACATTTGGCAGTACAAATGAGTCT
GAGTGTAATAGCCCAGAGATTTATATATAGTTGAATGTCTAAAATGGTAAAATGTGCCACTGTGTCAAGTTACAGTGGCTTATGTTTTTC
ATAGTAATTCAAATGAACTTCCTATTTTTGATAGTAAATGTCATTTAATAGTATACTTGCCATTTGAGCCTCACTGCAAAATTAGTGCAG
AGGAGAAAACAATTTTTAATGTAATCTTGATTTTACCTCATATACTGTACATTCCAAAAACTCTAAACTTTTTAAAGATTATAGATACAC
TACCAAACATATCACCTTAAAATTGTATAAGGCTGAATGAACTTCATACAAATGAAAAAAATCTCATAAAAATACATAAACTATGTAGCA
AAAGTATCTGTAAAATCCATGGAAAATAAAAGTTGTATCATTCTTTTTGAGATACGTTTATTGTATTCATATATATTCATTATTTGCTAC
CTGTTTAAGAAAGTGAAATGTTATGGTCTCCCCTCTTCCAATGAGCTTAAAACATTTTTCCCAACAGTATATAAATCTTCAACATGAGAG

>In-frame_NBEA_ENST00000400445_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_10711nt
AGGCAGGGGGCGGCAACATGGCGGAGTGAGCGGCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCGGCAGCAGCGTCA
ATAGCATCGGCCACAGCCTGAGCTTCAGCACCGGCCAGCGTCGTGGCCAGCTGCTCGCGTCCTCGGGCTTCTCGGAGCGGCTGCAGCATC
TCCGCGGGGGGCGGGCCGGGCCGGACAGACCGGGAGAGGGAGAGAGCAGAGGCAGCGGCGGCGGCAGCGGCAGCGGCAGCGGCACACCTG
CTGGGCGGGCACAGCCGCTTGCCCGGCAGCGGTTAGCGGTACCGCCACCGCCGAGAATAAGCCTGCGGATCCCCCGCCGCCTCCGCGGGG
GAGAGCGCCGGAGCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGG
CCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCT
AGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGC
GGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAAC
CCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTG
GAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGTATGACA
GAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAATTTACAG
ACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGATATGTTG
GGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCAAGACAT
GCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCTGCGGCA
ATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAATATTAAT
GTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTAATAGTC
ACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATTGTCCAC
ATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTTAACACA
AATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTGTATGTG
TTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCTGAGAGT
GATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAGGCCACT
GATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGATGTGAAA
GCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGATAATAGG
CAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCCATGCAA
GAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTCCTGGAG
CAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTTAACCCA
GCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATCTACACC
ACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGTGGCATT
ACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAGCTGATA
CTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCATGATGTG
CTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATCTACAAA
TTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGAAAAGTT
GAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATACAACACA
CTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAGAATCCA
ATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCTGATATG
ATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGCTATATC
AATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATATGAATGG
GGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAAATGTAT
GAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAGACAACA
GGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTCAGCACA
GATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTGGAAGTA
CATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACTTTAGTA
GGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAATGTACAT
GGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCCAATAGT
AGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAATATTCAG
GACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCCAGTATA
ATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAGGGGCTG
GAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATAATTTCA
GATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAGGGTCGG
TCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTTAGCCCA
GGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCATTAGAA
ACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACATAACACA
ATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCAACTGGT
TCTAAGACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTT
GATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTA
AGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGT
AAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAG
GATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTC
TTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACT
GGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTG
AACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATA
AAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTG
GCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAG
AAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAAT
GTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTG
AAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGT
TTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACA
CCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGC
AAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTA
GAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTA
TTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTT
ATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCA
CATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGAC
ATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGA
GATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCA
TCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCA
AAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTT
CTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGT
GAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATAT
GTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAG
GGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAAT
TCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGA
GAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCC
AGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTA
ACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATG
GAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAG
TATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGC
ATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACC
ATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGT
GATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTG
CAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCC
CCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGT
TCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCA
TTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCA
CAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATA
TGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTG
GGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGAT
GAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTAC
AGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGA
ATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCT
CGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAG
TACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAG
TCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCT
GTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGT
GATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTAT
TCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGT
CCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGA
CGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTT
GTAATCAAGTGAAAATATAACTTTATTTTTTAACTCTATTACATTTTATTTTGTCATGTACTAAAATTATTTCTGTATTGCTTTTATAAA
AAACAGTGGCATTTAGCACTGGCATTGAGACTATAGCACATCATTTTTGCCATTTTCAGTGCTTATATTGTTAGGTAGAGGCTGGCACTT
TATTAGAATGCAAGCCACAAAAATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTCTTTTTTTCTTTCCCTCTCTCTTTTTTTAACAA
ATGCCTTCTTATAGAAAAACTTTCTAAGAGGCAACAATTTAGAATGGATATTTTGACGAATCGGCATGAGTGTAACAGTGATAACCTGAT
CTGTTTGTTTTAAAGATTATTACCAAGTGAAAAATTCAGAATGAATAGAATTTACACTAACATGCTATATAAAATGTTAAAGTCTGATGC
TGTGAAAGCAATCTAGTGCTATATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAAGTGGGATTATGATGAGTAACTGGAGGGGCTTA
GAAACAAAAACTGGATGAAAGAGTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGAGTTCTTCATTATAAATATATATTCATGAATTC
ACAGATAAGTACTTAAAGAACAGACAGTTTACTTGGCCTAAAAATATTTTGATGTTTACTCAAAAAGTACCTCTTCAGGTCTTGAGAACA
TGGAAAAGAATTGAGTGCTTTTAAATACTTTTTAGAAAGTAATCATAAAAGTAAATTGAATTTCAAACCTATTTGGCTTCTGTTTTGTGA
ACCTTTGAACTATATGTATGTGTATAAGGGTATACACATACATATATGGCATATAACAAGTGTACACATATACACATAACAAGTGTAGAA
GTATATATTACATACATACACTCACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCCCATAAGTTTCTGCTGCTTCTCCCATAACTGCT

>In-frame_NBEA_ENST00000400445_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_11930nt
AGGCAGGGGGCGGCAACATGGCGGAGTGAGCGGCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCGGCAGCAGCGTCA
ATAGCATCGGCCACAGCCTGAGCTTCAGCACCGGCCAGCGTCGTGGCCAGCTGCTCGCGTCCTCGGGCTTCTCGGAGCGGCTGCAGCATC
TCCGCGGGGGGCGGGCCGGGCCGGACAGACCGGGAGAGGGAGAGAGCAGAGGCAGCGGCGGCGGCAGCGGCAGCGGCAGCGGCACACCTG
CTGGGCGGGCACAGCCGCTTGCCCGGCAGCGGTTAGCGGTACCGCCACCGCCGAGAATAAGCCTGCGGATCCCCCGCCGCCTCCGCGGGG
GAGAGCGCCGGAGCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGG
CCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCT
AGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGC
GGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAAC
CCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTG
GAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGTATGACA
GAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAATTTACAG
ACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGATATGTTG
GGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCAAGACAT
GCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCTGCGGCA
ATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAATATTAAT
GTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTAATAGTC
ACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATTGTCCAC
ATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTTAACACA
AATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTGTATGTG
TTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCTGAGAGT
GATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAGGCCACT
GATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGATGTGAAA
GCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGATAATAGG
CAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCCATGCAA
GAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTCCTGGAG
CAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTTAACCCA
GCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATCTACACC
ACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGTGGCATT
ACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAGCTGATA
CTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCATGATGTG
CTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATCTACAAA
TTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGAAAAGTT
GAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATACAACACA
CTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAGAATCCA
ATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCTGATATG
ATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGCTATATC
AATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATATGAATGG
GGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAAATGTAT
GAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAGACAACA
GGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTCAGCACA
GATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTGGAAGTA
CATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACTTTAGTA
GGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAATGTACAT
GGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCCAATAGT
AGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAATATTCAG
GACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCCAGTATA
ATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAGGGGCTG
GAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATAATTTCA
GATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAGGGTCGG
TCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTTAGCCCA
GGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCATTAGAA
ACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACATAACACA
ATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCAACTGGT
TCTAAGACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTT
GATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTA
AGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGT
AAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAG
GATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTC
TTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACT
GGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTG
AACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATA
AAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTG
GCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAG
AAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAAT
GTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTG
AAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGT
TTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACA
CCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGC
AAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTA
GAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTA
TTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTT
ATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCA
CATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGAC
ATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGA
GATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCA
TCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCA
AAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTT
CTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGT
GAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATAT
GTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAG
GGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAAT
TCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGA
GAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCC
AGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTA
ACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATG
GAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAG
TATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGC
ATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACC
ATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGT
GATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTG
CAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCC
CCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGT
TCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCA
TTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCA
CAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATA
TGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTG
GGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGAT
GAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTAC
AGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGA
ATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCT
CGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAG
TACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAG
TCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCT
GTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGT
GATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTAT
TCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGT
CCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGA
CGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTT
GTAATCAAGTGAAAATATAACTTTATTTTTTAACTCTATTACATTTTATTTTGTCATGTACTAAAATTATTTCTGTATTGCTTTTATAAA
AAACAGTGGCATTTAGCACTGGCATTGAGACTATAGCACATCATTTTTGCCATTTTCAGTGCTTATATTGTTAGGTAGAGGCTGGCACTT
TATTAGAATGCAAGCCACAAAAATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTCTTTTTTTCTTTCCCTCTCTCTTTTTTTAACAA
ATGCCTTCTTATAGAAAAACTTTCTAAGAGGCAACAATTTAGAATGGATATTTTGACGAATCGGCATGAGTGTAACAGTGATAACCTGAT
CTGTTTGTTTTAAAGATTATTACCAAGTGAAAAATTCAGAATGAATAGAATTTACACTAACATGCTATATAAAATGTTAAAGTCTGATGC
TGTGAAAGCAATCTAGTGCTATATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAAGTGGGATTATGATGAGTAACTGGAGGGGCTTA
GAAACAAAAACTGGATGAAAGAGTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGAGTTCTTCATTATAAATATATATTCATGAATTC
ACAGATAAGTACTTAAAGAACAGACAGTTTACTTGGCCTAAAAATATTTTGATGTTTACTCAAAAAGTACCTCTTCAGGTCTTGAGAACA
TGGAAAAGAATTGAGTGCTTTTAAATACTTTTTAGAAAGTAATCATAAAAGTAAATTGAATTTCAAACCTATTTGGCTTCTGTTTTGTGA
ACCTTTGAACTATATGTATGTGTATAAGGGTATACACATACATATATGGCATATAACAAGTGTACACATATACACATAACAAGTGTAGAA
GTATATATTACATACATACACTCACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCCCATAAGTTTCTGCTGCTTCTCCCATAACTGCT
GCCACCACCATCAGAATTCATAATCAAACCTAACCTTTTTGTTTGGGGCACCAAATCTGAAGACAAAATTAATTTGCACCAGTAAACTTC
AAGCTGCTTTCTTTCTTGAAAACTAAACGTTTAACGTATAATGTCTGTTTGGATACTGTTCCAAATTGTTGATTGCATGTGGTTAATGTT
GCATTAGAGCACTTTGCAATTGCATAATTCATTAATGTTTTGTGAGCTTGCATTTGTGAGTTATTGGATGATCAGACTGAATTTTGTCAA
GTATCACATTGTACATCTTGCCTAGATGTCGATGACTGCAAGTAATAATACAGTTTATAATGAAACTATCTACAATTCTTGTTTTAGCAC
ATCTGTTATCCGTAAAACACCTGTAACTAGCTTTTTTAATTTATTATTTGAATTTTAGGATAGCGAATCACTAATTTTTAGTTGCTGAGG
TTGGCATTTTAGTGATTATTAAGCACTTCTGTCAGTCTTTGAAAAAAGAACGTATTTTTTGTGCTTTGAAGATCTCTGAAGAATTTCTTT
TATAATAGAATGGGCATGTATTGTAACAGTTTTATGTCAAATGATCTGTGCTGTAGAAAAACATTAACCCTTGTTCAAAAAAGAAATGGA
TAAACTTGGCCTTTCTAAGTGGTAAGAATGACCTGTCACTATAATATACTGTATGTTTACATTTTATTTAAATTTAATCTCTTATGTATA
GGGTGATAACCTTCCCCAGAAACAACAGTGATTGCGATTGTTTTCTAGAAACTTCTTTAAAGTGCCACATTTGGCAGTACAAATGAGTCT
GAGTGTAATAGCCCAGAGATTTATATATAGTTGAATGTCTAAAATGGTAAAATGTGCCACTGTGTCAAGTTACAGTGGCTTATGTTTTTC
ATAGTAATTCAAATGAACTTCCTATTTTTGATAGTAAATGTCATTTAATAGTATACTTGCCATTTGAGCCTCACTGCAAAATTAGTGCAG
AGGAGAAAACAATTTTTAATGTAATCTTGATTTTACCTCATATACTGTACATTCCAAAAACTCTAAACTTTTTAAAGATTATAGATACAC
TACCAAACATATCACCTTAAAATTGTATAAGGCTGAATGAACTTCATACAAATGAAAAAAATCTCATAAAAATACATAAACTATGTAGCA

>In-frame_NBEA_ENST00000310336_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_11788nt
GCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGG
CGCTGGTGGATGCTGGGGCTCCGAGGCGACGGCCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTC
TTCCCTTCTCCTCAGGAGGGGGGCCAATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCG
TCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCG
GCTCGGTGATGCTCCCCGCGGGGATGATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATAC
AGGTCGGAGAGGTCAGCAACAGGGACATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTA
TCCAGGATGCTGAGAGTATAACATGTATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAG
CCATTCTACGAAAAAGTGTTCGGAATTTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATG
ACATGATAGCAGATCTTCTAGTTGATATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGC
TTCGAGGAGAAAGTGGAATCTGGCCAAGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTT
TTTTCAATTTCCCTGGTTGTAGCGCTGCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTT
GGTTTCGTATGGATCCATTAAATAATATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACT
CTGCTCATTTTGTTGGCAACTGTTTAATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAAC
CACGCAAGTGGTACATGATCAGCATTGTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTAT
CTTATGGTGATATGGCTTGGCATGTTAACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGG
TATTCTGTGGTCAACTTGGTGCCGTGTATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGAT
ATAAGAGTACCTTCAAGTTTAAATCTGAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTA
GCATTGCCTTTACATATAATGCTAAGGCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATT
CCCCACATGCTCTAATGCTTCAGGATGTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGC
TTTTTCCACTTTTTGCCCAATTGGATAATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGG
TTGAACTACTTAAAAGTTCAGTAGCCATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCAT
CAAGAGTTCATATAACTAGAGCTGTCCTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGA
AGCAGCTTTGTGATCACATTTTATTTAACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTG
CTGAATTTATTGGAACTGCTACCATCTACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACT
GGGTTATTAATCCTGCTGACAGTAGTGGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGG
CATTTATGCTACTTTTTCTGAAACAGCTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTA
CGATGCATGAGGATGAAAATATTCATGATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTG
ATCAAAGAAATGGAATAAGGGTGATCTACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACT
TTCTGAAGCATTTAGGTCACAAGAGAAAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATA
CAAACACTGTGACTGTCACCACATACAACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAG
AGCCAGATTCTACAGTGAAAATTCAGAATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGA
TGGAAGTTCGTCGTTTATTTTTATCTGATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGT
GGCAGGATTGGATGTTTTCTCTTGGCTATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGA
TTCTTTTGTATCATGCAATAAAATATGAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATG
AAGCTCATAAGGAATACCTAGCCAAAATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGA
GCACCATCTCTGGTCTTTCATCACAGACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCC
CAGAAAGTGAGACCGATTACCCTGTCAGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAG
ATAGACCAGGAAGTGGTGTACATGTGGAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCG
ATGATATGGATTTATCACCGGAGACTTTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTG
CTGCTGTTGAGAAACTCCAGAACAATGTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACAT
TAGCAGATGAGAAAGAAGACCTTCCCAATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAAC
TTTCTAGCAATCACATTATTCCAAATATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCG
GTAGCGTAGACTTAACTTGTACATCCAGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTG
AAAGAGACTTAGCGTCATCAACTAAGGGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTG
TACCAAATATTGATGCAGGAAGTATAATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAA
CAACTACTACGACACAAGCTGTGCAGGGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAA
TGACTGAGGAACAGCGACGCCAGTTTAGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGC
GGCTTCTCACTGATTTACTATTTGCATTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATA
GCAATGAAAATATTATTTTTGTACATAACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTAC
CTTTGCTCTCTGCTGCTACATCACCAACTGTAAGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAG
TAACTTTCCTCAGCCGGCTGATGGCTATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACA
TGTCTTCTGGAGGTTTAATGCGACAGTGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAG
ACAGGGGAAATAAATCTTCCCATGGAAGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGG
AAAATGTTCCAGGTAACCTTTCTCCTATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTC
GGGATGTGGATGATAGCAAACAAGCACAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACA
TATTAGAACCCCAGAGAGAGACTACAAGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTG
TGGTCATACCATCTATCCCTCATCCAAGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACA
AAGAAACACCTGCTGCATTTCCAGACACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCC
ATACAGATTCAGGAATTGGAGAGGAGCAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTG
AACTCTTATCCACTTTGTCATCCGAAGTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCA
TATCTAGCATTAGTCAAACCAAAGGCATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCC
CTGAACCTATCCCATACCCAGATCCAGCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTG
TGGTGCCTGTAAAGAAACCACCTCCAGGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTA
CCTCTAATATATTTGCTGCTACTGGAGCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCT
CCTCTTCTAGTTTTGTGAATGGTGCTACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATA
TGAGCATCACTGCAAAACTTGAAAGAGCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTC
GTACACTTCTTGGCAGTCATGGACAAGAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTA
TCTATGTGCCTCCTGGATATGCCCCACAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACC
CTGGTAGTCACACAGTTCTCCACCGTTCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTC
ATATGTACTCACCCGTGACTGGAGCTGGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATG
CTCACTCTACACATGGAAGGTCCAACTTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAG
GAACACAGAAAGATAAAATGAGCAGTCCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGAC
AAATTGCTGGTGGTATAAACACAGGATCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAA
AAGATGAAGAAACTAAAGCATTTGAAGCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTA
CCTGGTCACCACCTTCCAGCCTCATTAATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTA
CTGGAAAAGATGGGAAATACAAAAGTGTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATG
CAAAAGTCCAGGCAGAATATAATTCTATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTA
ATCCACCAAGGATAGCCAATCGGACCAAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTG
TATTAGAATGGGATGAAGGAAAAGGAAATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCAC
CAGCAATGGGCTGTAAATTCAGACTATCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCT
GTGCTCCTTCTATGCCAGCAAGTCCTGTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCAT
CAGATGAAGGAATTTCTTACATTTTAGAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTT
ACACAGTGAAAAATCTCAGACGTAGTACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAG
TAGAATTTACTACTTGCCCTGATAAACCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCT
GGGATCCACCAAAAGACAATGGCGGAGCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGA
TATACAGTGGTGCTACCAGGGAACATCTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAG
GACAGAGTGCGGTCTCTGAATCTTTACTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCA
AAGCAAAAGAAATACAGTTACGATGGGGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAG
AAAAAGATGAACCTAGAGAAGTTTACCAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGAC
TACGTGCAGCTAACAAAATGGGGTTTGGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCC
CTCAAGTGACATGTAGATCTGCAACTTGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGG
AGTGGGGAGGAGTTGAAGGAAGTATGCAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCT
ATTATTGCAGGGTCCAGGCTCTGAGTGTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCA
TTGTGACCTGTCTTCAAGAAATAAGCGATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGC
CTTGTGATCATGGTTCGGAAATCCTTGCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTA
TCAACAATTTGCAACCAGATACAACATACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAAT
TAAAAACTAAGCCTCTCCCTCCTGATCCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAA
CTCCAAAGACATTGTCAACCGATTCTATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCAT
GTCATACATACAAAGTACAAAGACTTAATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCT
CCCAAGAATATATTTTCACTACTCCAAAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAA
TTACATGGGAGTGTTTACAGCCAATGAAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGA
TTTACAAGGGTCCCGACTCTTCCTTCCGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCC
AAGACTCTCTGGGACACCAGGACCTCGTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCA
ACAGAGACACTGTGGAAAGCACAAGGACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTT
CCATTTTGATTGCCTTTATCATTCAGTACTTTGTAATCAAGTGAAAATATAACTTTATTTTTTAACTCTATTACATTTTATTTTGTCATG
TACTAAAATTATTTCTGTATTGCTTTTATAAAAAACAGTGGCATTTAGCACTGGCATTGAGACTATAGCACATCATTTTTGCCATTTTCA
GTGCTTATATTGTTAGGTAGAGGCTGGCACTTTATTAGAATGCAAGCCACAAAAATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTC
TTTTTTTCTTTCCCTCTCTCTTTTTTTAACAAATGCCTTCTTATAGAAAAACTTTCTAAGAGGCAACAATTTAGAATGGATATTTTGACG
AATCGGCATGAGTGTAACAGTGATAACCTGATCTGTTTGTTTTAAAGATTATTACCAAGTGAAAAATTCAGAATGAATAGAATTTACACT
AACATGCTATATAAAATGTTAAAGTCTGATGCTGTGAAAGCAATCTAGTGCTATATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAA
GTGGGATTATGATGAGTAACTGGAGGGGCTTAGAAACAAAAACTGGATGAAAGAGTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGA
GTTCTTCATTATAAATATATATTCATGAATTCACAGATAAGTACTTAAAGAACAGACAGTTTACTTGGCCTAAAAATATTTTGATGTTTA
CTCAAAAAGTACCTCTTCAGGTCTTGAGAACATGGAAAAGAATTGAGTGCTTTTAAATACTTTTTAGAAAGTAATCATAAAAGTAAATTG
AATTTCAAACCTATTTGGCTTCTGTTTTGTGAACCTTTGAACTATATGTATGTGTATAAGGGTATACACATACATATATGGCATATAACA
AGTGTACACATATACACATAACAAGTGTAGAAGTATATATTACATACATACACTCACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCC
CATAAGTTTCTGCTGCTTCTCCCATAACTGCTGCCACCACCATCAGAATTCATAATCAAACCTAACCTTTTTGTTTGGGGCACCAAATCT
GAAGACAAAATTAATTTGCACCAGTAAACTTCAAGCTGCTTTCTTTCTTGAAAACTAAACGTTTAACGTATAATGTCTGTTTGGATACTG
TTCCAAATTGTTGATTGCATGTGGTTAATGTTGCATTAGAGCACTTTGCAATTGCATAATTCATTAATGTTTTGTGAGCTTGCATTTGTG
AGTTATTGGATGATCAGACTGAATTTTGTCAAGTATCACATTGTACATCTTGCCTAGATGTCGATGACTGCAAGTAATAATACAGTTTAT
AATGAAACTATCTACAATTCTTGTTTTAGCACATCTGTTATCCGTAAAACACCTGTAACTAGCTTTTTTAATTTATTATTTGAATTTTAG
GATAGCGAATCACTAATTTTTAGTTGCTGAGGTTGGCATTTTAGTGATTATTAAGCACTTCTGTCAGTCTTTGAAAAAAGAACGTATTTT
TTGTGCTTTGAAGATCTCTGAAGAATTTCTTTTATAATAGAATGGGCATGTATTGTAACAGTTTTATGTCAAATGATCTGTGCTGTAGAA
AAACATTAACCCTTGTTCAAAAAAGAAATGGATAAACTTGGCCTTTCTAAGTGGTAAGAATGACCTGTCACTATAATATACTGTATGTTT
ACATTTTATTTAAATTTAATCTCTTATGTATAGGGTGATAACCTTCCCCAGAAACAACAGTGATTGCGATTGTTTTCTAGAAACTTCTTT
AAAGTGCCACATTTGGCAGTACAAATGAGTCTGAGTGTAATAGCCCAGAGATTTATATATAGTTGAATGTCTAAAATGGTAAAATGTGCC
ACTGTGTCAAGTTACAGTGGCTTATGTTTTTCATAGTAATTCAAATGAACTTCCTATTTTTGATAGTAAATGTCATTTAATAGTATACTT
GCCATTTGAGCCTCACTGCAAAATTAGTGCAGAGGAGAAAACAATTTTTAATGTAATCTTGATTTTACCTCATATACTGTACATTCCAAA
AACTCTAAACTTTTTAAAGATTATAGATACACTACCAAACATATCACCTTAAAATTGTATAAGGCTGAATGAACTTCATACAAATGAAAA
AAATCTCATAAAAATACATAAACTATGTAGCAAAAGTATCTGTAAAATCCATGGAAAATAAAAGTTGTATCATTCTTTTTGAGATACGTT
TATTGTATTCATATATATTCATTATTTGCTACCTGTTTAAGAAAGTGAAATGTTATGGTCTCCCCTCTTCCAATGAGCTTAAAACATTTT

>In-frame_NBEA_ENST00000310336_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_10383nt
GCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGG
CGCTGGTGGATGCTGGGGCTCCGAGGCGACGGCCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTC
TTCCCTTCTCCTCAGGAGGGGGGCCAATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCG
TCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCG
GCTCGGTGATGCTCCCCGCGGGGATGATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATAC
AGGTCGGAGAGGTCAGCAACAGGGACATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTA
TCCAGGATGCTGAGAGTATAACATGTATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAG
CCATTCTACGAAAAAGTGTTCGGAATTTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATG
ACATGATAGCAGATCTTCTAGTTGATATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGC
TTCGAGGAGAAAGTGGAATCTGGCCAAGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTT
TTTTCAATTTCCCTGGTTGTAGCGCTGCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTT
GGTTTCGTATGGATCCATTAAATAATATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACT
CTGCTCATTTTGTTGGCAACTGTTTAATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAAC
CACGCAAGTGGTACATGATCAGCATTGTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTAT
CTTATGGTGATATGGCTTGGCATGTTAACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGG
TATTCTGTGGTCAACTTGGTGCCGTGTATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGAT
ATAAGAGTACCTTCAAGTTTAAATCTGAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTA
GCATTGCCTTTACATATAATGCTAAGGCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATT
CCCCACATGCTCTAATGCTTCAGGATGTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGC
TTTTTCCACTTTTTGCCCAATTGGATAATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGG
TTGAACTACTTAAAAGTTCAGTAGCCATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCAT
CAAGAGTTCATATAACTAGAGCTGTCCTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGA
AGCAGCTTTGTGATCACATTTTATTTAACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTG
CTGAATTTATTGGAACTGCTACCATCTACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACT
GGGTTATTAATCCTGCTGACAGTAGTGGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGG
CATTTATGCTACTTTTTCTGAAACAGCTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTA
CGATGCATGAGGATGAAAATATTCATGATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTG
ATCAAAGAAATGGAATAAGGGTGATCTACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACT
TTCTGAAGCATTTAGGTCACAAGAGAAAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATA
CAAACACTGTGACTGTCACCACATACAACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAG
AGCCAGATTCTACAGTGAAAATTCAGAATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGA
TGGAAGTTCGTCGTTTATTTTTATCTGATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGT
GGCAGGATTGGATGTTTTCTCTTGGCTATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGA
TTCTTTTGTATCATGCAATAAAATATGAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATG
AAGCTCATAAGGAATACCTAGCCAAAATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGA
GCACCATCTCTGGTCTTTCATCACAGACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCC
CAGAAAGTGAGACCGATTACCCTGTCAGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAG
ATAGACCAGGAAGTGGTGTACATGTGGAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCG
ATGATATGGATTTATCACCGGAGACTTTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTG
CTGCTGTTGAGAAACTCCAGAACAATGTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACAT
TAGCAGATGAGAAAGAAGACCTTCCCAATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAAC
TTTCTAGCAATCACATTATTCCAAATATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCG
GTAGCGTAGACTTAACTTGTACATCCAGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTG
AAAGAGACTTAGCGTCATCAACTAAGGGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTG
TACCAAATATTGATGCAGGAAGTATAATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAA
CAACTACTACGACACAAGCTGTGCAGGGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAA
TGACTGAGGAACAGCGACGCCAGTTTAGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGC
GGCTTCTCACTGATTTACTATTTGCATTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATA
GCAATGAAAATATTATTTTTGTACATAACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTAC
CTTTGCTCTCTGCTGCTACATCACCAACTGTAAGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAG
TAACTTTCCTCAGCCGGCTGATGGCTATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACA
TGTCTTCTGGAGGTTTAATGCGACAGTGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAG
ACAGGGGAAATAAATCTTCCCATGGAAGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGG
AAAATGTTCCAGGTAACCTTTCTCCTATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTC
GGGATGTGGATGATAGCAAACAAGCACAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACA
TATTAGAACCCCAGAGAGAGACTACAAGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTG
TGGTCATACCATCTATCCCTCATCCAAGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACA
AAGAAACACCTGCTGCATTTCCAGACACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCC
ATACAGATTCAGGAATTGGAGAGGAGCAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTG
AACTCTTATCCACTTTGTCATCCGAAGTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCA
TATCTAGCATTAGTCAAACCAAAGGCATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCC
CTGAACCTATCCCATACCCAGATCCAGCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTG
TGGTGCCTGTAAAGAAACCACCTCCAGGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTA
CCTCTAATATATTTGCTGCTACTGGAGCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCT
CCTCTTCTAGTTTTGTGAATGGTGCTACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATA
TGAGCATCACTGCAAAACTTGAAAGAGCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTC
GTACACTTCTTGGCAGTCATGGACAAGAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTA
TCTATGTGCCTCCTGGATATGCCCCACAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACC
CTGGTAGTCACACAGTTCTCCACCGTTCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTC
ATATGTACTCACCCGTGACTGGAGCTGGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATG
CTCACTCTACACATGGAAGGTCCAACTTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAG
GAACACAGAAAGATAAAATGAGCAGTCCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGAC
AAATTGCTGGTGGTATAAACACAGGATCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAA
AAGATGAAGAAACTAAAGCATTTGAAGCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTA
CCTGGTCACCACCTTCCAGCCTCATTAATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTA
CTGGAAAAGATGGGAAATACAAAAGTGTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATG
CAAAAGTCCAGGCAGAATATAATTCTATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTA
ATCCACCAAGGATAGCCAATCGGACCAAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTG
TATTAGAATGGGATGAAGGAAAAGGAAATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCAC
CAGCAATGGGCTGTAAATTCAGACTATCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCT
GTGCTCCTTCTATGCCAGCAAGTCCTGTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCAT
CAGATGAAGGAATTTCTTACATTTTAGAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTT
ACACAGTGAAAAATCTCAGACGTAGTACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAG
TAGAATTTACTACTTGCCCTGATAAACCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCT
GGGATCCACCAAAAGACAATGGCGGAGCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGA
TATACAGTGGTGCTACCAGGGAACATCTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAG
GACAGAGTGCGGTCTCTGAATCTTTACTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCA
AAGCAAAAGAAATACAGTTACGATGGGGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAG
AAAAAGATGAACCTAGAGAAGTTTACCAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGAC
TACGTGCAGCTAACAAAATGGGGTTTGGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCC
CTCAAGTGACATGTAGATCTGCAACTTGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGG
AGTGGGGAGGAGTTGAAGGAAGTATGCAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCT
ATTATTGCAGGGTCCAGGCTCTGAGTGTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCA
TTGTGACCTGTCTTCAAGAAATAAGCGATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGC
CTTGTGATCATGGTTCGGAAATCCTTGCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTA
TCAACAATTTGCAACCAGATACAACATACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAAT
TAAAAACTAAGCCTCTCCCTCCTGATCCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAA
CTCCAAAGACATTGTCAACCGATTCTATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCAT
GTCATACATACAAAGTACAAAGACTTAATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCT
CCCAAGAATATATTTTCACTACTCCAAAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAA
TTACATGGGAGTGTTTACAGCCAATGAAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGA
TTTACAAGGGTCCCGACTCTTCCTTCCGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCC
AAGACTCTCTGGGACACCAGGACCTCGTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCA
ACAGAGACACTGTGGAAAGCACAAGGACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTT
CCATTTTGATTGCCTTTATCATTCAGTACTTTGTAATCAAGTGAAAATATAACTTTATTTTTTAACTCTATTACATTTTATTTTGTCATG
TACTAAAATTATTTCTGTATTGCTTTTATAAAAAACAGTGGCATTTAGCACTGGCATTGAGACTATAGCACATCATTTTTGCCATTTTCA
GTGCTTATATTGTTAGGTAGAGGCTGGCACTTTATTAGAATGCAAGCCACAAAAATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTC
TTTTTTTCTTTCCCTCTCTCTTTTTTTAACAAATGCCTTCTTATAGAAAAACTTTCTAAGAGGCAACAATTTAGAATGGATATTTTGACG
AATCGGCATGAGTGTAACAGTGATAACCTGATCTGTTTGTTTTAAAGATTATTACCAAGTGAAAAATTCAGAATGAATAGAATTTACACT
AACATGCTATATAAAATGTTAAAGTCTGATGCTGTGAAAGCAATCTAGTGCTATATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAA
GTGGGATTATGATGAGTAACTGGAGGGGCTTAGAAACAAAAACTGGATGAAAGAGTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGA
GTTCTTCATTATAAATATATATTCATGAATTCACAGATAAGTACTTAAAGAACAGACAGTTTACTTGGCCTAAAAATATTTTGATGTTTA
CTCAAAAAGTACCTCTTCAGGTCTTGAGAACATGGAAAAGAATTGAGTGCTTTTAAATACTTTTTAGAAAGTAATCATAAAAGTAAATTG
AATTTCAAACCTATTTGGCTTCTGTTTTGTGAACCTTTGAACTATATGTATGTGTATAAGGGTATACACATACATATATGGCATATAACA
AGTGTACACATATACACATAACAAGTGTAGAAGTATATATTACATACATACACTCACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCC

>In-frame_NBEA_ENST00000310336_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_11602nt
GCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGG
CGCTGGTGGATGCTGGGGCTCCGAGGCGACGGCCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTC
TTCCCTTCTCCTCAGGAGGGGGGCCAATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCG
TCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCG
GCTCGGTGATGCTCCCCGCGGGGATGATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATAC
AGGTCGGAGAGGTCAGCAACAGGGACATCGTGGAGACGGTGCTCAACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTA
TCCAGGATGCTGAGAGTATAACATGTATGACAGAGCTTTTGGAGCACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAG
CCATTCTACGAAAAAGTGTTCGGAATTTACAGACTAGCACAGAAGTTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATG
ACATGATAGCAGATCTTCTAGTTGATATGTTGGGGGTTCTTGCCAGCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGC
TTCGAGGAGAAAGTGGAATCTGGCCAAGACATGCAGTAAAATTATTATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTT
TTTTCAATTTCCCTGGTTGTAGCGCTGCGGCAATTGCCTTGCCTCCTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTT
GGTTTCGTATGGATCCATTAAATAATATTAATGTTGATAAGGATAAACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACT
CTGCTCATTTTGTTGGCAACTGTTTAATAGTCACATCATTGAAGTCCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAAC
CACGCAAGTGGTACATGATCAGCATTGTCCACATTTACAATCGATGGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTAT
CTTATGGTGATATGGCTTGGCATGTTAACACAAATGATAGCTATGACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGG
TATTCTGTGGTCAACTTGGTGCCGTGTATGTGTTCAGTGAAGCACTCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGAT
ATAAGAGTACCTTCAAGTTTAAATCTGAGAGTGATATTCATTTGGCAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTA
GCATTGCCTTTACATATAATGCTAAGGCCACTGATGCTCAGCTCTGCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATT
CCCCACATGCTCTAATGCTTCAGGATGTGAAAGCGATAGTAACACATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGC
TTTTTCCACTTTTTGCCCAATTGGATAATAGGCAGCTCAATGACAGTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGG
TTGAACTACTTAAAAGTTCAGTAGCCATGCAAGAACAGATGCTGGGTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCAT
CAAGAGTTCATATAACTAGAGCTGTCCTGGAGCAATTTTTATCTTTTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGA
AGCAGCTTTGTGATCACATTTTATTTAACCCAGCCATCTGGATACATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTG
CTGAATTTATTGGAACTGCTACCATCTACACCACCATACGCAGAGTAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACT
GGGTTATTAATCCTGCTGACAGTAGTGGCATTACACCTAAAGGATTAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGG
CATTTATGCTACTTTTTCTGAAACAGCTGATACTAAAGGATCGAGGGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTA
CGATGCATGAGGATGAAAATATTCATGATGTGCTACAGTTACTGGTGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTG
ATCAAAGAAATGGAATAAGGGTGATCTACAAATTATTGGCTTCTAAAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACT
TTCTGAAGCATTTAGGTCACAAGAGAAAAGTTGAAATTATGCACACCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATA
CAAACACTGTGACTGTCACCACATACAACACACTTTATGAGATCTTGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAG
AGCCAGATTCTACAGTGAAAATTCAGAATCCAATGATTCTTAAAGTGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGA
TGGAAGTTCGTCGTTTATTTTTATCTGATATGATAAAACTTTTCAGTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGT
GGCAGGATTGGATGTTTTCTCTTGGCTATATCAATCCTAAAAATTCTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGA
TTCTTTTGTATCATGCAATAAAATATGAATGGGGAGGCTGGAGAGTCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATG
AAGCTCATAAGGAATACCTAGCCAAAATGTATGAGGAATATCAAAGACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGA
GCACCATCTCTGGTCTTTCATCACAGACAACAGGAGCAAAAGGTGGAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCC
CAGAAAGTGAGACCGATTACCCTGTCAGCACAGATACTCGAGACTTACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAG
ATAGACCAGGAAGTGGTGTACATGTGGAAGTACATGATCTTTTAGTAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCG
ATGATATGGATTTATCACCGGAGACTTTAGTAGGTGGAGAGAATGGTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTG
CTGCTGTTGAGAAACTCCAGAACAATGTACATGGAAGTGTTGGTATCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACAT
TAGCAGATGAGAAAGAAGACCTTCCCAATAGTAGTACATCATTTCTCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAAC
TTTCTAGCAATCACATTATTCCAAATATTCAGGACACACAAGTACATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCG
GTAGCGTAGACTTAACTTGTACATCCAGTATAATAGAAGAAAAAGAATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTG
AAAGAGACTTAGCGTCATCAACTAAGGGGCTGGAGTATGCTGAAATGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTG
TACCAAATATTGATGCAGGAAGTATAATTTCAGATACTGAAAGGTCTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAA
CAACTACTACGACACAAGCTGTGCAGGGTCGGTCTATCACCCAACAAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAA
TGACTGAGGAACAGCGACGCCAGTTTAGCCCAGGTCCACGGACTACAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGC
GGCTTCTCACTGATTTACTATTTGCATTAGAAACTGATGTACATGTTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATA
GCAATGAAAATATTATTTTTGTACATAACACAATTCACCTCATTTCCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTAC
CTTTGCTCTCTGCTGCTACATCACCAACTGTAAGTAAAACGGAATTGGAAAATATTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAG
TAACTTTCCTCAGCCGGCTGATGGCTATGGTTGATGTACTTGTGTTTGCAAGCTCTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACA
TGTCTTCTGGAGGTTTAATGCGACAGTGCCTAAGATTAGTTTGTTGTGTTGCTGTGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAG
ACAGGGGAAATAAATCTTCCCATGGAAGCAGTAAACCTCAGGAAGTTCCTCAAAGTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGG
AAAATGTTCCAGGTAACCTTTCTCCTATTAAGGATCCGGATAGACTTCTTCAGGATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTC
GGGATGTGGATGATAGCAAACAAGCACAGTTCTTAGCTCTGGCTGTTGTTTACTTCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACA
TATTAGAACCCCAGAGAGAGACTACAAGAACTGGAAGCCAACCAGGTAGAAACATCAGGCAAGAAATAAATTCACCAACAAGTACAGTTG
TGGTCATACCATCTATCCCTCATCCAAGTTTGAACCATGGATTCCTTGCCAAGTTAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACA
AAGAAACACCTGCTGCATTTCCAGACACCATAAAAGAAAAAGAAACACCAACTCCTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCC
ATACAGATTCAGGAATTGGAGAGGAGCAAGTGGCTAGCATCCTGAATGGGGCAGAATTAGAAACAAGTACAGGCCCTGATGCCATGAGTG
AACTCTTATCCACTTTGTCATCCGAAGTGAAGAAATCACAAGAGAGCTTAACTGAAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCA
TATCTAGCATTAGTCAAACCAAAGGCATCAATGTGAAGGAAATACTGAAAAGTCTTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCC
CTGAACCTATCCCATACCCAGATCCAGCATTGAAGAGAGAAACACAAGCTATTCTTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTG
TGGTGCCTGTAAAGAAACCACCTCCAGGTAGTTTAGCTGTAACCACTGTGGGAGCCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTA
CCTCTAATATATTTGCTGCTACTGGAGCTACACCAAAAAGTATGATTAATACAACAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCT
CCTCTTCTAGTTTTGTGAATGGTGCTACTAGCAAAAACCTTCCAGCTGTACAAACTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATA
TGAGCATCACTGCAAAACTTGAAAGAGCGTTAGAAAAAGTTGCTCCTCTTCTTCGTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTC
GTACACTTCTTGGCAGTCATGGACAAGAGCTATTGATAGAAGGTCCTGCTCAGGTTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTA
TCTATGTGCCTCCTGGATATGCCCCACAGGTTATTGAAGACAATGGTGTTCGAAGAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACC
CTGGTAGTCACACAGTTCTCCACCGTTCTCCACATCCTCCTCTACCTGGTTTCATTCCTGTCCCAACTATGATGCCGCCTCCACCACGTC
ATATGTACTCACCCGTGACTGGAGCTGGAGACATGACAACACAGTATATGCCACAGTATCAGTCTTCACAAGTCTATGGAGATGTAGATG
CTCACTCTACACATGGAAGGTCCAACTTTAGAGATGAACGATCTAGTAAAACATATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAG
GAACACAGAAAGATAAAATGAGCAGTCCACCATCATCACCCCAGAAATGCCCTTCTCCCATTAATGAACATAATGGACTTATAAAAGGAC
AAATTGCTGGTGGTATAAACACAGGATCAGCAAAAATCAAGTCTGGGAAGGGGAAAGGTGGTACACAAGTTGATACAGAAATTGAAGAAA
AAGATGAAGAAACTAAAGCATTTGAAGCACTTCTTTCCAACATTGTCAAACCAGTGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTA
CCTGGTCACCACCTTCCAGCCTCATTAATGGTGAAACAGATGAAAGTAGTGTACCAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTA
CTGGAAAAGATGGGAAATACAAAAGTGTATATGTAGGAGAAGAAACAAATATCACTTTAAATGATCTCAAGCCAGCCATGGATTACCATG
CAAAAGTCCAGGCAGAATATAATTCTATAAAGGGAACTCCTTCAGAGGCTGAAATCTTTACCACCTTGAGCTGTGAACCTGATATACCTA
ATCCACCAAGGATAGCCAATCGGACCAAAAATTCACTCACTTTGCAATGGAAGGCACCTAGTGACAATGGTTCTAAAATCCAAAACTTTG
TATTAGAATGGGATGAAGGAAAAGGAAATGGAGAATTTTGTCAGTGTTACATGGGCTCACAGAAACAATTTAAAATTACTAAACTTTCAC
CAGCAATGGGCTGTAAATTCAGACTATCGGCCAGAAATGACTATGGTACAAGTGGTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCT
GTGCTCCTTCTATGCCAGCAAGTCCTGTATTAACCAAGGCTGGAATTACTTGGTTATCCTTACAATGGAGTAAGCCCTCAGGAACACCAT
CAGATGAAGGAATTTCTTACATTTTAGAGATGGAGGAAGAAACTTCAGGATATGGTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTT
ACACAGTGAAAAATCTCAGACGTAGTACTAAGTATAAATTTAAGGTTATTGCTTACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAG
TAGAATTTACTACTTGCCCTGATAAACCAGGCATACCTGTAAAGCCTTCAGTGAAAGGAAAGATACATTCACACAGTTTTAAAATAACCT
GGGATCCACCAAAAGACAATGGCGGAGCAACCATCAATAAATATGTAGTGGAGATGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGA
TATACAGTGGTGCTACCAGGGAACATCTTTGTGATCGACTGAATCCAGGCTGTTTCTATCGTTTACGAGTTTACTGCATCAGTGATGGAG
GACAGAGTGCGGTCTCTGAATCTTTACTTGTGCAGACTCCAGCTGTGCCTCCTGGCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCA
AAGCAAAAGAAATACAGTTACGATGGGGACCCCCTCTGGTTGATGGTGGATCACCCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAG
AAAAAGATGAACCTAGAGAAGTTTACCAAGGTTCTGAAGTAGAATGTACAGTGAGCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGAC
TACGTGCAGCTAACAAAATGGGGTTTGGACCATTTTCAGAAAAATGTGATATTACTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCC
CTCAAGTGACATGTAGATCTGCAACTTGTGCACAAGTGAATTGGGAGGTTCCTTTGAGTAATGGAACAGATGTCACTGAATATCGACTGG
AGTGGGGAGGAGTTGAAGGAAGTATGCAGATATGTTACTGTGGGCCTGGTCTCAGTTATGAAATAAAAGGACTTTCACCAGCAACTACCT
ATTATTGCAGGGTCCAGGCTCTGAGTGTTGTGGGTGCAGGCCCTTTCAGTGAAGTAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCA
TTGTGACCTGTCTTCAAGAAATAAGCGATGATGAGATAGAAAATCCCCATTATTCACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGC
CTTGTGATCATGGTTCGGAAATCCTTGCCTACAGCATAGACTTTGGAGATAAACAATCCCTAACAGTGGGAAAGGTTACAAGCTATATTA
TCAACAATTTGCAACCAGATACAACATACAGAATACGAATTCAAGCCTTGAATAGCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAAT
TAAAAACTAAGCCTCTCCCTCCTGATCCACCTCGTCTGGAATGTGTTGCCTTTAGCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAA
CTCCAAAGACATTGTCAACCGATTCTATTCAGTACCACCTTCAGATGGAGGATAAGAATGGACGGTTTGTATCCCTATACAGAGGACCAT
GTCATACATACAAAGTACAAAGACTTAATGAGTCAACATCCTATAAATTCTGTATTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCT
CCCAAGAATATATTTTCACTACTCCAAAATCTGTCCCAGCTGCCTTGAAAGCCCCCAAAATAGAGAAAGTAAATGATCACATTTGTGAAA
TTACATGGGAGTGTTTACAGCCAATGAAAGGTGATCCAGTTATTTACAGTCTTCAAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGA
TTTACAAGGGTCCCGACTCTTCCTTCCGGTATTCCAGCCTTCAGCTGAACTGTGAATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCC
AAGACTCTCTGGGACACCAGGACCTCGTAGGTCCCTACAGCACCACAGTGCTCTTCATCTCTCAGAGGACTGAACCACCAGCCAGCACCA
ACAGAGACACTGTGGAAAGCACAAGGACCCGACGGGCACTGAGTGACGAGCAGTGTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTT
CCATTTTGATTGCCTTTATCATTCAGTACTTTGTAATCAAGTGAAAATATAACTTTATTTTTTAACTCTATTACATTTTATTTTGTCATG
TACTAAAATTATTTCTGTATTGCTTTTATAAAAAACAGTGGCATTTAGCACTGGCATTGAGACTATAGCACATCATTTTTGCCATTTTCA
GTGCTTATATTGTTAGGTAGAGGCTGGCACTTTATTAGAATGCAAGCCACAAAAATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTC
TTTTTTTCTTTCCCTCTCTCTTTTTTTAACAAATGCCTTCTTATAGAAAAACTTTCTAAGAGGCAACAATTTAGAATGGATATTTTGACG
AATCGGCATGAGTGTAACAGTGATAACCTGATCTGTTTGTTTTAAAGATTATTACCAAGTGAAAAATTCAGAATGAATAGAATTTACACT
AACATGCTATATAAAATGTTAAAGTCTGATGCTGTGAAAGCAATCTAGTGCTATATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAA
GTGGGATTATGATGAGTAACTGGAGGGGCTTAGAAACAAAAACTGGATGAAAGAGTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGA
GTTCTTCATTATAAATATATATTCATGAATTCACAGATAAGTACTTAAAGAACAGACAGTTTACTTGGCCTAAAAATATTTTGATGTTTA
CTCAAAAAGTACCTCTTCAGGTCTTGAGAACATGGAAAAGAATTGAGTGCTTTTAAATACTTTTTAGAAAGTAATCATAAAAGTAAATTG
AATTTCAAACCTATTTGGCTTCTGTTTTGTGAACCTTTGAACTATATGTATGTGTATAAGGGTATACACATACATATATGGCATATAACA
AGTGTACACATATACACATAACAAGTGTAGAAGTATATATTACATACATACACTCACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCC
CATAAGTTTCTGCTGCTTCTCCCATAACTGCTGCCACCACCATCAGAATTCATAATCAAACCTAACCTTTTTGTTTGGGGCACCAAATCT
GAAGACAAAATTAATTTGCACCAGTAAACTTCAAGCTGCTTTCTTTCTTGAAAACTAAACGTTTAACGTATAATGTCTGTTTGGATACTG
TTCCAAATTGTTGATTGCATGTGGTTAATGTTGCATTAGAGCACTTTGCAATTGCATAATTCATTAATGTTTTGTGAGCTTGCATTTGTG
AGTTATTGGATGATCAGACTGAATTTTGTCAAGTATCACATTGTACATCTTGCCTAGATGTCGATGACTGCAAGTAATAATACAGTTTAT
AATGAAACTATCTACAATTCTTGTTTTAGCACATCTGTTATCCGTAAAACACCTGTAACTAGCTTTTTTAATTTATTATTTGAATTTTAG
GATAGCGAATCACTAATTTTTAGTTGCTGAGGTTGGCATTTTAGTGATTATTAAGCACTTCTGTCAGTCTTTGAAAAAAGAACGTATTTT
TTGTGCTTTGAAGATCTCTGAAGAATTTCTTTTATAATAGAATGGGCATGTATTGTAACAGTTTTATGTCAAATGATCTGTGCTGTAGAA
AAACATTAACCCTTGTTCAAAAAAGAAATGGATAAACTTGGCCTTTCTAAGTGGTAAGAATGACCTGTCACTATAATATACTGTATGTTT
ACATTTTATTTAAATTTAATCTCTTATGTATAGGGTGATAACCTTCCCCAGAAACAACAGTGATTGCGATTGTTTTCTAGAAACTTCTTT
AAAGTGCCACATTTGGCAGTACAAATGAGTCTGAGTGTAATAGCCCAGAGATTTATATATAGTTGAATGTCTAAAATGGTAAAATGTGCC
ACTGTGTCAAGTTACAGTGGCTTATGTTTTTCATAGTAATTCAAATGAACTTCCTATTTTTGATAGTAAATGTCATTTAATAGTATACTT
GCCATTTGAGCCTCACTGCAAAATTAGTGCAGAGGAGAAAACAATTTTTAATGTAATCTTGATTTTACCTCATATACTGTACATTCCAAA
AACTCTAAACTTTTTAAAGATTATAGATACACTACCAAACATATCACCTTAAAATTGTATAAGGCTGAATGAACTTCATACAAATGAAAA

>In-frame_NBEA_ENST00000379939_chr13_35806756_+_FNDC3A_ENST00000492622_chr13_49688791_+_11734nt
CGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGGCCGGGGGGCGGGG
GCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCTAGCGAGAAGCCGG
GCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGCGGTGGTGGCGGCA
CCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAACCCTTCGGTGCCGA
TCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTGGAGACGGTGCTCA
ACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGTATGACAGAGCTTTTGGAGC
ACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAATTTACAGACTAGCACAGAAG
TTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGATATGTTGGGGGTTCTTGCCA
GCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCAAGACATGCAGTAAAATTAT
TATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCTGCGGCAATTGCCTTGCCTC
CTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAATATTAATGTTGATAAGGATA
AACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTAATAGTCACATCATTGAAGT
CCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATTGTCCACATTTACAATCGAT
GGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTTAACACAAATGATAGCTATG
ACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTGTATGTGTTCAGTGAAGCAC
TCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCTGAGAGTGATATTCATTTGG
CAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAGGCCACTGATGCTCAGCTCT
GCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGATGTGAAAGCGATAGTAACAC
ATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGATAATAGGCAGCTCAATGACA
GTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCCATGCAAGAACAGATGCTGG
GTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTCCTGGAGCAATTTTTATCTT
TTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTTAACCCAGCCATCTGGATAC
ATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATCTACACCACCATACGCAGAG
TAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGTGGCATTACACCTAAAGGAT
TAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAGCTGATACTAAAGGATCGAG
GGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCATGATGTGCTACAGTTACTGG
TGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATCTACAAATTATTGGCTTCTA
AAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGAAAAGTTGAAATTATGCACA
CCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATACAACACACTTTATGAGATCT
TGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAGAATCCAATGATTCTTAAAG
TGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCTGATATGATAAAACTTTTCA
GTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGCTATATCAATCCTAAAAATT
CTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATATGAATGGGGAGGCTGGAGAG
TCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAAATGTATGAGGAATATCAAA
GACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAGACAACAGGAGCAAAAGGTG
GAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTCAGCACAGATACTCGAGACT
TACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTGGAAGTACATGATCTTTTAG
TAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACTTTAGTAGGTGGAGAGAATG
GTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAATGTACATGGAAGTGTTGGTA
TCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCCAATAGTAGTACATCATTTC
TCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAATATTCAGGACACACAAGTAC
ATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCCAGTATAATAGAAGAAAAAG
AATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAGGGGCTGGAGTATGCTGAAA
TGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATAATTTCAGATACTGAAAGGT
CTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAGGGTCGGTCTATCACCCAAC
AAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTTAGCCCAGGTCCACGGACTA
CAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCATTAGAAACTGATGTACATG
TTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACATAACACAATTCACCTCATTT
CCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCAACTACGGAATTGGAAAATA
TTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTTGATGTACTTGTGTTTGCAAGCT
CTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTAAGATTAGTTTGTTGTGTTGCTG
TGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGTAAACCTCAGGAAGTTCCTCAAA
GTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAGGATCCGGATAGACTTCTTCAGG
ATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTCTTAGCTCTGGCTGTTGTTTACT
TCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACTGGAAGCCAACCAGGTAGAAACA
TCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTGAACCATGGATTCCTTGCCAAGT
TAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATAAAAGAAAAAGAAACACCAACTC
CTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTGGCTAGCATCCTGAATGGGGCAG
AATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAGAAATCACAAGAGAGCTTAACTG
AAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAATGTGAAGGAAATACTGAAAAGTC
TTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTGAAGAGAGAAACACAAGCTATTC
TTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGTTTAGCTGTAACCACTGTGGGAG
CCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACACCAAAAAGTATGATTAATACAA
CAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGCAAAAACCTTCCAGCTGTACAAA
CTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTAGAAAAAGTTGCTCCTCTTCTTC
GTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTATTGATAGAAGGTCCTGCTCAGG
TTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTTATTGAAGACAATGGTGTTCGAA
GAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCACATCCTCCTCTACCTGGTTTCA
TTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGACATGACAACACAGTATATGCCAC
AGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGAGATGAACGATCTAGTAAAACAT
ATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCATCATCACCCCAGAAATGCCCTT
CTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCAAAAATCAAGTCTGGGAAGGGGA
AAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTTCTTTCCAACATTGTCAAACCAG
TGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGTGAAACAGATGAAAGTAGTGTAC
CAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATATGTAGGAGAAGAAACAAATATCA
CTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAGGGAACTCCTTCAGAGGCTGAAA
TCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAATTCACTCACTTTGCAATGGAAGG
CACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGAGAATTTTGTCAGTGTTACATGG
GCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCCAGAAATGACTATGGTACAAGTG
GTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTAACCAAGGCTGGAATTACTTGGT
TATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATGGAGGAAGAAACTTCAGGATATG
GTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAGTATAAATTTAAGGTTATTGCTT
ACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGCATACCTGTAAAGCCTTCAGTGA
AAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACCATCAATAAATATGTAGTGGAGA
TGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGTGATCGACTGAATCCAGGCTGTT
TCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTGCAGACTCCAGCTGTGCCTCCTG
GCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCCCCTCTGGTTGATGGTGGATCAC
CCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGTTCTGAAGTAGAATGTACAGTGA
GCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCATTTTCAGAAAAATGTGATATTA
CTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCACAAGTGAATTGGGAGGTTCCTT
TGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATATGTTACTGTGGGCCTGGTCTCA
GTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTGGGTGCAGGCCCTTTCAGTGAAG
TAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGATGAGATAGAAAATCCCCATTATT
CACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTACAGCATAGACTTTGGAGATAAAC
AATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGAATACGAATTCAAGCCTTGAATA
GCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCTCGTCTGGAATGTGTTGCCTTTA
GCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAGTACCACCTTCAGATGGAGGATA
AGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAGTCAACATCCTATAAATTCTGTA
TTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCTGTCCCAGCTGCCTTGAAAGCCC
CCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGTGATCCAGTTATTTACAGTCTTC
AAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTATTCCAGCCTTCAGCTGAACTGTG
AATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGTCCCTACAGCACCACAGTGCTCT
TCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGACGGGCACTGAGTGACGAGCAGT
GTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTTGTAATCAAGTGAAAATATAACT
TTATTTTTTAACTCTATTACATTTTATTTTGTCATGTACTAAAATTATTTCTGTATTGCTTTTATAAAAAACAGTGGCATTTAGCACTGG
CATTGAGACTATAGCACATCATTTTTGCCATTTTCAGTGCTTATATTGTTAGGTAGAGGCTGGCACTTTATTAGAATGCAAGCCACAAAA
ATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTCTTTTTTTCTTTCCCTCTCTCTTTTTTTAACAAATGCCTTCTTATAGAAAAACTT
TCTAAGAGGCAACAATTTAGAATGGATATTTTGACGAATCGGCATGAGTGTAACAGTGATAACCTGATCTGTTTGTTTTAAAGATTATTA
CCAAGTGAAAAATTCAGAATGAATAGAATTTACACTAACATGCTATATAAAATGTTAAAGTCTGATGCTGTGAAAGCAATCTAGTGCTAT
ATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAAGTGGGATTATGATGAGTAACTGGAGGGGCTTAGAAACAAAAACTGGATGAAAGA
GTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGAGTTCTTCATTATAAATATATATTCATGAATTCACAGATAAGTACTTAAAGAACA
GACAGTTTACTTGGCCTAAAAATATTTTGATGTTTACTCAAAAAGTACCTCTTCAGGTCTTGAGAACATGGAAAAGAATTGAGTGCTTTT
AAATACTTTTTAGAAAGTAATCATAAAAGTAAATTGAATTTCAAACCTATTTGGCTTCTGTTTTGTGAACCTTTGAACTATATGTATGTG
TATAAGGGTATACACATACATATATGGCATATAACAAGTGTACACATATACACATAACAAGTGTAGAAGTATATATTACATACATACACT
CACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCCCATAAGTTTCTGCTGCTTCTCCCATAACTGCTGCCACCACCATCAGAATTCATA
ATCAAACCTAACCTTTTTGTTTGGGGCACCAAATCTGAAGACAAAATTAATTTGCACCAGTAAACTTCAAGCTGCTTTCTTTCTTGAAAA
CTAAACGTTTAACGTATAATGTCTGTTTGGATACTGTTCCAAATTGTTGATTGCATGTGGTTAATGTTGCATTAGAGCACTTTGCAATTG
CATAATTCATTAATGTTTTGTGAGCTTGCATTTGTGAGTTATTGGATGATCAGACTGAATTTTGTCAAGTATCACATTGTACATCTTGCC
TAGATGTCGATGACTGCAAGTAATAATACAGTTTATAATGAAACTATCTACAATTCTTGTTTTAGCACATCTGTTATCCGTAAAACACCT
GTAACTAGCTTTTTTAATTTATTATTTGAATTTTAGGATAGCGAATCACTAATTTTTAGTTGCTGAGGTTGGCATTTTAGTGATTATTAA
GCACTTCTGTCAGTCTTTGAAAAAAGAACGTATTTTTTGTGCTTTGAAGATCTCTGAAGAATTTCTTTTATAATAGAATGGGCATGTATT
GTAACAGTTTTATGTCAAATGATCTGTGCTGTAGAAAAACATTAACCCTTGTTCAAAAAAGAAATGGATAAACTTGGCCTTTCTAAGTGG
TAAGAATGACCTGTCACTATAATATACTGTATGTTTACATTTTATTTAAATTTAATCTCTTATGTATAGGGTGATAACCTTCCCCAGAAA
CAACAGTGATTGCGATTGTTTTCTAGAAACTTCTTTAAAGTGCCACATTTGGCAGTACAAATGAGTCTGAGTGTAATAGCCCAGAGATTT
ATATATAGTTGAATGTCTAAAATGGTAAAATGTGCCACTGTGTCAAGTTACAGTGGCTTATGTTTTTCATAGTAATTCAAATGAACTTCC
TATTTTTGATAGTAAATGTCATTTAATAGTATACTTGCCATTTGAGCCTCACTGCAAAATTAGTGCAGAGGAGAAAACAATTTTTAATGT
AATCTTGATTTTACCTCATATACTGTACATTCCAAAAACTCTAAACTTTTTAAAGATTATAGATACACTACCAAACATATCACCTTAAAA
TTGTATAAGGCTGAATGAACTTCATACAAATGAAAAAAATCTCATAAAAATACATAAACTATGTAGCAAAAGTATCTGTAAAATCCATGG
AAAATAAAAGTTGTATCATTCTTTTTGAGATACGTTTATTGTATTCATATATATTCATTATTTGCTACCTGTTTAAGAAAGTGAAATGTT
ATGGTCTCCCCTCTTCCAATGAGCTTAAAACATTTTTCCCAACAGTATATAAATCTTCAACATGAGAGGATGTATATTTATTATATAAAG

>In-frame_NBEA_ENST00000379939_chr13_35806756_+_FNDC3A_ENST00000541916_chr13_49688791_+_10329nt
CGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGGCCGGGGGGCGGGG
GCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCTAGCGAGAAGCCGG
GCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGCGGTGGTGGCGGCA
CCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAACCCTTCGGTGCCGA
TCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTGGAGACGGTGCTCA
ACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGTATGACAGAGCTTTTGGAGC
ACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAATTTACAGACTAGCACAGAAG
TTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGATATGTTGGGGGTTCTTGCCA
GCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCAAGACATGCAGTAAAATTAT
TATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCTGCGGCAATTGCCTTGCCTC
CTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAATATTAATGTTGATAAGGATA
AACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTAATAGTCACATCATTGAAGT
CCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATTGTCCACATTTACAATCGAT
GGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTTAACACAAATGATAGCTATG
ACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTGTATGTGTTCAGTGAAGCAC
TCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCTGAGAGTGATATTCATTTGG
CAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAGGCCACTGATGCTCAGCTCT
GCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGATGTGAAAGCGATAGTAACAC
ATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGATAATAGGCAGCTCAATGACA
GTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCCATGCAAGAACAGATGCTGG
GTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTCCTGGAGCAATTTTTATCTT
TTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTTAACCCAGCCATCTGGATAC
ATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATCTACACCACCATACGCAGAG
TAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGTGGCATTACACCTAAAGGAT
TAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAGCTGATACTAAAGGATCGAG
GGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCATGATGTGCTACAGTTACTGG
TGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATCTACAAATTATTGGCTTCTA
AAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGAAAAGTTGAAATTATGCACA
CCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATACAACACACTTTATGAGATCT
TGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAGAATCCAATGATTCTTAAAG
TGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCTGATATGATAAAACTTTTCA
GTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGCTATATCAATCCTAAAAATT
CTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATATGAATGGGGAGGCTGGAGAG
TCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAAATGTATGAGGAATATCAAA
GACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAGACAACAGGAGCAAAAGGTG
GAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTCAGCACAGATACTCGAGACT
TACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTGGAAGTACATGATCTTTTAG
TAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACTTTAGTAGGTGGAGAGAATG
GTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAATGTACATGGAAGTGTTGGTA
TCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCCAATAGTAGTACATCATTTC
TCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAATATTCAGGACACACAAGTAC
ATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCCAGTATAATAGAAGAAAAAG
AATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAGGGGCTGGAGTATGCTGAAA
TGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATAATTTCAGATACTGAAAGGT
CTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAGGGTCGGTCTATCACCCAAC
AAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTTAGCCCAGGTCCACGGACTA
CAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCATTAGAAACTGATGTACATG
TTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACATAACACAATTCACCTCATTT
CCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCAACTACGGAATTGGAAAATA
TTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTTGATGTACTTGTGTTTGCAAGCT
CTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTAAGATTAGTTTGTTGTGTTGCTG
TGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGTAAACCTCAGGAAGTTCCTCAAA
GTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAGGATCCGGATAGACTTCTTCAGG
ATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTCTTAGCTCTGGCTGTTGTTTACT
TCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACTGGAAGCCAACCAGGTAGAAACA
TCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTGAACCATGGATTCCTTGCCAAGT
TAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATAAAAGAAAAAGAAACACCAACTC
CTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTGGCTAGCATCCTGAATGGGGCAG
AATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAGAAATCACAAGAGAGCTTAACTG
AAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAATGTGAAGGAAATACTGAAAAGTC
TTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTGAAGAGAGAAACACAAGCTATTC
TTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGTTTAGCTGTAACCACTGTGGGAG
CCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACACCAAAAAGTATGATTAATACAA
CAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGCAAAAACCTTCCAGCTGTACAAA
CTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTAGAAAAAGTTGCTCCTCTTCTTC
GTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTATTGATAGAAGGTCCTGCTCAGG
TTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTTATTGAAGACAATGGTGTTCGAA
GAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCACATCCTCCTCTACCTGGTTTCA
TTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGACATGACAACACAGTATATGCCAC
AGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGAGATGAACGATCTAGTAAAACAT
ATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCATCATCACCCCAGAAATGCCCTT
CTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCAAAAATCAAGTCTGGGAAGGGGA
AAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTTCTTTCCAACATTGTCAAACCAG
TGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGTGAAACAGATGAAAGTAGTGTAC
CAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATATGTAGGAGAAGAAACAAATATCA
CTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAGGGAACTCCTTCAGAGGCTGAAA
TCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAATTCACTCACTTTGCAATGGAAGG
CACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGAGAATTTTGTCAGTGTTACATGG
GCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCCAGAAATGACTATGGTACAAGTG
GTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTAACCAAGGCTGGAATTACTTGGT
TATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATGGAGGAAGAAACTTCAGGATATG
GTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAGTATAAATTTAAGGTTATTGCTT
ACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGCATACCTGTAAAGCCTTCAGTGA
AAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACCATCAATAAATATGTAGTGGAGA
TGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGTGATCGACTGAATCCAGGCTGTT
TCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTGCAGACTCCAGCTGTGCCTCCTG
GCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCCCCTCTGGTTGATGGTGGATCAC
CCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGTTCTGAAGTAGAATGTACAGTGA
GCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCATTTTCAGAAAAATGTGATATTA
CTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCACAAGTGAATTGGGAGGTTCCTT
TGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATATGTTACTGTGGGCCTGGTCTCA
GTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTGGGTGCAGGCCCTTTCAGTGAAG
TAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGATGAGATAGAAAATCCCCATTATT
CACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTACAGCATAGACTTTGGAGATAAAC
AATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGAATACGAATTCAAGCCTTGAATA
GCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCTCGTCTGGAATGTGTTGCCTTTA
GCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAGTACCACCTTCAGATGGAGGATA
AGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAGTCAACATCCTATAAATTCTGTA
TTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCTGTCCCAGCTGCCTTGAAAGCCC
CCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGTGATCCAGTTATTTACAGTCTTC
AAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTATTCCAGCCTTCAGCTGAACTGTG
AATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGTCCCTACAGCACCACAGTGCTCT
TCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGACGGGCACTGAGTGACGAGCAGT
GTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTTGTAATCAAGTGAAAATATAACT
TTATTTTTTAACTCTATTACATTTTATTTTGTCATGTACTAAAATTATTTCTGTATTGCTTTTATAAAAAACAGTGGCATTTAGCACTGG
CATTGAGACTATAGCACATCATTTTTGCCATTTTCAGTGCTTATATTGTTAGGTAGAGGCTGGCACTTTATTAGAATGCAAGCCACAAAA
ATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTCTTTTTTTCTTTCCCTCTCTCTTTTTTTAACAAATGCCTTCTTATAGAAAAACTT
TCTAAGAGGCAACAATTTAGAATGGATATTTTGACGAATCGGCATGAGTGTAACAGTGATAACCTGATCTGTTTGTTTTAAAGATTATTA
CCAAGTGAAAAATTCAGAATGAATAGAATTTACACTAACATGCTATATAAAATGTTAAAGTCTGATGCTGTGAAAGCAATCTAGTGCTAT
ATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAAGTGGGATTATGATGAGTAACTGGAGGGGCTTAGAAACAAAAACTGGATGAAAGA
GTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGAGTTCTTCATTATAAATATATATTCATGAATTCACAGATAAGTACTTAAAGAACA
GACAGTTTACTTGGCCTAAAAATATTTTGATGTTTACTCAAAAAGTACCTCTTCAGGTCTTGAGAACATGGAAAAGAATTGAGTGCTTTT
AAATACTTTTTAGAAAGTAATCATAAAAGTAAATTGAATTTCAAACCTATTTGGCTTCTGTTTTGTGAACCTTTGAACTATATGTATGTG
TATAAGGGTATACACATACATATATGGCATATAACAAGTGTACACATATACACATAACAAGTGTAGAAGTATATATTACATACATACACT

>In-frame_NBEA_ENST00000379939_chr13_35806756_+_FNDC3A_ENST00000398316_chr13_49688791_+_11548nt
CGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGGCCGGGGGGCGGGG
GCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCTAGCGAGAAGCCGG
GCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGCGGTGGTGGCGGCA
CCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAACCCTTCGGTGCCGA
TCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTGGAGACGGTGCTCA
ACCTGCTGGTTGGTGGAGAATTTGACTTGGAGATGAACTTTATTATCCAGGATGCTGAGAGTATAACATGTATGACAGAGCTTTTGGAGC
ACTGTGATGTAACATGTCAAGCAGAAATATGGAGCATGTTTACAGCCATTCTACGAAAAAGTGTTCGGAATTTACAGACTAGCACAGAAG
TTGGGCTAATTGAACAAGTATTGCTGAAAATGAGTGCTGTAGATGACATGATAGCAGATCTTCTAGTTGATATGTTGGGGGTTCTTGCCA
GCTACAGCATCACTGTCAAGGAGTTGAAGCTTTTGTTCAGCATGCTTCGAGGAGAAAGTGGAATCTGGCCAAGACATGCAGTAAAATTAT
TATCAGTTCTTAATCAGATGCCACAGAGACACGGTCCTGATACTTTTTTCAATTTCCCTGGTTGTAGCGCTGCGGCAATTGCCTTGCCTC
CTATTGCAAAGTGGCCTTATCAGAATGGCTTCACCTTAAACACTTGGTTTCGTATGGATCCATTAAATAATATTAATGTTGATAAGGATA
AACCTTATCTTTATTGTTTTCGTACTAGCAAAGGAGTTGGTTACTCTGCTCATTTTGTTGGCAACTGTTTAATAGTCACATCATTGAAGT
CCAAAGGAAAAGGTTTTCAGCATTGTGTGAAATATGATTTTCAACCACGCAAGTGGTACATGATCAGCATTGTCCACATTTACAATCGAT
GGAGGAACAGTGAAATTCGGTGTTATGTTAATGGACAACTGGTATCTTATGGTGATATGGCTTGGCATGTTAACACAAATGATAGCTATG
ACAAGTGCTTTCTTGGATCATCAGAAACTGCTGATGCAAATAGGGTATTCTGTGGTCAACTTGGTGCCGTGTATGTGTTCAGTGAAGCAC
TCAACCCAGCACAGATATTTGCAATTCATCAGTTAGGACCTGGATATAAGAGTACCTTCAAGTTTAAATCTGAGAGTGATATTCATTTGG
CAGAACATCATAAACAGGTGTTATATGATGGGAAACTTGCAAGTAGCATTGCCTTTACATATAATGCTAAGGCCACTGATGCTCAGCTCT
GCCTGGAATCATCACCAAAAGAGAATGCATCAATTTTTGTGCATTCCCCACATGCTCTAATGCTTCAGGATGTGAAAGCGATAGTAACAC
ATTCAATTCATAGTGCAATTCATTCAATTGGAGGGATTCAAGTGCTTTTTCCACTTTTTGCCCAATTGGATAATAGGCAGCTCAATGACA
GTCAAGTGGAAACAACTGTCTGTGCTACTCTGTTGGCATTCCTGGTTGAACTACTTAAAAGTTCAGTAGCCATGCAAGAACAGATGCTGG
GTGGAAAAGGCTTTTTAGTCATTGGCTACTTACTTGAAAAGTCATCAAGAGTTCATATAACTAGAGCTGTCCTGGAGCAATTTTTATCTT
TTGCAAAATACCTTGATGGTTTATCTCATGGAGCACCTTTGCTGAAGCAGCTTTGTGATCACATTTTATTTAACCCAGCCATCTGGATAC
ATACACCTGCAAAGGTTCAGCTTTCCCTATACACATATTTGTCTGCTGAATTTATTGGAACTGCTACCATCTACACCACCATACGCAGAG
TAGGAACAGTATTACAGCTAATGCACACCTTAAAATATTACTACTGGGTTATTAATCCTGCTGACAGTAGTGGCATTACACCTAAAGGAT
TAGATGGTCCCCGGCCATCACAAAAAGAAATTATATCACTGAGGGCATTTATGCTACTTTTTCTGAAACAGCTGATACTAAAGGATCGAG
GGGTCAAGGAAGATGAACTTCAGAGTATATTAAATTACCTACTTACGATGCATGAGGATGAAAATATTCATGATGTGCTACAGTTACTGG
TGGCTTTAATGTCGGAACACCCAGCCTCAATGATACCAGCATTTGATCAAAGAAATGGAATAAGGGTGATCTACAAATTATTGGCTTCTA
AAAGTGAAAGTATTTGGGTTCAAGCTTTGAAGGTTCTGGGATACTTTCTGAAGCATTTAGGTCACAAGAGAAAAGTTGAAATTATGCACA
CCCATAGTCTTTTCACTCTTCTTGGAGAAAGGCTGATGTTGCATACAAACACTGTGACTGTCACCACATACAACACACTTTATGAGATCT
TGACAGAACAAGTATGTACTCAGGTCGTACACAAACCACATCCAGAGCCAGATTCTACAGTGAAAATTCAGAATCCAATGATTCTTAAAG
TGGTGGCAACTTTGTTAAAAAACTCTACACCAAGTGCAGAGCTGATGGAAGTTCGTCGTTTATTTTTATCTGATATGATAAAACTTTTCA
GTAACAGCCGTGAAAATAGAAGATGCTTATTGCAGTGTTCAGTGTGGCAGGATTGGATGTTTTCTCTTGGCTATATCAATCCTAAAAATT
CTGAGGAACAGAAGATTACCGAAATGGTCTACAATATCTTCCGGATTCTTTTGTATCATGCAATAAAATATGAATGGGGAGGCTGGAGAG
TCTGGGTGGATACCCTCTCAATAGCCCATTCCAAGGTCACTTATGAAGCTCATAAGGAATACCTAGCCAAAATGTATGAGGAATATCAAA
GACAAGAGGAGGAAAACATTAAAAAGGGAAAGAAAGGGAATGTGAGCACCATCTCTGGTCTTTCATCACAGACAACAGGAGCAAAAGGTG
GAATGGAAATTCGAGAGATAGAAGATCTTTCACAAAGCCAGAGCCCAGAAAGTGAGACCGATTACCCTGTCAGCACAGATACTCGAGACT
TACTCATGTCAACAAAAGTGTCAGATGATATTCTTGGAAATTCAGATAGACCAGGAAGTGGTGTACATGTGGAAGTACATGATCTTTTAG
TAGATATAAAAGCAGAGAAAGTGGAAGCAACAGAAGTAAAGCTCGATGATATGGATTTATCACCGGAGACTTTAGTAGGTGGAGAGAATG
GTGCCCTTGTGGAGGTTGAATCTCTGTTGGATAATGTATATAGTGCTGCTGTTGAGAAACTCCAGAACAATGTACATGGAAGTGTTGGTA
TCATTAAAAAAAATGAAGAAAAGGATAATGGTCCATTGATAACATTAGCAGATGAGAAAGAAGACCTTCCCAATAGTAGTACATCATTTC
TCTTTGATAAAATACCCAAACAGGAGGAAAAACTACTTCCTGAACTTTCTAGCAATCACATTATTCCAAATATTCAGGACACACAAGTAC
ATCTTGGTGTTAGTGATGATCTTGGATTGCTTGCTCACATGACCGGTAGCGTAGACTTAACTTGTACATCCAGTATAATAGAAGAAAAAG
AATTCAAAATCCATACAACTTCAGATGGAATGAGCAGTATTTCTGAAAGAGACTTAGCGTCATCAACTAAGGGGCTGGAGTATGCTGAAA
TGACTGCTACAACTCTGGAAACTGAGTCTTCTAGTAGCAAAATTGTACCAAATATTGATGCAGGAAGTATAATTTCAGATACTGAAAGGT
CTGACGATGGCAAAGAATCAGGAAAAGAAATCCGAAAAATCCAAACAACTACTACGACACAAGCTGTGCAGGGTCGGTCTATCACCCAAC
AAGACCGAGATCTCCGAGTTGATTTAGGATTTCGAGGAATGCCAATGACTGAGGAACAGCGACGCCAGTTTAGCCCAGGTCCACGGACTA
CAATGTTTCGTATTCCTGAGTTTAAATGGTCTCCAATGCACCAGCGGCTTCTCACTGATTTACTATTTGCATTAGAAACTGATGTACATG
TTTGGAGGAGCCATTCTACAAAGTCTGTAATGGATTTTGTCAATAGCAATGAAAATATTATTTTTGTACATAACACAATTCACCTCATTT
CCCAAATGGTAGACAACATCATCATTGCTTGTGGAGGAATTTTACCTTTGCTCTCTGCTGCTACATCACCAACTACGGAATTGGAAAATA
TTGAAGTGACACAAGGCATGTCAGCTGAGACAGCAGTAACTTTCCTCAGCCGGCTGATGGCTATGGTTGATGTACTTGTGTTTGCAAGCT
CTCTAAATTTTAGTGAGATTGAAGCTGAGAAAAACATGTCTTCTGGAGGTTTAATGCGACAGTGCCTAAGATTAGTTTGTTGTGTTGCTG
TGAGAAACTGTTTAGAATGTCGGCAAAGACAGAGAGACAGGGGAAATAAATCTTCCCATGGAAGCAGTAAACCTCAGGAAGTTCCTCAAA
GTGTGACTGCTACAGCAGCTTCGAAGACTCCATTGGAAAATGTTCCAGGTAACCTTTCTCCTATTAAGGATCCGGATAGACTTCTTCAGG
ATGTTGATATCAATCGCCTTCGTGCTGTTGTCTTTCGGGATGTGGATGATAGCAAACAAGCACAGTTCTTAGCTCTGGCTGTTGTTTACT
TCATTTCGGTTCTGATGGTTTCCAAGTATCGTGACATATTAGAACCCCAGAGAGAGACTACAAGAACTGGAAGCCAACCAGGTAGAAACA
TCAGGCAAGAAATAAATTCACCAACAAGTACAGTTGTGGTCATACCATCTATCCCTCATCCAAGTTTGAACCATGGATTCCTTGCCAAGT
TAATTCCTGAGCAGAGCTTTGGCCACTCATTTTACAAAGAAACACCTGCTGCATTTCCAGACACCATAAAAGAAAAAGAAACACCAACTC
CTGGTGAAGATATTCAGGTAGAAAGTTCAATTCCCCATACAGATTCAGGAATTGGAGAGGAGCAAGTGGCTAGCATCCTGAATGGGGCAG
AATTAGAAACAAGTACAGGCCCTGATGCCATGAGTGAACTCTTATCCACTTTGTCATCCGAAGTGAAGAAATCACAAGAGAGCTTAACTG
AAAATCCTAGTGAAACGTTGAAGCCTGCAACATCCATATCTAGCATTAGTCAAACCAAAGGCATCAATGTGAAGGAAATACTGAAAAGTC
TTGTGGCTGCTCCAGTTGAAATAGCAGAATGTGGCCCTGAACCTATCCCATACCCAGATCCAGCATTGAAGAGAGAAACACAAGCTATTC
TTCCTATGCAGTTTCATTCCTTTGACAGGAGTGTTGTGGTGCCTGTAAAGAAACCACCTCCAGGTAGTTTAGCTGTAACCACTGTGGGAG
CCACTACTGCTGGAAGTGGGCTGCCAACAGGCAGTACCTCTAATATATTTGCTGCTACTGGAGCTACACCAAAAAGTATGATTAATACAA
CAGGTGCCGTGGATTCAGGGTCCTCCTCCTCTTCCTCCTCTTCTAGTTTTGTGAATGGTGCTACTAGCAAAAACCTTCCAGCTGTACAAA
CTGTTGCTCCAATGCCAGAAGATTCAGCTGAAAATATGAGCATCACTGCAAAACTTGAAAGAGCGTTAGAAAAAGTTGCTCCTCTTCTTC
GTGAAATTTTTGTAGACTTTGCCCCATTCCTATCTCGTACACTTCTTGGCAGTCATGGACAAGAGCTATTGATAGAAGGTCCTGCTCAGG
TTCCAATGATGTCCCCAAATGGTTCTGTGCCTCCTATCTATGTGCCTCCTGGATATGCCCCACAGGTTATTGAAGACAATGGTGTTCGAA
GAGTTGTCGTGGTCCCTCAGGCACCAGAGTTTCACCCTGGTAGTCACACAGTTCTCCACCGTTCTCCACATCCTCCTCTACCTGGTTTCA
TTCCTGTCCCAACTATGATGCCGCCTCCACCACGTCATATGTACTCACCCGTGACTGGAGCTGGAGACATGACAACACAGTATATGCCAC
AGTATCAGTCTTCACAAGTCTATGGAGATGTAGATGCTCACTCTACACATGGAAGGTCCAACTTTAGAGATGAACGATCTAGTAAAACAT
ATGAACGTTTGCAGAAAAAATTGAAGGATCGCCAAGGAACACAGAAAGATAAAATGAGCAGTCCACCATCATCACCCCAGAAATGCCCTT
CTCCCATTAATGAACATAATGGACTTATAAAAGGACAAATTGCTGGTGGTATAAACACAGGATCAGCAAAAATCAAGTCTGGGAAGGGGA
AAGGTGGTACACAAGTTGATACAGAAATTGAAGAAAAAGATGAAGAAACTAAAGCATTTGAAGCACTTCTTTCCAACATTGTCAAACCAG
TGGCCTCCGACATCCAGGCAAGGACAGTAGTACTTACCTGGTCACCACCTTCCAGCCTCATTAATGGTGAAACAGATGAAAGTAGTGTAC
CAGAGCTCTATGGTTATGAAGTTCTGATCTCAAGTACTGGAAAAGATGGGAAATACAAAAGTGTATATGTAGGAGAAGAAACAAATATCA
CTTTAAATGATCTCAAGCCAGCCATGGATTACCATGCAAAAGTCCAGGCAGAATATAATTCTATAAAGGGAACTCCTTCAGAGGCTGAAA
TCTTTACCACCTTGAGCTGTGAACCTGATATACCTAATCCACCAAGGATAGCCAATCGGACCAAAAATTCACTCACTTTGCAATGGAAGG
CACCTAGTGACAATGGTTCTAAAATCCAAAACTTTGTATTAGAATGGGATGAAGGAAAAGGAAATGGAGAATTTTGTCAGTGTTACATGG
GCTCACAGAAACAATTTAAAATTACTAAACTTTCACCAGCAATGGGCTGTAAATTCAGACTATCGGCCAGAAATGACTATGGTACAAGTG
GTTTTAGTGAAGAAGTCTTATATTACACCTCAGGCTGTGCTCCTTCTATGCCAGCAAGTCCTGTATTAACCAAGGCTGGAATTACTTGGT
TATCCTTACAATGGAGTAAGCCCTCAGGAACACCATCAGATGAAGGAATTTCTTACATTTTAGAGATGGAGGAAGAAACTTCAGGATATG
GTTTTAAGCCTAAATATGATGGAGAAGATCTTGCTTACACAGTGAAAAATCTCAGACGTAGTACTAAGTATAAATTTAAGGTTATTGCTT
ACAACTCAGAAGGTAAAAGTAATCCAAGTGAAGTAGTAGAATTTACTACTTGCCCTGATAAACCAGGCATACCTGTAAAGCCTTCAGTGA
AAGGAAAGATACATTCACACAGTTTTAAAATAACCTGGGATCCACCAAAAGACAATGGCGGAGCAACCATCAATAAATATGTAGTGGAGA
TGGCAGAAGGTTCTAACGGAAACAAATGGGAAATGATATACAGTGGTGCTACCAGGGAACATCTTTGTGATCGACTGAATCCAGGCTGTT
TCTATCGTTTACGAGTTTACTGCATCAGTGATGGAGGACAGAGTGCGGTCTCTGAATCTTTACTTGTGCAGACTCCAGCTGTGCCTCCTG
GCCCATGCCTCCCTCCCAGATTACAGGGTAGACCCAAAGCAAAAGAAATACAGTTACGATGGGGACCCCCTCTGGTTGATGGTGGATCAC
CCATTTCCTGTTACAGTGTGGAAATGTCTCCTATAGAAAAAGATGAACCTAGAGAAGTTTACCAAGGTTCTGAAGTAGAATGTACAGTGA
GCAGCCTTCTTCCTGGAAAGACATACAGCTTCAGACTACGTGCAGCTAACAAAATGGGGTTTGGACCATTTTCAGAAAAATGTGATATTA
CTACAGCCCCTGGGCCACCAGATCAGTGCAAGCCCCCTCAAGTGACATGTAGATCTGCAACTTGTGCACAAGTGAATTGGGAGGTTCCTT
TGAGTAATGGAACAGATGTCACTGAATATCGACTGGAGTGGGGAGGAGTTGAAGGAAGTATGCAGATATGTTACTGTGGGCCTGGTCTCA
GTTATGAAATAAAAGGACTTTCACCAGCAACTACCTATTATTGCAGGGTCCAGGCTCTGAGTGTTGTGGGTGCAGGCCCTTTCAGTGAAG
TAGTAGCCTGTGTGACTCCACCATCAGTTCCTGGCATTGTGACCTGTCTTCAAGAAATAAGCGATGATGAGATAGAAAATCCCCATTATT
CACCTTCTACATGCCTTGCAATAAGCTGGGAAAAGCCTTGTGATCATGGTTCGGAAATCCTTGCCTACAGCATAGACTTTGGAGATAAAC
AATCCCTAACAGTGGGAAAGGTTACAAGCTATATTATCAACAATTTGCAACCAGATACAACATACAGAATACGAATTCAAGCCTTGAATA
GCCTTGGAGCTGGTCCTTTCAGCCATATGATAAAATTAAAAACTAAGCCTCTCCCTCCTGATCCACCTCGTCTGGAATGTGTTGCCTTTA
GCCACCAGAACCTTAAGCTGAAATGGGGAGAAGGAACTCCAAAGACATTGTCAACCGATTCTATTCAGTACCACCTTCAGATGGAGGATA
AGAATGGACGGTTTGTATCCCTATACAGAGGACCATGTCATACATACAAAGTACAAAGACTTAATGAGTCAACATCCTATAAATTCTGTA
TTCAAGCTTGTAATGAAGCTGGGGAAGGTCCCCTCTCCCAAGAATATATTTTCACTACTCCAAAATCTGTCCCAGCTGCCTTGAAAGCCC
CCAAAATAGAGAAAGTAAATGATCACATTTGTGAAATTACATGGGAGTGTTTACAGCCAATGAAAGGTGATCCAGTTATTTACAGTCTTC
AAGTTATGTTGGGAAAAGATTCAGAATTCAAACAGATTTACAAGGGTCCCGACTCTTCCTTCCGGTATTCCAGCCTTCAGCTGAACTGTG
AATATCGCTTCCGTGTATGTGCCATTCGCCAGTGCCAAGACTCTCTGGGACACCAGGACCTCGTAGGTCCCTACAGCACCACAGTGCTCT
TCATCTCTCAGAGGACTGAACCACCAGCCAGCACCAACAGAGACACTGTGGAAAGCACAAGGACCCGACGGGCACTGAGTGACGAGCAGT
GTGCTGCCGTCATCCTTGTGCTGTTTGCTTTCTTTTCCATTTTGATTGCCTTTATCATTCAGTACTTTGTAATCAAGTGAAAATATAACT
TTATTTTTTAACTCTATTACATTTTATTTTGTCATGTACTAAAATTATTTCTGTATTGCTTTTATAAAAAACAGTGGCATTTAGCACTGG
CATTGAGACTATAGCACATCATTTTTGCCATTTTCAGTGCTTATATTGTTAGGTAGAGGCTGGCACTTTATTAGAATGCAAGCCACAAAA
ATATCAATTTTGTTTTTTTTGTTAGGGTGGGTCTTCTTTTTTTCTTTCCCTCTCTCTTTTTTTAACAAATGCCTTCTTATAGAAAAACTT
TCTAAGAGGCAACAATTTAGAATGGATATTTTGACGAATCGGCATGAGTGTAACAGTGATAACCTGATCTGTTTGTTTTAAAGATTATTA
CCAAGTGAAAAATTCAGAATGAATAGAATTTACACTAACATGCTATATAAAATGTTAAAGTCTGATGCTGTGAAAGCAATCTAGTGCTAT
ATTTCTACCTCCTCATTTGTCTTAATTATTTGGTAAGTGGGATTATGATGAGTAACTGGAGGGGCTTAGAAACAAAAACTGGATGAAAGA
GTATGCATGAAGAAAAGCTTCTTTGATAAATGTGGAGTTCTTCATTATAAATATATATTCATGAATTCACAGATAAGTACTTAAAGAACA
GACAGTTTACTTGGCCTAAAAATATTTTGATGTTTACTCAAAAAGTACCTCTTCAGGTCTTGAGAACATGGAAAAGAATTGAGTGCTTTT
AAATACTTTTTAGAAAGTAATCATAAAAGTAAATTGAATTTCAAACCTATTTGGCTTCTGTTTTGTGAACCTTTGAACTATATGTATGTG
TATAAGGGTATACACATACATATATGGCATATAACAAGTGTACACATATACACATAACAAGTGTAGAAGTATATATTACATACATACACT
CACTCTGTCTGGTATAGGCTAATTTTGAAGAACTCCCATAAGTTTCTGCTGCTTCTCCCATAACTGCTGCCACCACCATCAGAATTCATA
ATCAAACCTAACCTTTTTGTTTGGGGCACCAAATCTGAAGACAAAATTAATTTGCACCAGTAAACTTCAAGCTGCTTTCTTTCTTGAAAA
CTAAACGTTTAACGTATAATGTCTGTTTGGATACTGTTCCAAATTGTTGATTGCATGTGGTTAATGTTGCATTAGAGCACTTTGCAATTG
CATAATTCATTAATGTTTTGTGAGCTTGCATTTGTGAGTTATTGGATGATCAGACTGAATTTTGTCAAGTATCACATTGTACATCTTGCC
TAGATGTCGATGACTGCAAGTAATAATACAGTTTATAATGAAACTATCTACAATTCTTGTTTTAGCACATCTGTTATCCGTAAAACACCT
GTAACTAGCTTTTTTAATTTATTATTTGAATTTTAGGATAGCGAATCACTAATTTTTAGTTGCTGAGGTTGGCATTTTAGTGATTATTAA
GCACTTCTGTCAGTCTTTGAAAAAAGAACGTATTTTTTGTGCTTTGAAGATCTCTGAAGAATTTCTTTTATAATAGAATGGGCATGTATT
GTAACAGTTTTATGTCAAATGATCTGTGCTGTAGAAAAACATTAACCCTTGTTCAAAAAAGAAATGGATAAACTTGGCCTTTCTAAGTGG
TAAGAATGACCTGTCACTATAATATACTGTATGTTTACATTTTATTTAAATTTAATCTCTTATGTATAGGGTGATAACCTTCCCCAGAAA
CAACAGTGATTGCGATTGTTTTCTAGAAACTTCTTTAAAGTGCCACATTTGGCAGTACAAATGAGTCTGAGTGTAATAGCCCAGAGATTT
ATATATAGTTGAATGTCTAAAATGGTAAAATGTGCCACTGTGTCAAGTTACAGTGGCTTATGTTTTTCATAGTAATTCAAATGAACTTCC
TATTTTTGATAGTAAATGTCATTTAATAGTATACTTGCCATTTGAGCCTCACTGCAAAATTAGTGCAGAGGAGAAAACAATTTTTAATGT
AATCTTGATTTTACCTCATATACTGTACATTCCAAAAACTCTAAACTTTTTAAAGATTATAGATACACTACCAAACATATCACCTTAAAA
TTGTATAAGGCTGAATGAACTTCATACAAATGAAAAAAATCTCATAAAAATACATAAACTATGTAGCAAAAGTATCTGTAAAATCCATGG


Top

FusionGenePPI for NBEA_FNDC3A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NBEASTRN4, DTNBP1, NOTCH1, VCP, FOSL2, RD3, TMEM17, PTPRH, ALOXE3, SHC4, RBM48, MRPL21, NAB2, STRADBFNDC3AELAVL1, APP, SPINT2, TMEM51, KCNK16, DLK1, HERC2, EVC2, TMEM17, HNRNPD, SORT1, NIPSNAP1, SMC3, VAPA, SYNCRIP, FAM46A, RBM45, CEP170P1, BAG6, CENPU, FPR2, SYT3, IL27RA, CD1E, FADS3, CLEC2D, PDGFRB, PCDHGA5, GRAMD1B, GRPR, SLC22A16, AP3S1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NBEA_FNDC3A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NBEA_FNDC3A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNBEAC0004352Autistic Disorder2CTD_human
HgeneNBEAC0023893Liver Cirrhosis, Experimental1CTD_human