FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23489

FusionGeneSummary for NBAS_RASGRP3

check button Fusion gene summary
Fusion gene informationFusion gene name: NBAS_RASGRP3
Fusion gene ID: 23489
HgeneTgene
Gene symbol

NBAS

RASGRP3

Gene ID

51594

25780

Gene nameneuroblastoma amplified sequenceRAS guanyl releasing protein 3
SynonymsILFS2|NAG|SOPHGRP3
Cytomap

2p24.3

2p22.3

Type of geneprotein-codingprotein-coding
Descriptionneuroblastoma-amplified sequenceNAG/BC035112 fusionNAG/FAM49A fusionneuroblastoma-amplified gene proteinras guanyl-releasing protein 3CalDAG-GEFIIIRAS guanyl releasing protein 3 (calcium and DAG-regulated)calcium and DAG-regulated guanine nucleotide exchange factor IIIcalcium- and diacylglycerol-regulated guanine nucleotide exchange factor IIIguanine n
Modification date2018051920180522
UniProtAcc

A2RRP1

Q8IV61

Ensembl transtripts involved in fusion geneENST00000441750, ENST00000281513, 
ENST00000402538, ENST00000403687, 
ENST00000407811, ENST00000482731, 
Fusion gene scores* DoF score11 X 10 X 7=7702 X 2 X 2=8
# samples 122
** MAII scorelog2(12/770*10)=-2.68182403997375
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: NBAS [Title/Abstract] AND RASGRP3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-AX-A3G3-01ANBASchr2

15415608

-RASGRP3chr2

33787796

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000441750ENST00000402538NBASchr2

15415608

-RASGRP3chr2

33787796

+
Frame-shiftENST00000441750ENST00000403687NBASchr2

15415608

-RASGRP3chr2

33787796

+
Frame-shiftENST00000441750ENST00000407811NBASchr2

15415608

-RASGRP3chr2

33787796

+
5CDS-intronENST00000441750ENST00000482731NBASchr2

15415608

-RASGRP3chr2

33787796

+
In-frameENST00000281513ENST00000402538NBASchr2

15415608

-RASGRP3chr2

33787796

+
Frame-shiftENST00000281513ENST00000403687NBASchr2

15415608

-RASGRP3chr2

33787796

+
Frame-shiftENST00000281513ENST00000407811NBASchr2

15415608

-RASGRP3chr2

33787796

+
5CDS-intronENST00000281513ENST00000482731NBASchr2

15415608

-RASGRP3chr2

33787796

+

Top

FusionProtFeatures for NBAS_RASGRP3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NBAS

A2RRP1

RASGRP3

Q8IV61

Involved in Golgi-to-endoplasmic reticulum (ER)retrograde transport; the function is proposed to depend on itsassociation in the NRZ complex which is believed to play a role inSNARE assembly at the ER (PubMed:19369418).{ECO:0000269|PubMed:19369418, ECO:0000305}. Guanine nucleotide exchange factor (GEF) for Ras andRap1. {ECO:0000269|PubMed:10934204}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNBASchr2:15415608chr2:33787796ENST00000281513-44521421_142519082372Compositional biasNote=Poly-Thr
HgeneNBASchr2:15415608chr2:33787796ENST00000441750-42501421_142517882252Compositional biasNote=Poly-Thr
HgeneNBASchr2:15415608chr2:33787796ENST00000281513-4452130_16919082372RepeatNote=WD 1
HgeneNBASchr2:15415608chr2:33787796ENST00000281513-4452316_35519082372RepeatNote=WD 2
HgeneNBASchr2:15415608chr2:33787796ENST00000441750-4250130_16917882252RepeatNote=WD 1
HgeneNBASchr2:15415608chr2:33787796ENST00000441750-4250316_35517882252RepeatNote=WD 2

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNBASchr2:15415608chr2:33787796ENST00000281513-44522242_224719082372Compositional biasNote=Poly-Leu
HgeneNBASchr2:15415608chr2:33787796ENST00000441750-42502242_224717882252Compositional biasNote=Poly-Leu
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000402538+1719433_444688691Calcium binding1
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000402538+1719462_473688691Calcium binding2
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000403687+1618433_444688691Calcium binding1
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000403687+1618462_473688691Calcium binding2
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000407811+1517433_444687690Calcium binding1
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000407811+1517462_473687690Calcium binding2
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000402538+1719152_383688691DomainRas-GEF
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000402538+17193_125688691DomainN-terminal Ras-GEF
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000402538+1719420_455688691DomainEF-hand 1
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000402538+1719449_484688691DomainEF-hand 2
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000403687+1618152_383688691DomainRas-GEF
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000403687+16183_125688691DomainN-terminal Ras-GEF
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000403687+1618420_455688691DomainEF-hand 1
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000403687+1618449_484688691DomainEF-hand 2
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000407811+1517152_383687690DomainRas-GEF
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000407811+15173_125687690DomainN-terminal Ras-GEF
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000407811+1517420_455687690DomainEF-hand 1
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000407811+1517449_484687690DomainEF-hand 2
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000402538+1719494_544688691Zinc fingerPhorbol-ester/DAG-type
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000403687+1618494_544688691Zinc fingerPhorbol-ester/DAG-type
TgeneRASGRP3chr2:15415608chr2:33787796ENST00000407811+1517494_544687690Zinc fingerPhorbol-ester/DAG-type


Top

FusionGeneSequence for NBAS_RASGRP3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NBAS_ENST00000441750_chr2_15415608_-_RASGRP3_ENST00000402538_chr2_33787796_+_1791aa
MAAPESGPALSPGTAEGEEETILYDLLVNTEWPPETEVQPRGNQKHGASFIITKAIRDRLLFLRQYIWYSPAPFLLPDGLVRLVNKQINW
HLVLASNGKLLAAVQDQCVEIRSAKDDFTSIIGKCQVPKDPKPQWRRVAWSYDCTLLAYAESTGTVRVFDLMGSELFVISPASSFIGDLS
YAIAGLIFLEYKASAQWSAELLVINYRGELRSYLVSVGTNQSYQESHCFSFSSHYPHGINTAIYHPGHRLLLVGGCETAEVGMSKASSCG
LSAWRVLSGSPYYKQVTNGGDGVTAVPKTLGLLRMLSVKFYSRQGQEQDGIFKMSLSPDGMLLAAIHFSGKLSIWAIPSLKQQGEWGQNE
QPGYDDLNPDWRLSTEKRKKIKDKESFYPLIDVNWWADSAVTLARCSGALTVSSVKTLKNLLGKSCEWFEPSPQVTATHDGGFLSLECEI
KLAPKRSRLETRAGEEDEGEEDSDSDYEISAKARYFGYIKQGLYLVTEMERFAPPRKRPRTITKNYRLVSLRSTTPEELYQRKIESEEYE
EALSLAHTYGLDTDLVYQRQWRKSAVNVASIQNYLSKIKKRSWVLHECLERVPENVDAAKELLQYGLKGTDLEALLAIGKGADDGRFTLP
GEIDIDSISYEELSPPDEEPAKNKKEKELKKRQELLKLVNFSKLTLEQKELCRCRRKLLTYLDRLATYEEILGVPHASEQRYDAEFFKKF
RNQNIVLSARTYAQESNVQALEILFTYHGSDLLPHRLAILSNFPETTSPHEYSVLLPEACFNGDSLMIIPWHEHKHRAKDWCEELACRMV
VEPNLQDESEFLYAAQPELLRFRMTQLTVEKVMDWYQTRAEEIEHYARQLQQKIIPDQDQLMAIALECIYTCERNDQLCLCYDLLECLPE
RGYGDKTEATTKLHDMVDQLEQILSVSELLEKHGLEKPISFVKNTQSSSEEARKLMVRLTRHTGRKQPPVSESHWRTLLQDMLTMQQNVY
TCLDSDACYEIFTESLLCSSRLENIHLAGQMMHCSACSENPPAGIAHKGKPHYRVSYEKSIDLVLAASREYFNSSTNLTDSCMDLARCCL
QLITDRPPAIQEELDLIQAVGCLEEFGVKILPLQVRLCPDRISLIKECISQSPTCYKQSTKLLGLAELLRVAGENPEERRGQVLILLVEQ
ALRFHDYKAASMHCQELMATGYPKSWDVCSQLGQSEGYQDLATRQELMAFALTHCPPSSIELLLAASSSLQTEILYQRVNFQIHHEGGEN
ISASPLTSKAVQEDEVGVPGSNSADLLRWTTATTMKVLSNTTTTTKAVLQAVSDGQWWKKSLTYLRPLQGQKCGGAYQIGTTANEDLEKQ
GCHPFYESVISNPFVAESEGTYDTYQHVPVESFAEVLLRTGKLAEAKNKGEVFPTTEVLLQLASEALPNDMTLALAYLLALPQVLDANRC
FEKQSPSALSLQLAAYYYSLQIYARLAPCFRDKCHPLYRADPKELIKMVTRHVTRHEHEAWPEDLISLTKQLHCYNERLLDFTQAQILQG
LRKGVDVQRFTADDQYKRETILGLAETLEESVYSIAISLAQRYSVSRWEVFMTHLEFLFTDSGLSTLEIENRAQDLHLFETLKTDPEAFH
QHMVKYIYPTIGGFDHERLQYYFTLLENCGCADLGNCAIKPETHIRLLKKFKVVASGLNYKKLTDENMSPLEALEPVLSSQNILSISKLV

>In-frame_NBAS_ENST00000281513_chr2_15415608_-_RASGRP3_ENST00000402538_chr2_33787796_+_1911aa
MAAPESGPALSPGTAEGEEETILYDLLVNTEWPPETEVQPRGNQKHGASFIITKAIRDRLLFLRQYIWYSPAPFLLPDGLVRLVNKQINW
HLVLASNGKLLAAVQDQCVEIRSAKDDFTSIIGKCQVPKDPKPQWRRVAWSYDCTLLAYAESTGTVRVFDLMGSELFVISPASSFIGDLS
YAIAGLIFLEYKASAQWSAELLVINYRGELRSYLVSVGTNQSYQESHCFSFSSHYPHGINTAIYHPGHRLLLVGGCETAEVGMSKASSCG
LSAWRVLSGSPYYKQVTNGGDGVTAVPKTLGLLRMLSVKFYSRQGQEQDGIFKMSLSPDGMLLAAIHFSGKLSIWAIPSLKQQGEWGQNE
QPGYDDLNPDWRLSTEKRKKIKDKESFYPLIDVNWWADSAVTLARCSGALTVSSVKTLKNLLGKSCEWFEPSPQVTATHDGGFLSLECEI
KLAPKRSRLETRAGEEDEGEEDSDSDYEISAKARYFGYIKQGLYLVTEMERFAPPRKRPRTITKNYRLVSLRSTTPEELYQRKIESEEYE
EALSLAHTYGLDTDLVYQRQWRKSAVNVASIQNYLSKIKKRSWVLHECLERVPENVDAAKELLQYGLKGTDLEALLAIGKGADDGRFTLP
GEIDIDSISYEELSPPDEEPAKNKKEKELKKRQELLKLVNFSKLTLEQKELCRCRRKLLTYLDRLATYEEILGVPHASEQRYDAEFFKKF
RNQNIVLSARTYAQESNVQALEILFTYHGSDLLPHRLAILSNFPETTSPHEYSVLLPEACFNGDSLMIIPWHEHKHRAKDWCEELACRMV
VEPNLQDESEFLYAAQPELLRFRMTQLTVEKVMDWYQTRAEEIEHYARQVDCALSLIRLGMERNIPGLLVLCDNLVTLETLVYEARCDVT
LTLKELQQMKDIEKLRLLMNSCSEDKYVTSAYQWMVPFLHRCEKQSPGVANELLKEYLVTLAKGDLKFPLKIFQHSKPDLQQKIIPDQDQ
LMAIALECIYTCERNDQLCLCYDLLECLPERGYGDKTEATTKLHDMVDQLEQILSVSELLEKHGLEKPISFVKNTQSSSEEARKLMVRLT
RHTGRKQPPVSESHWRTLLQDMLTMQQNVYTCLDSDACYEIFTESLLCSSRLENIHLAGQMMHCSACSENPPAGIAHKGKPHYRVSYEKS
IDLVLAASREYFNSSTNLTDSCMDLARCCLQLITDRPPAIQEELDLIQAVGCLEEFGVKILPLQVRLCPDRISLIKECISQSPTCYKQST
KLLGLAELLRVAGENPEERRGQVLILLVEQALRFHDYKAASMHCQELMATGYPKSWDVCSQLGQSEGYQDLATRQELMAFALTHCPPSSI
ELLLAASSSLQTEILYQRVNFQIHHEGGENISASPLTSKAVQEDEVGVPGSNSADLLRWTTATTMKVLSNTTTTTKAVLQAVSDGQWWKK
SLTYLRPLQGQKCGGAYQIGTTANEDLEKQGCHPFYESVISNPFVAESEGTYDTYQHVPVESFAEVLLRTGKLAEAKNKGEVFPTTEVLL
QLASEALPNDMTLALAYLLALPQVLDANRCFEKQSPSALSLQLAAYYYSLQIYARLAPCFRDKCHPLYRADPKELIKMVTRHVTRHEHEA
WPEDLISLTKQLHCYNERLLDFTQAQILQGLRKGVDVQRFTADDQYKRETILGLAETLEESVYSIAISLAQRYSVSRWEVFMTHLEFLFT
DSGLSTLEIENRAQDLHLFETLKTDPEAFHQHMVKYIYPTIGGFDHERLQYYFTLLENCGCADLGNCAIKPETHIRLLKKFKVVASGLNY
KKLTDENMSPLEALEPVLSSQNILSISKLVPKIPEKDGQMLSPSSLYTIWLQKLFWTGDPHLIKQVPGSSPEWLHAYDVCMKYFDRLHPG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NBAS_ENST00000441750_chr2_15415608_-_RASGRP3_ENST00000402538_chr2_33787796_+_5373nt
ATGGCGGCCCCCGAGTCAGGGCCGGCTTTGAGTCCAGGCACTGCAGAGGGTGAGGAGGAGACGATTCTCTATGACTTGTTGGTCAACACC
GAGTGGCCACCGGAGACTGAAGTACAGCCTAGAGGCAACCAAAAACATGGTGCATCCTTTATCATCACGAAAGCAATTCGAGATCGTTTA
TTATTTTTACGCCAATACATCTGGTACAGCCCGGCACCTTTTTTGCTCCCTGATGGACTGGTTCGCTTGGTTAATAAACAGATAAACTGG
CATTTGGTACTTGCAAGCAATGGAAAGCTTTTGGCTGCTGTTCAAGATCAGTGTGTGGAAATCAGGTCTGCAAAAGATGATTTTACATCC
ATTATTGGGAAATGTCAAGTTCCGAAAGACCCGAAACCCCAGTGGAGACGGGTAGCATGGAGTTACGATTGTACCCTACTGGCCTATGCC
GAAAGCACAGGAACTGTGAGGGTGTTTGATCTCATGGGAAGTGAACTCTTTGTCATTTCCCCGGCATCTAGTTTTATAGGTGACTTAAGC
TATGCCATTGCTGGGTTGATATTTTTAGAATATAAAGCAAGTGCACAGTGGTCTGCAGAACTCCTGGTCATCAATTACCGAGGAGAACTT
AGAAGTTACCTTGTAAGTGTTGGAACAAATCAGAGCTACCAAGAAAGTCACTGTTTCAGCTTCAGTAGTCATTATCCTCATGGAATCAAC
ACAGCTATTTACCACCCTGGTCACAGACTTTTACTTGTTGGTGGATGTGAAACTGCTGAAGTAGGCATGTCAAAAGCTTCTAGCTGTGGC
CTTTCTGCCTGGAGAGTTCTTTCAGGATCACCGTATTATAAGCAGGTTACTAATGGTGGAGACGGGGTTACTGCAGTACCGAAGACACTG
GGATTATTAAGGATGTTAAGTGTCAAGTTTTACAGTCGCCAGGGACAAGAACAGGATGGAATTTTTAAGATGAGCCTTTCTCCAGATGGG
ATGCTCCTGGCAGCCATTCACTTCTCAGGGAAACTGAGCATCTGGGCGATTCCATCTCTGAAGCAACAAGGGGAATGGGGTCAAAATGAG
CAGCCAGGCTATGATGACCTTAATCCTGATTGGAGGCTCTCTACTGAGAAGAGAAAAAAAATCAAAGATAAAGAGTCCTTTTACCCACTG
ATAGATGTCAATTGGTGGGCAGACAGTGCAGTGACTTTAGCTCGATGCTCTGGTGCTTTAACTGTTTCATCTGTGAAAACTTTGAAGAAT
TTACTGGGAAAATCCTGTGAATGGTTTGAACCATCACCTCAAGTCACTGCTACCCATGATGGGGGATTTTTAAGTTTGGAGTGTGAGATT
AAACTTGCCCCCAAACGATCTCGTTTGGAGACTAGAGCTGGAGAAGAAGATGAAGGAGAAGAGGATTCTGATTCTGATTATGAAATATCT
GCCAAGGCTCGCTACTTTGGTTATATAAAACAGGGCCTTTACTTGGTGACTGAAATGGAGCGATTTGCACCACCACGGAAACGCCCACGA
ACCATTACTAAAAACTACCGCCTTGTGAGTTTGCGCTCCACGACACCAGAGGAACTTTATCAGAGGAAGATTGAAAGTGAAGAGTATGAG
GAAGCCTTGTCCTTGGCTCATACCTACGGCCTGGATACTGACCTTGTATATCAGAGGCAGTGGAGGAAGTCAGCGGTCAACGTTGCTTCA
ATTCAGAATTATTTGAGTAAAATAAAGAAGCGATCCTGGGTTCTCCATGAGTGTTTGGAAAGAGTTCCTGAAAATGTGGATGCTGCAAAA
GAACTGCTTCAGTATGGATTAAAAGGCACAGACCTGGAGGCTCTTTTAGCAATAGGGAAAGGAGCAGATGATGGCAGATTTACATTACCT
GGTGAAATAGACATTGACAGTATCTCCTATGAAGAGCTTTCACCACCTGATGAAGAGCCTGCCAAGAATAAAAAGGAAAAGGAGCTCAAG
AAGAGACAAGAACTACTGAAATTAGTGAACTTTTCCAAGTTGACACTGGAACAAAAGGAACTTTGCCGTTGTAGACGGAAGTTATTAACC
TACTTAGATCGACTTGCAACATATGAGGAAATCCTAGGAGTGCCTCATGCATCTGAACAGAGATATGATGCTGAATTCTTTAAGAAATTC
AGAAATCAGAATATTGTTCTCTCAGCAAGAACTTATGCTCAGGAAAGTAATGTACAAGCCCTGGAAATTCTGTTTACTTACCATGGTTCC
GACCTGCTTCCTCATCGCCTTGCAATTCTGTCCAACTTTCCAGAGACCACTTCTCCACATGAATATTCTGTTTTGCTGCCCGAAGCTTGT
TTTAACGGTGACTCCCTGATGATCATTCCTTGGCATGAACATAAACACCGAGCTAAAGATTGGTGCGAGGAGTTGGCTTGCAGAATGGTT
GTTGAGCCGAATCTCCAAGATGAAAGTGAATTCTTGTATGCTGCACAGCCTGAGTTACTAAGGTTCAGGATGACCCAGCTTACGGTGGAG
AAGGTTATGGACTGGTATCAGACCAGAGCAGAGGAAATAGAGCATTATGCTCGGCAGCTGCAGCAAAAAATTATTCCTGATCAGGACCAA
CTGATGGCAATAGCACTAGAGTGCATCTATACCTGTGAACGAAATGATCAACTCTGTCTTTGCTATGACCTACTAGAATGTCTGCCAGAA
AGAGGATATGGTGATAAGACAGAGGCAACCACAAAGCTTCATGACATGGTAGACCAACTGGAACAAATTCTCAGTGTGTCAGAGCTTTTG
GAAAAACATGGACTCGAGAAACCAATTTCATTTGTTAAAAACACTCAATCTAGCTCAGAAGAGGCACGCAAGCTGATGGTTAGATTGACG
AGGCACACTGGCCGGAAGCAGCCTCCTGTCAGTGAGTCTCATTGGAGAACGTTGCTGCAAGACATGTTAACTATGCAGCAGAATGTATAC
ACATGTCTAGATTCTGATGCCTGCTATGAGATATTTACAGAAAGCCTTCTGTGCTCTAGTCGCCTTGAAAACATCCACCTGGCTGGACAG
ATGATGCACTGCAGTGCTTGTTCAGAAAATCCTCCAGCTGGTATAGCCCATAAAGGGAAACCCCACTACAGGGTCAGCTACGAAAAGAGT
ATTGACTTGGTTTTGGCTGCCAGCAGAGAGTACTTCAATTCTTCTACCAACCTCACTGATAGCTGCATGGATCTAGCCAGGTGCTGCTTA
CAACTGATAACAGACAGACCCCCTGCCATTCAAGAGGAGCTAGATCTTATCCAAGCCGTTGGATGTCTTGAAGAATTTGGGGTAAAGATC
CTGCCTTTGCAAGTGCGATTGTGCCCTGATCGGATCAGTCTCATCAAGGAGTGTATTTCCCAGTCCCCCACATGCTATAAACAATCCACC
AAGCTTCTGGGCCTTGCTGAGCTGCTGAGGGTTGCAGGTGAGAACCCAGAAGAAAGGCGGGGACAGGTTCTAATCCTTTTAGTGGAGCAG
GCACTTCGCTTCCATGACTACAAAGCAGCCAGTATGCATTGTCAGGAGCTGATGGCCACAGGTTATCCTAAAAGTTGGGATGTTTGTAGC
CAGTTAGGACAATCAGAAGGTTACCAGGACTTGGCCACTCGTCAAGAGCTCATGGCTTTTGCTTTGACACATTGCCCTCCTAGCAGCATT
GAACTTCTTTTGGCAGCTAGCAGCTCTCTGCAGACAGAAATTCTTTATCAAAGAGTGAATTTCCAGATCCATCATGAAGGAGGGGAAAAT
ATCAGTGCTTCACCATTAACTAGTAAAGCAGTACAAGAGGATGAAGTAGGTGTTCCAGGTAGCAATTCAGCTGACCTATTGCGCTGGACC
ACTGCTACCACCATGAAAGTCCTTTCCAACACCACAACCACCACCAAAGCGGTGCTGCAGGCCGTCAGTGATGGGCAGTGGTGGAAGAAG
TCTTTAACTTACCTTCGACCCCTTCAGGGGCAAAAATGTGGTGGTGCATATCAAATCGGAACTACAGCCAATGAAGATCTAGAGAAACAA
GGGTGTCATCCTTTTTATGAATCTGTCATCTCAAATCCTTTTGTCGCTGAGTCTGAAGGGACCTATGACACCTATCAGCATGTTCCAGTG
GAAAGCTTTGCAGAAGTATTGCTGAGAACTGGAAAATTGGCAGAGGCTAAAAATAAAGGAGAAGTATTTCCAACAACTGAAGTTCTCTTG
CAACTAGCAAGTGAAGCCTTGCCAAATGACATGACCTTGGCTCTTGCTTACCTTCTTGCCTTACCACAAGTGTTAGATGCTAACCGGTGC
TTTGAAAAGCAGTCCCCCTCTGCATTATCTCTCCAGCTGGCAGCGTATTACTATAGCCTCCAGATCTATGCCCGATTGGCCCCATGTTTC
AGGGACAAGTGCCATCCTCTTTACAGGGCTGATCCCAAAGAACTAATCAAGATGGTCACCAGGCATGTGACTCGACATGAGCACGAAGCC
TGGCCTGAAGACCTTATTTCACTGACCAAGCAGTTACACTGCTACAATGAACGTCTCCTGGATTTCACTCAGGCGCAGATCCTTCAGGGC
CTTCGGAAGGGTGTGGACGTGCAGCGGTTTACTGCAGATGACCAGTATAAAAGGGAAACTATCCTTGGTCTGGCAGAAACTCTAGAGGAA
AGCGTCTACAGCATTGCTATTTCTCTGGCACAACGTTACAGTGTCTCCCGCTGGGAAGTTTTTATGACCCATTTGGAGTTCCTCTTCACG
GACAGTGGTTTGTCCACACTAGAAATTGAAAATAGAGCCCAAGACCTTCATCTCTTTGAGACTTTGAAGACTGATCCAGAAGCCTTTCAC
CAGCACATGGTCAAGTATATTTACCCTACTATTGGTGGCTTTGATCACGAAAGGCTGCAGTATTATTTCACTCTTCTGGAAAACTGTGGC
TGTGCAGATTTGGGGAACTGTGCCATTAAACCAGAAACCCACATTCGACTGCTGAAGAAGTTTAAGGTTGTTGCATCAGGTCTTAATTAC
AAAAAGCTGACAGATGAAAACATGAGTCCTCTTGAAGCATTGGAGCCAGTTCTTTCAAGTCAAAATATCTTGTCTATTTCCAAACTTGTT
CCCAAAATCCCTGAAAAGGATGGACAGATGCTTTCCCCAAGCTCTCTGTACACCATCTGGTTACAGAAGTTGTTCTGGACTGGAGACCCT
CATCTCATTAAACAAGTCCCAGGCTCTTCACCGGAGTGGCTTCATGCCTATGATGTCTGCATGAAGTACTTTGATCGTCTCCACCCAGGT

>In-frame_NBAS_ENST00000281513_chr2_15415608_-_RASGRP3_ENST00000402538_chr2_33787796_+_5733nt
ATGGCGGCCCCCGAGTCAGGGCCGGCTTTGAGTCCAGGCACTGCAGAGGGTGAGGAGGAGACGATTCTCTATGACTTGTTGGTCAACACC
GAGTGGCCACCGGAGACTGAAGTACAGCCTAGAGGCAACCAAAAACATGGTGCATCCTTTATCATCACGAAAGCAATTCGAGATCGTTTA
TTATTTTTACGCCAATACATCTGGTACAGCCCGGCACCTTTTTTGCTCCCTGATGGACTGGTTCGCTTGGTTAATAAACAGATAAACTGG
CATTTGGTACTTGCAAGCAATGGAAAGCTTTTGGCTGCTGTTCAAGATCAGTGTGTGGAAATCAGGTCTGCAAAAGATGATTTTACATCC
ATTATTGGGAAATGTCAAGTTCCGAAAGACCCGAAACCCCAGTGGAGACGGGTAGCATGGAGTTACGATTGTACCCTACTGGCCTATGCC
GAAAGCACAGGAACTGTGAGGGTGTTTGATCTCATGGGAAGTGAACTCTTTGTCATTTCCCCGGCATCTAGTTTTATAGGTGACTTAAGC
TATGCCATTGCTGGGTTGATATTTTTAGAATATAAAGCAAGTGCACAGTGGTCTGCAGAACTCCTGGTCATCAATTACCGAGGAGAACTT
AGAAGTTACCTTGTAAGTGTTGGAACAAATCAGAGCTACCAAGAAAGTCACTGTTTCAGCTTCAGTAGTCATTATCCTCATGGAATCAAC
ACAGCTATTTACCACCCTGGTCACAGACTTTTACTTGTTGGTGGATGTGAAACTGCTGAAGTAGGCATGTCAAAAGCTTCTAGCTGTGGC
CTTTCTGCCTGGAGAGTTCTTTCAGGATCACCGTATTATAAGCAGGTTACTAATGGTGGAGACGGGGTTACTGCAGTACCGAAGACACTG
GGATTATTAAGGATGTTAAGTGTCAAGTTTTACAGTCGCCAGGGACAAGAACAGGATGGAATTTTTAAGATGAGCCTTTCTCCAGATGGG
ATGCTCCTGGCAGCCATTCACTTCTCAGGGAAACTGAGCATCTGGGCGATTCCATCTCTGAAGCAACAAGGGGAATGGGGTCAAAATGAG
CAGCCAGGCTATGATGACCTTAATCCTGATTGGAGGCTCTCTACTGAGAAGAGAAAAAAAATCAAAGATAAAGAGTCCTTTTACCCACTG
ATAGATGTCAATTGGTGGGCAGACAGTGCAGTGACTTTAGCTCGATGCTCTGGTGCTTTAACTGTTTCATCTGTGAAAACTTTGAAGAAT
TTACTGGGAAAATCCTGTGAATGGTTTGAACCATCACCTCAAGTCACTGCTACCCATGATGGGGGATTTTTAAGTTTGGAGTGTGAGATT
AAACTTGCCCCCAAACGATCTCGTTTGGAGACTAGAGCTGGAGAAGAAGATGAAGGAGAAGAGGATTCTGATTCTGATTATGAAATATCT
GCCAAGGCTCGCTACTTTGGTTATATAAAACAGGGCCTTTACTTGGTGACTGAAATGGAGCGATTTGCACCACCACGGAAACGCCCACGA
ACCATTACTAAAAACTACCGCCTTGTGAGTTTGCGCTCCACGACACCAGAGGAACTTTATCAGAGGAAGATTGAAAGTGAAGAGTATGAG
GAAGCCTTGTCCTTGGCTCATACCTACGGCCTGGATACTGACCTTGTATATCAGAGGCAGTGGAGGAAGTCAGCGGTCAACGTTGCTTCA
ATTCAGAATTATTTGAGTAAAATAAAGAAGCGATCCTGGGTTCTCCATGAGTGTTTGGAAAGAGTTCCTGAAAATGTGGATGCTGCAAAA
GAACTGCTTCAGTATGGATTAAAAGGCACAGACCTGGAGGCTCTTTTAGCAATAGGGAAAGGAGCAGATGATGGCAGATTTACATTACCT
GGTGAAATAGACATTGACAGTATCTCCTATGAAGAGCTTTCACCACCTGATGAAGAGCCTGCCAAGAATAAAAAGGAAAAGGAGCTCAAG
AAGAGACAAGAACTACTGAAATTAGTGAACTTTTCCAAGTTGACACTGGAACAAAAGGAACTTTGCCGTTGTAGACGGAAGTTATTAACC
TACTTAGATCGACTTGCAACATATGAGGAAATCCTAGGAGTGCCTCATGCATCTGAACAGAGATATGATGCTGAATTCTTTAAGAAATTC
AGAAATCAGAATATTGTTCTCTCAGCAAGAACTTATGCTCAGGAAAGTAATGTACAAGCCCTGGAAATTCTGTTTACTTACCATGGTTCC
GACCTGCTTCCTCATCGCCTTGCAATTCTGTCCAACTTTCCAGAGACCACTTCTCCACATGAATATTCTGTTTTGCTGCCCGAAGCTTGT
TTTAACGGTGACTCCCTGATGATCATTCCTTGGCATGAACATAAACACCGAGCTAAAGATTGGTGCGAGGAGTTGGCTTGCAGAATGGTT
GTTGAGCCGAATCTCCAAGATGAAAGTGAATTCTTGTATGCTGCACAGCCTGAGTTACTAAGGTTCAGGATGACCCAGCTTACGGTGGAG
AAGGTTATGGACTGGTATCAGACCAGAGCAGAGGAAATAGAGCATTATGCTCGGCAGGTGGACTGTGCATTGTCACTTATTCGACTTGGG
ATGGAGCGGAATATTCCTGGTTTGCTGGTTCTCTGTGACAATTTGGTTACTCTGGAAACATTGGTTTATGAAGCCAGGTGTGATGTAACT
CTAACCCTGAAAGAACTCCAGCAGATGAAAGACATTGAAAAACTAAGATTACTGATGAATAGTTGTTCTGAGGATAAATATGTGACAAGT
GCCTACCAGTGGATGGTTCCCTTTCTTCATCGTTGTGAGAAACAGTCGCCTGGTGTGGCTAATGAGCTATTAAAAGAATATTTAGTAACT
TTAGCTAAAGGGGACTTAAAATTTCCCCTGAAGATATTTCAGCATTCCAAACCAGATCTGCAGCAAAAAATTATTCCTGATCAGGACCAA
CTGATGGCAATAGCACTAGAGTGCATCTATACCTGTGAACGAAATGATCAACTCTGTCTTTGCTATGACCTACTAGAATGTCTGCCAGAA
AGAGGATATGGTGATAAGACAGAGGCAACCACAAAGCTTCATGACATGGTAGACCAACTGGAACAAATTCTCAGTGTGTCAGAGCTTTTG
GAAAAACATGGACTCGAGAAACCAATTTCATTTGTTAAAAACACTCAATCTAGCTCAGAAGAGGCACGCAAGCTGATGGTTAGATTGACG
AGGCACACTGGCCGGAAGCAGCCTCCTGTCAGTGAGTCTCATTGGAGAACGTTGCTGCAAGACATGTTAACTATGCAGCAGAATGTATAC
ACATGTCTAGATTCTGATGCCTGCTATGAGATATTTACAGAAAGCCTTCTGTGCTCTAGTCGCCTTGAAAACATCCACCTGGCTGGACAG
ATGATGCACTGCAGTGCTTGTTCAGAAAATCCTCCAGCTGGTATAGCCCATAAAGGGAAACCCCACTACAGGGTCAGCTACGAAAAGAGT
ATTGACTTGGTTTTGGCTGCCAGCAGAGAGTACTTCAATTCTTCTACCAACCTCACTGATAGCTGCATGGATCTAGCCAGGTGCTGCTTA
CAACTGATAACAGACAGACCCCCTGCCATTCAAGAGGAGCTAGATCTTATCCAAGCCGTTGGATGTCTTGAAGAATTTGGGGTAAAGATC
CTGCCTTTGCAAGTGCGATTGTGCCCTGATCGGATCAGTCTCATCAAGGAGTGTATTTCCCAGTCCCCCACATGCTATAAACAATCCACC
AAGCTTCTGGGCCTTGCTGAGCTGCTGAGGGTTGCAGGTGAGAACCCAGAAGAAAGGCGGGGACAGGTTCTAATCCTTTTAGTGGAGCAG
GCACTTCGCTTCCATGACTACAAAGCAGCCAGTATGCATTGTCAGGAGCTGATGGCCACAGGTTATCCTAAAAGTTGGGATGTTTGTAGC
CAGTTAGGACAATCAGAAGGTTACCAGGACTTGGCCACTCGTCAAGAGCTCATGGCTTTTGCTTTGACACATTGCCCTCCTAGCAGCATT
GAACTTCTTTTGGCAGCTAGCAGCTCTCTGCAGACAGAAATTCTTTATCAAAGAGTGAATTTCCAGATCCATCATGAAGGAGGGGAAAAT
ATCAGTGCTTCACCATTAACTAGTAAAGCAGTACAAGAGGATGAAGTAGGTGTTCCAGGTAGCAATTCAGCTGACCTATTGCGCTGGACC
ACTGCTACCACCATGAAAGTCCTTTCCAACACCACAACCACCACCAAAGCGGTGCTGCAGGCCGTCAGTGATGGGCAGTGGTGGAAGAAG
TCTTTAACTTACCTTCGACCCCTTCAGGGGCAAAAATGTGGTGGTGCATATCAAATCGGAACTACAGCCAATGAAGATCTAGAGAAACAA
GGGTGTCATCCTTTTTATGAATCTGTCATCTCAAATCCTTTTGTCGCTGAGTCTGAAGGGACCTATGACACCTATCAGCATGTTCCAGTG
GAAAGCTTTGCAGAAGTATTGCTGAGAACTGGAAAATTGGCAGAGGCTAAAAATAAAGGAGAAGTATTTCCAACAACTGAAGTTCTCTTG
CAACTAGCAAGTGAAGCCTTGCCAAATGACATGACCTTGGCTCTTGCTTACCTTCTTGCCTTACCACAAGTGTTAGATGCTAACCGGTGC
TTTGAAAAGCAGTCCCCCTCTGCATTATCTCTCCAGCTGGCAGCGTATTACTATAGCCTCCAGATCTATGCCCGATTGGCCCCATGTTTC
AGGGACAAGTGCCATCCTCTTTACAGGGCTGATCCCAAAGAACTAATCAAGATGGTCACCAGGCATGTGACTCGACATGAGCACGAAGCC
TGGCCTGAAGACCTTATTTCACTGACCAAGCAGTTACACTGCTACAATGAACGTCTCCTGGATTTCACTCAGGCGCAGATCCTTCAGGGC
CTTCGGAAGGGTGTGGACGTGCAGCGGTTTACTGCAGATGACCAGTATAAAAGGGAAACTATCCTTGGTCTGGCAGAAACTCTAGAGGAA
AGCGTCTACAGCATTGCTATTTCTCTGGCACAACGTTACAGTGTCTCCCGCTGGGAAGTTTTTATGACCCATTTGGAGTTCCTCTTCACG
GACAGTGGTTTGTCCACACTAGAAATTGAAAATAGAGCCCAAGACCTTCATCTCTTTGAGACTTTGAAGACTGATCCAGAAGCCTTTCAC
CAGCACATGGTCAAGTATATTTACCCTACTATTGGTGGCTTTGATCACGAAAGGCTGCAGTATTATTTCACTCTTCTGGAAAACTGTGGC
TGTGCAGATTTGGGGAACTGTGCCATTAAACCAGAAACCCACATTCGACTGCTGAAGAAGTTTAAGGTTGTTGCATCAGGTCTTAATTAC
AAAAAGCTGACAGATGAAAACATGAGTCCTCTTGAAGCATTGGAGCCAGTTCTTTCAAGTCAAAATATCTTGTCTATTTCCAAACTTGTT
CCCAAAATCCCTGAAAAGGATGGACAGATGCTTTCCCCAAGCTCTCTGTACACCATCTGGTTACAGAAGTTGTTCTGGACTGGAGACCCT
CATCTCATTAAACAAGTCCCAGGCTCTTCACCGGAGTGGCTTCATGCCTATGATGTCTGCATGAAGTACTTTGATCGTCTCCACCCAGGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NBAS_ENST00000441750_chr2_15415608_-_RASGRP3_ENST00000402538_chr2_33787796_+_7412nt
CTCCGCTGCCTGAGTCCTCGGCGAACATGGCGGCCCCCGAGTCAGGGCCGGCTTTGAGTCCAGGCACTGCAGAGGGTGAGGAGGAGACGA
TTCTCTATGACTTGTTGGTCAACACCGAGTGGCCACCGGAGACTGAAGTACAGCCTAGAGGCAACCAAAAACATGGTGCATCCTTTATCA
TCACGAAAGCAATTCGAGATCGTTTATTATTTTTACGCCAATACATCTGGTACAGCCCGGCACCTTTTTTGCTCCCTGATGGACTGGTTC
GCTTGGTTAATAAACAGATAAACTGGCATTTGGTACTTGCAAGCAATGGAAAGCTTTTGGCTGCTGTTCAAGATCAGTGTGTGGAAATCA
GGTCTGCAAAAGATGATTTTACATCCATTATTGGGAAATGTCAAGTTCCGAAAGACCCGAAACCCCAGTGGAGACGGGTAGCATGGAGTT
ACGATTGTACCCTACTGGCCTATGCCGAAAGCACAGGAACTGTGAGGGTGTTTGATCTCATGGGAAGTGAACTCTTTGTCATTTCCCCGG
CATCTAGTTTTATAGGTGACTTAAGCTATGCCATTGCTGGGTTGATATTTTTAGAATATAAAGCAAGTGCACAGTGGTCTGCAGAACTCC
TGGTCATCAATTACCGAGGAGAACTTAGAAGTTACCTTGTAAGTGTTGGAACAAATCAGAGCTACCAAGAAAGTCACTGTTTCAGCTTCA
GTAGTCATTATCCTCATGGAATCAACACAGCTATTTACCACCCTGGTCACAGACTTTTACTTGTTGGTGGATGTGAAACTGCTGAAGTAG
GCATGTCAAAAGCTTCTAGCTGTGGCCTTTCTGCCTGGAGAGTTCTTTCAGGATCACCGTATTATAAGCAGGTTACTAATGGTGGAGACG
GGGTTACTGCAGTACCGAAGACACTGGGATTATTAAGGATGTTAAGTGTCAAGTTTTACAGTCGCCAGGGACAAGAACAGGATGGAATTT
TTAAGATGAGCCTTTCTCCAGATGGGATGCTCCTGGCAGCCATTCACTTCTCAGGGAAACTGAGCATCTGGGCGATTCCATCTCTGAAGC
AACAAGGGGAATGGGGTCAAAATGAGCAGCCAGGCTATGATGACCTTAATCCTGATTGGAGGCTCTCTACTGAGAAGAGAAAAAAAATCA
AAGATAAAGAGTCCTTTTACCCACTGATAGATGTCAATTGGTGGGCAGACAGTGCAGTGACTTTAGCTCGATGCTCTGGTGCTTTAACTG
TTTCATCTGTGAAAACTTTGAAGAATTTACTGGGAAAATCCTGTGAATGGTTTGAACCATCACCTCAAGTCACTGCTACCCATGATGGGG
GATTTTTAAGTTTGGAGTGTGAGATTAAACTTGCCCCCAAACGATCTCGTTTGGAGACTAGAGCTGGAGAAGAAGATGAAGGAGAAGAGG
ATTCTGATTCTGATTATGAAATATCTGCCAAGGCTCGCTACTTTGGTTATATAAAACAGGGCCTTTACTTGGTGACTGAAATGGAGCGAT
TTGCACCACCACGGAAACGCCCACGAACCATTACTAAAAACTACCGCCTTGTGAGTTTGCGCTCCACGACACCAGAGGAACTTTATCAGA
GGAAGATTGAAAGTGAAGAGTATGAGGAAGCCTTGTCCTTGGCTCATACCTACGGCCTGGATACTGACCTTGTATATCAGAGGCAGTGGA
GGAAGTCAGCGGTCAACGTTGCTTCAATTCAGAATTATTTGAGTAAAATAAAGAAGCGATCCTGGGTTCTCCATGAGTGTTTGGAAAGAG
TTCCTGAAAATGTGGATGCTGCAAAAGAACTGCTTCAGTATGGATTAAAAGGCACAGACCTGGAGGCTCTTTTAGCAATAGGGAAAGGAG
CAGATGATGGCAGATTTACATTACCTGGTGAAATAGACATTGACAGTATCTCCTATGAAGAGCTTTCACCACCTGATGAAGAGCCTGCCA
AGAATAAAAAGGAAAAGGAGCTCAAGAAGAGACAAGAACTACTGAAATTAGTGAACTTTTCCAAGTTGACACTGGAACAAAAGGAACTTT
GCCGTTGTAGACGGAAGTTATTAACCTACTTAGATCGACTTGCAACATATGAGGAAATCCTAGGAGTGCCTCATGCATCTGAACAGAGAT
ATGATGCTGAATTCTTTAAGAAATTCAGAAATCAGAATATTGTTCTCTCAGCAAGAACTTATGCTCAGGAAAGTAATGTACAAGCCCTGG
AAATTCTGTTTACTTACCATGGTTCCGACCTGCTTCCTCATCGCCTTGCAATTCTGTCCAACTTTCCAGAGACCACTTCTCCACATGAAT
ATTCTGTTTTGCTGCCCGAAGCTTGTTTTAACGGTGACTCCCTGATGATCATTCCTTGGCATGAACATAAACACCGAGCTAAAGATTGGT
GCGAGGAGTTGGCTTGCAGAATGGTTGTTGAGCCGAATCTCCAAGATGAAAGTGAATTCTTGTATGCTGCACAGCCTGAGTTACTAAGGT
TCAGGATGACCCAGCTTACGGTGGAGAAGGTTATGGACTGGTATCAGACCAGAGCAGAGGAAATAGAGCATTATGCTCGGCAGCTGCAGC
AAAAAATTATTCCTGATCAGGACCAACTGATGGCAATAGCACTAGAGTGCATCTATACCTGTGAACGAAATGATCAACTCTGTCTTTGCT
ATGACCTACTAGAATGTCTGCCAGAAAGAGGATATGGTGATAAGACAGAGGCAACCACAAAGCTTCATGACATGGTAGACCAACTGGAAC
AAATTCTCAGTGTGTCAGAGCTTTTGGAAAAACATGGACTCGAGAAACCAATTTCATTTGTTAAAAACACTCAATCTAGCTCAGAAGAGG
CACGCAAGCTGATGGTTAGATTGACGAGGCACACTGGCCGGAAGCAGCCTCCTGTCAGTGAGTCTCATTGGAGAACGTTGCTGCAAGACA
TGTTAACTATGCAGCAGAATGTATACACATGTCTAGATTCTGATGCCTGCTATGAGATATTTACAGAAAGCCTTCTGTGCTCTAGTCGCC
TTGAAAACATCCACCTGGCTGGACAGATGATGCACTGCAGTGCTTGTTCAGAAAATCCTCCAGCTGGTATAGCCCATAAAGGGAAACCCC
ACTACAGGGTCAGCTACGAAAAGAGTATTGACTTGGTTTTGGCTGCCAGCAGAGAGTACTTCAATTCTTCTACCAACCTCACTGATAGCT
GCATGGATCTAGCCAGGTGCTGCTTACAACTGATAACAGACAGACCCCCTGCCATTCAAGAGGAGCTAGATCTTATCCAAGCCGTTGGAT
GTCTTGAAGAATTTGGGGTAAAGATCCTGCCTTTGCAAGTGCGATTGTGCCCTGATCGGATCAGTCTCATCAAGGAGTGTATTTCCCAGT
CCCCCACATGCTATAAACAATCCACCAAGCTTCTGGGCCTTGCTGAGCTGCTGAGGGTTGCAGGTGAGAACCCAGAAGAAAGGCGGGGAC
AGGTTCTAATCCTTTTAGTGGAGCAGGCACTTCGCTTCCATGACTACAAAGCAGCCAGTATGCATTGTCAGGAGCTGATGGCCACAGGTT
ATCCTAAAAGTTGGGATGTTTGTAGCCAGTTAGGACAATCAGAAGGTTACCAGGACTTGGCCACTCGTCAAGAGCTCATGGCTTTTGCTT
TGACACATTGCCCTCCTAGCAGCATTGAACTTCTTTTGGCAGCTAGCAGCTCTCTGCAGACAGAAATTCTTTATCAAAGAGTGAATTTCC
AGATCCATCATGAAGGAGGGGAAAATATCAGTGCTTCACCATTAACTAGTAAAGCAGTACAAGAGGATGAAGTAGGTGTTCCAGGTAGCA
ATTCAGCTGACCTATTGCGCTGGACCACTGCTACCACCATGAAAGTCCTTTCCAACACCACAACCACCACCAAAGCGGTGCTGCAGGCCG
TCAGTGATGGGCAGTGGTGGAAGAAGTCTTTAACTTACCTTCGACCCCTTCAGGGGCAAAAATGTGGTGGTGCATATCAAATCGGAACTA
CAGCCAATGAAGATCTAGAGAAACAAGGGTGTCATCCTTTTTATGAATCTGTCATCTCAAATCCTTTTGTCGCTGAGTCTGAAGGGACCT
ATGACACCTATCAGCATGTTCCAGTGGAAAGCTTTGCAGAAGTATTGCTGAGAACTGGAAAATTGGCAGAGGCTAAAAATAAAGGAGAAG
TATTTCCAACAACTGAAGTTCTCTTGCAACTAGCAAGTGAAGCCTTGCCAAATGACATGACCTTGGCTCTTGCTTACCTTCTTGCCTTAC
CACAAGTGTTAGATGCTAACCGGTGCTTTGAAAAGCAGTCCCCCTCTGCATTATCTCTCCAGCTGGCAGCGTATTACTATAGCCTCCAGA
TCTATGCCCGATTGGCCCCATGTTTCAGGGACAAGTGCCATCCTCTTTACAGGGCTGATCCCAAAGAACTAATCAAGATGGTCACCAGGC
ATGTGACTCGACATGAGCACGAAGCCTGGCCTGAAGACCTTATTTCACTGACCAAGCAGTTACACTGCTACAATGAACGTCTCCTGGATT
TCACTCAGGCGCAGATCCTTCAGGGCCTTCGGAAGGGTGTGGACGTGCAGCGGTTTACTGCAGATGACCAGTATAAAAGGGAAACTATCC
TTGGTCTGGCAGAAACTCTAGAGGAAAGCGTCTACAGCATTGCTATTTCTCTGGCACAACGTTACAGTGTCTCCCGCTGGGAAGTTTTTA
TGACCCATTTGGAGTTCCTCTTCACGGACAGTGGTTTGTCCACACTAGAAATTGAAAATAGAGCCCAAGACCTTCATCTCTTTGAGACTT
TGAAGACTGATCCAGAAGCCTTTCACCAGCACATGGTCAAGTATATTTACCCTACTATTGGTGGCTTTGATCACGAAAGGCTGCAGTATT
ATTTCACTCTTCTGGAAAACTGTGGCTGTGCAGATTTGGGGAACTGTGCCATTAAACCAGAAACCCACATTCGACTGCTGAAGAAGTTTA
AGGTTGTTGCATCAGGTCTTAATTACAAAAAGCTGACAGATGAAAACATGAGTCCTCTTGAAGCATTGGAGCCAGTTCTTTCAAGTCAAA
ATATCTTGTCTATTTCCAAACTTGTTCCCAAAATCCCTGAAAAGGATGGACAGATGCTTTCCCCAAGCTCTCTGTACACCATCTGGTTAC
AGAAGTTGTTCTGGACTGGAGACCCTCATCTCATTAAACAAGTCCCAGGCTCTTCACCGGAGTGGCTTCATGCCTATGATGTCTGCATGA
AGTACTTTGATCGTCTCCACCCAGGTGACCTCATCACTGTGGTAGATGCAGTTACATTTTCTCCAAAAGCTGTGACCAAGGATGGCTGAC
TTCAGGCTGCGGAAACTGAAGGCAATAATGTTGGCTTTTGGAAGGGGCAAGACGAGAAACTCTGAAGAAAGCTCTGACTCTCAGGAAGTT
ATCTGGAAAGATACCTGGATGTTTACTGCCTTGGGACACTGTGGGATCTCCATGTTTGGACTATGGGACAGAGAATTGACCCTAACTAAC
TAACTATGAACTATTTATTTCCTCCTCCCCTACCCCTAGTTAAGTGCCACAAAGACTGTGTTATGTAGTCAGTACTTTTTTCTCATGTAT
CTTTCTCTAGACCATTTATATACGGGTGAAATGAAAGCTTTTTTGCATGTACTTGATACTCAGTCTGTAAACTCAGACTTCGCTTTTTTT
GTGAGACTATCCTTTCAATATTTTTATAAACTTTTGTGTGTGCTGTGGCAGGGAACAGTTAACAAGGAGTTTATTTAGAGGGGTTTTTTT
CATTTTTTGTTTTTCTTGTTTTGTTTTGTTTTGTTTTGTTCTTCTTGGTGTGCTTTTTGGATGGGACCAGAACTTAACATTTTCCTGAGG
ACTAGGAAGCTCATCAGACACTGGAATGCAGTGATTCTTCTAATGATGGTCAACTGCAAGGAGAAACTGTTTACATCCTTCCCACTACAC
AGTTGCTATGATATGTAACAAGTCACACATGTATATATCACACAAGTCTTACCAATTCTGCGTCACTAGGAAGCTATAGCATGGTCGTGA
AAGCTCTCCTAATACTTACTTAAATAGCCATGGAAGAAAATTATGCTTGTCCCTTCTGACTGGGTTAAGCCATCTTTCTTAAGATTCCTG
AAGTAGAAATAGCAATTAAGAAATTAATTCAAGTTTTGACGGTTAACATTTAGCAGAAAAACAAACCATTGAATAAGCTACTAGGTGAAA
TGCAAAACAACCATCAATTTTTTTAAACTCAATAATTTTGTGAAAAAAAAAACCACCACCAAACTTTTGGTTGTAAAAGAGAACCCTTGT
TCCCTTCCTAAGAAACTGCCTTCCACAATTAAAGAATACTCATAGAAAGAAAATAATCATAAATCATATTTGATTAACATTTCATTTAAG
CTTTTAAAATATCAATTTTTTAAATAGCTCCCATTTACCCAAAATAACTAGTTATGGGTCTATTTCTTCCATGATTAGAGGAGAGAGAAC
TTGATTCAAGATACTGAAAAATAGAGCTGGGACTGAGCCTGTGAATGACAGGAATGATCTATTACCAGGTGACTAGTCGGAAACTACACA
GACGTGCACTGGTCTGCATTTGGGGGCTAAAGTGTATATATTCCATTTAAAATGGAATTTGTTTGTATTTGGGGCAGTCTTCAGTAAAGC
CTTTCTCCTTTCTTTTCTCCATTGAGGACAGTTCTGCTCAGCAAAATTGTTGAGTACCTGTTCTGGGCAGGTCCCACGCTATATGCACAA
AGTTAAGAAAAACTTGGTCTTAGCCCTTGGGAGCTGACAGCCCATGGGCATTAAGGCAAAGTAGTTCCAGTGATTTAAAATACGGTTCCA
AATACGCTAAAACCAACTTGTGCCAACCAGATTTACAGATTGGAAATACTGCAGATGATGTGAAGTTATCAGTTGGAGGAGCTGTGATTA
AGCTGGATAATAAGAGAACGTGCCATCTGTAAAGCACTCAGAAGGCAGCCATCCCTAGATGTTGGTTTCATGTATATTACACTATCTACT
ACTATCCATAAATGCAATAATATGCATGTTAACAACATTAAAAACAGCAAACAGCAATCTAAGTACAGAAAAGCTTTTTGTGTGTTTAAA
AAAATTGAAGAAAATTCAGGAAGAAACGTGTTAATAAACATTGTACTGTTCTTTTGCTTCTCAAAGGAATTATTCACTTGCCACTTTGGT
TATTTTTGAGTTTTCGTACATAGGAAGTTTTATATTGCCAGCCTTCCTGTGATAAAGATATTAAATGTAACTTGAGTAAAAAATAAAAAA

>In-frame_NBAS_ENST00000281513_chr2_15415608_-_RASGRP3_ENST00000402538_chr2_33787796_+_7772nt
CTCCGCTGCCTGAGTCCTCGGCGAACATGGCGGCCCCCGAGTCAGGGCCGGCTTTGAGTCCAGGCACTGCAGAGGGTGAGGAGGAGACGA
TTCTCTATGACTTGTTGGTCAACACCGAGTGGCCACCGGAGACTGAAGTACAGCCTAGAGGCAACCAAAAACATGGTGCATCCTTTATCA
TCACGAAAGCAATTCGAGATCGTTTATTATTTTTACGCCAATACATCTGGTACAGCCCGGCACCTTTTTTGCTCCCTGATGGACTGGTTC
GCTTGGTTAATAAACAGATAAACTGGCATTTGGTACTTGCAAGCAATGGAAAGCTTTTGGCTGCTGTTCAAGATCAGTGTGTGGAAATCA
GGTCTGCAAAAGATGATTTTACATCCATTATTGGGAAATGTCAAGTTCCGAAAGACCCGAAACCCCAGTGGAGACGGGTAGCATGGAGTT
ACGATTGTACCCTACTGGCCTATGCCGAAAGCACAGGAACTGTGAGGGTGTTTGATCTCATGGGAAGTGAACTCTTTGTCATTTCCCCGG
CATCTAGTTTTATAGGTGACTTAAGCTATGCCATTGCTGGGTTGATATTTTTAGAATATAAAGCAAGTGCACAGTGGTCTGCAGAACTCC
TGGTCATCAATTACCGAGGAGAACTTAGAAGTTACCTTGTAAGTGTTGGAACAAATCAGAGCTACCAAGAAAGTCACTGTTTCAGCTTCA
GTAGTCATTATCCTCATGGAATCAACACAGCTATTTACCACCCTGGTCACAGACTTTTACTTGTTGGTGGATGTGAAACTGCTGAAGTAG
GCATGTCAAAAGCTTCTAGCTGTGGCCTTTCTGCCTGGAGAGTTCTTTCAGGATCACCGTATTATAAGCAGGTTACTAATGGTGGAGACG
GGGTTACTGCAGTACCGAAGACACTGGGATTATTAAGGATGTTAAGTGTCAAGTTTTACAGTCGCCAGGGACAAGAACAGGATGGAATTT
TTAAGATGAGCCTTTCTCCAGATGGGATGCTCCTGGCAGCCATTCACTTCTCAGGGAAACTGAGCATCTGGGCGATTCCATCTCTGAAGC
AACAAGGGGAATGGGGTCAAAATGAGCAGCCAGGCTATGATGACCTTAATCCTGATTGGAGGCTCTCTACTGAGAAGAGAAAAAAAATCA
AAGATAAAGAGTCCTTTTACCCACTGATAGATGTCAATTGGTGGGCAGACAGTGCAGTGACTTTAGCTCGATGCTCTGGTGCTTTAACTG
TTTCATCTGTGAAAACTTTGAAGAATTTACTGGGAAAATCCTGTGAATGGTTTGAACCATCACCTCAAGTCACTGCTACCCATGATGGGG
GATTTTTAAGTTTGGAGTGTGAGATTAAACTTGCCCCCAAACGATCTCGTTTGGAGACTAGAGCTGGAGAAGAAGATGAAGGAGAAGAGG
ATTCTGATTCTGATTATGAAATATCTGCCAAGGCTCGCTACTTTGGTTATATAAAACAGGGCCTTTACTTGGTGACTGAAATGGAGCGAT
TTGCACCACCACGGAAACGCCCACGAACCATTACTAAAAACTACCGCCTTGTGAGTTTGCGCTCCACGACACCAGAGGAACTTTATCAGA
GGAAGATTGAAAGTGAAGAGTATGAGGAAGCCTTGTCCTTGGCTCATACCTACGGCCTGGATACTGACCTTGTATATCAGAGGCAGTGGA
GGAAGTCAGCGGTCAACGTTGCTTCAATTCAGAATTATTTGAGTAAAATAAAGAAGCGATCCTGGGTTCTCCATGAGTGTTTGGAAAGAG
TTCCTGAAAATGTGGATGCTGCAAAAGAACTGCTTCAGTATGGATTAAAAGGCACAGACCTGGAGGCTCTTTTAGCAATAGGGAAAGGAG
CAGATGATGGCAGATTTACATTACCTGGTGAAATAGACATTGACAGTATCTCCTATGAAGAGCTTTCACCACCTGATGAAGAGCCTGCCA
AGAATAAAAAGGAAAAGGAGCTCAAGAAGAGACAAGAACTACTGAAATTAGTGAACTTTTCCAAGTTGACACTGGAACAAAAGGAACTTT
GCCGTTGTAGACGGAAGTTATTAACCTACTTAGATCGACTTGCAACATATGAGGAAATCCTAGGAGTGCCTCATGCATCTGAACAGAGAT
ATGATGCTGAATTCTTTAAGAAATTCAGAAATCAGAATATTGTTCTCTCAGCAAGAACTTATGCTCAGGAAAGTAATGTACAAGCCCTGG
AAATTCTGTTTACTTACCATGGTTCCGACCTGCTTCCTCATCGCCTTGCAATTCTGTCCAACTTTCCAGAGACCACTTCTCCACATGAAT
ATTCTGTTTTGCTGCCCGAAGCTTGTTTTAACGGTGACTCCCTGATGATCATTCCTTGGCATGAACATAAACACCGAGCTAAAGATTGGT
GCGAGGAGTTGGCTTGCAGAATGGTTGTTGAGCCGAATCTCCAAGATGAAAGTGAATTCTTGTATGCTGCACAGCCTGAGTTACTAAGGT
TCAGGATGACCCAGCTTACGGTGGAGAAGGTTATGGACTGGTATCAGACCAGAGCAGAGGAAATAGAGCATTATGCTCGGCAGGTGGACT
GTGCATTGTCACTTATTCGACTTGGGATGGAGCGGAATATTCCTGGTTTGCTGGTTCTCTGTGACAATTTGGTTACTCTGGAAACATTGG
TTTATGAAGCCAGGTGTGATGTAACTCTAACCCTGAAAGAACTCCAGCAGATGAAAGACATTGAAAAACTAAGATTACTGATGAATAGTT
GTTCTGAGGATAAATATGTGACAAGTGCCTACCAGTGGATGGTTCCCTTTCTTCATCGTTGTGAGAAACAGTCGCCTGGTGTGGCTAATG
AGCTATTAAAAGAATATTTAGTAACTTTAGCTAAAGGGGACTTAAAATTTCCCCTGAAGATATTTCAGCATTCCAAACCAGATCTGCAGC
AAAAAATTATTCCTGATCAGGACCAACTGATGGCAATAGCACTAGAGTGCATCTATACCTGTGAACGAAATGATCAACTCTGTCTTTGCT
ATGACCTACTAGAATGTCTGCCAGAAAGAGGATATGGTGATAAGACAGAGGCAACCACAAAGCTTCATGACATGGTAGACCAACTGGAAC
AAATTCTCAGTGTGTCAGAGCTTTTGGAAAAACATGGACTCGAGAAACCAATTTCATTTGTTAAAAACACTCAATCTAGCTCAGAAGAGG
CACGCAAGCTGATGGTTAGATTGACGAGGCACACTGGCCGGAAGCAGCCTCCTGTCAGTGAGTCTCATTGGAGAACGTTGCTGCAAGACA
TGTTAACTATGCAGCAGAATGTATACACATGTCTAGATTCTGATGCCTGCTATGAGATATTTACAGAAAGCCTTCTGTGCTCTAGTCGCC
TTGAAAACATCCACCTGGCTGGACAGATGATGCACTGCAGTGCTTGTTCAGAAAATCCTCCAGCTGGTATAGCCCATAAAGGGAAACCCC
ACTACAGGGTCAGCTACGAAAAGAGTATTGACTTGGTTTTGGCTGCCAGCAGAGAGTACTTCAATTCTTCTACCAACCTCACTGATAGCT
GCATGGATCTAGCCAGGTGCTGCTTACAACTGATAACAGACAGACCCCCTGCCATTCAAGAGGAGCTAGATCTTATCCAAGCCGTTGGAT
GTCTTGAAGAATTTGGGGTAAAGATCCTGCCTTTGCAAGTGCGATTGTGCCCTGATCGGATCAGTCTCATCAAGGAGTGTATTTCCCAGT
CCCCCACATGCTATAAACAATCCACCAAGCTTCTGGGCCTTGCTGAGCTGCTGAGGGTTGCAGGTGAGAACCCAGAAGAAAGGCGGGGAC
AGGTTCTAATCCTTTTAGTGGAGCAGGCACTTCGCTTCCATGACTACAAAGCAGCCAGTATGCATTGTCAGGAGCTGATGGCCACAGGTT
ATCCTAAAAGTTGGGATGTTTGTAGCCAGTTAGGACAATCAGAAGGTTACCAGGACTTGGCCACTCGTCAAGAGCTCATGGCTTTTGCTT
TGACACATTGCCCTCCTAGCAGCATTGAACTTCTTTTGGCAGCTAGCAGCTCTCTGCAGACAGAAATTCTTTATCAAAGAGTGAATTTCC
AGATCCATCATGAAGGAGGGGAAAATATCAGTGCTTCACCATTAACTAGTAAAGCAGTACAAGAGGATGAAGTAGGTGTTCCAGGTAGCA
ATTCAGCTGACCTATTGCGCTGGACCACTGCTACCACCATGAAAGTCCTTTCCAACACCACAACCACCACCAAAGCGGTGCTGCAGGCCG
TCAGTGATGGGCAGTGGTGGAAGAAGTCTTTAACTTACCTTCGACCCCTTCAGGGGCAAAAATGTGGTGGTGCATATCAAATCGGAACTA
CAGCCAATGAAGATCTAGAGAAACAAGGGTGTCATCCTTTTTATGAATCTGTCATCTCAAATCCTTTTGTCGCTGAGTCTGAAGGGACCT
ATGACACCTATCAGCATGTTCCAGTGGAAAGCTTTGCAGAAGTATTGCTGAGAACTGGAAAATTGGCAGAGGCTAAAAATAAAGGAGAAG
TATTTCCAACAACTGAAGTTCTCTTGCAACTAGCAAGTGAAGCCTTGCCAAATGACATGACCTTGGCTCTTGCTTACCTTCTTGCCTTAC
CACAAGTGTTAGATGCTAACCGGTGCTTTGAAAAGCAGTCCCCCTCTGCATTATCTCTCCAGCTGGCAGCGTATTACTATAGCCTCCAGA
TCTATGCCCGATTGGCCCCATGTTTCAGGGACAAGTGCCATCCTCTTTACAGGGCTGATCCCAAAGAACTAATCAAGATGGTCACCAGGC
ATGTGACTCGACATGAGCACGAAGCCTGGCCTGAAGACCTTATTTCACTGACCAAGCAGTTACACTGCTACAATGAACGTCTCCTGGATT
TCACTCAGGCGCAGATCCTTCAGGGCCTTCGGAAGGGTGTGGACGTGCAGCGGTTTACTGCAGATGACCAGTATAAAAGGGAAACTATCC
TTGGTCTGGCAGAAACTCTAGAGGAAAGCGTCTACAGCATTGCTATTTCTCTGGCACAACGTTACAGTGTCTCCCGCTGGGAAGTTTTTA
TGACCCATTTGGAGTTCCTCTTCACGGACAGTGGTTTGTCCACACTAGAAATTGAAAATAGAGCCCAAGACCTTCATCTCTTTGAGACTT
TGAAGACTGATCCAGAAGCCTTTCACCAGCACATGGTCAAGTATATTTACCCTACTATTGGTGGCTTTGATCACGAAAGGCTGCAGTATT
ATTTCACTCTTCTGGAAAACTGTGGCTGTGCAGATTTGGGGAACTGTGCCATTAAACCAGAAACCCACATTCGACTGCTGAAGAAGTTTA
AGGTTGTTGCATCAGGTCTTAATTACAAAAAGCTGACAGATGAAAACATGAGTCCTCTTGAAGCATTGGAGCCAGTTCTTTCAAGTCAAA
ATATCTTGTCTATTTCCAAACTTGTTCCCAAAATCCCTGAAAAGGATGGACAGATGCTTTCCCCAAGCTCTCTGTACACCATCTGGTTAC
AGAAGTTGTTCTGGACTGGAGACCCTCATCTCATTAAACAAGTCCCAGGCTCTTCACCGGAGTGGCTTCATGCCTATGATGTCTGCATGA
AGTACTTTGATCGTCTCCACCCAGGTGACCTCATCACTGTGGTAGATGCAGTTACATTTTCTCCAAAAGCTGTGACCAAGGATGGCTGAC
TTCAGGCTGCGGAAACTGAAGGCAATAATGTTGGCTTTTGGAAGGGGCAAGACGAGAAACTCTGAAGAAAGCTCTGACTCTCAGGAAGTT
ATCTGGAAAGATACCTGGATGTTTACTGCCTTGGGACACTGTGGGATCTCCATGTTTGGACTATGGGACAGAGAATTGACCCTAACTAAC
TAACTATGAACTATTTATTTCCTCCTCCCCTACCCCTAGTTAAGTGCCACAAAGACTGTGTTATGTAGTCAGTACTTTTTTCTCATGTAT
CTTTCTCTAGACCATTTATATACGGGTGAAATGAAAGCTTTTTTGCATGTACTTGATACTCAGTCTGTAAACTCAGACTTCGCTTTTTTT
GTGAGACTATCCTTTCAATATTTTTATAAACTTTTGTGTGTGCTGTGGCAGGGAACAGTTAACAAGGAGTTTATTTAGAGGGGTTTTTTT
CATTTTTTGTTTTTCTTGTTTTGTTTTGTTTTGTTTTGTTCTTCTTGGTGTGCTTTTTGGATGGGACCAGAACTTAACATTTTCCTGAGG
ACTAGGAAGCTCATCAGACACTGGAATGCAGTGATTCTTCTAATGATGGTCAACTGCAAGGAGAAACTGTTTACATCCTTCCCACTACAC
AGTTGCTATGATATGTAACAAGTCACACATGTATATATCACACAAGTCTTACCAATTCTGCGTCACTAGGAAGCTATAGCATGGTCGTGA
AAGCTCTCCTAATACTTACTTAAATAGCCATGGAAGAAAATTATGCTTGTCCCTTCTGACTGGGTTAAGCCATCTTTCTTAAGATTCCTG
AAGTAGAAATAGCAATTAAGAAATTAATTCAAGTTTTGACGGTTAACATTTAGCAGAAAAACAAACCATTGAATAAGCTACTAGGTGAAA
TGCAAAACAACCATCAATTTTTTTAAACTCAATAATTTTGTGAAAAAAAAAACCACCACCAAACTTTTGGTTGTAAAAGAGAACCCTTGT
TCCCTTCCTAAGAAACTGCCTTCCACAATTAAAGAATACTCATAGAAAGAAAATAATCATAAATCATATTTGATTAACATTTCATTTAAG
CTTTTAAAATATCAATTTTTTAAATAGCTCCCATTTACCCAAAATAACTAGTTATGGGTCTATTTCTTCCATGATTAGAGGAGAGAGAAC
TTGATTCAAGATACTGAAAAATAGAGCTGGGACTGAGCCTGTGAATGACAGGAATGATCTATTACCAGGTGACTAGTCGGAAACTACACA
GACGTGCACTGGTCTGCATTTGGGGGCTAAAGTGTATATATTCCATTTAAAATGGAATTTGTTTGTATTTGGGGCAGTCTTCAGTAAAGC
CTTTCTCCTTTCTTTTCTCCATTGAGGACAGTTCTGCTCAGCAAAATTGTTGAGTACCTGTTCTGGGCAGGTCCCACGCTATATGCACAA
AGTTAAGAAAAACTTGGTCTTAGCCCTTGGGAGCTGACAGCCCATGGGCATTAAGGCAAAGTAGTTCCAGTGATTTAAAATACGGTTCCA
AATACGCTAAAACCAACTTGTGCCAACCAGATTTACAGATTGGAAATACTGCAGATGATGTGAAGTTATCAGTTGGAGGAGCTGTGATTA
AGCTGGATAATAAGAGAACGTGCCATCTGTAAAGCACTCAGAAGGCAGCCATCCCTAGATGTTGGTTTCATGTATATTACACTATCTACT
ACTATCCATAAATGCAATAATATGCATGTTAACAACATTAAAAACAGCAAACAGCAATCTAAGTACAGAAAAGCTTTTTGTGTGTTTAAA
AAAATTGAAGAAAATTCAGGAAGAAACGTGTTAATAAACATTGTACTGTTCTTTTGCTTCTCAAAGGAATTATTCACTTGCCACTTTGGT
TATTTTTGAGTTTTCGTACATAGGAAGTTTTATATTGCCAGCCTTCCTGTGATAAAGATATTAAATGTAACTTGAGTAAAAAATAAAAAA


Top

FusionGenePPI for NBAS_RASGRP3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NBASVTI1B, STX6, USE1, STX12, NAPG, STX18, HSPB1, NTRK1, AK1, DVL2, RINT1, SCFD2, SEC22B, VAMP4, TEX28RASGRP3YWHAQ, PIK3CA, PRKCB, PRKCD, PRKCE, PRKACA, APP, DGKI, PRKCQ, SULT1C2, DYNLL2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneNBASchr2:15415608chr2:33787796ENST00000281513-44521_103519082372USE1L
HgeneNBASchr2:15415608chr2:33787796ENST00000441750-42501_103517882252USE1L


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneNBASchr2:15415608chr2:33787796ENST00000281513-44521036_237119082372ZW10 and RINT1
HgeneNBASchr2:15415608chr2:33787796ENST00000441750-42501036_237117882252ZW10 and RINT1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NBAS_RASGRP3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NBAS_RASGRP3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNBASC0038356Stomach Neoplasms1CTD_human
HgeneNBASC3541319SHORT STATURE, OPTIC NERVE ATROPHY, AND PELGER-HUET ANOMALY1ORPHANET;UNIPROT
HgeneNBASC3809651INFANTILE LIVER FAILURE SYNDROME 21ORPHANET;UNIPROT
TgeneRASGRP3C0024141Lupus Erythematosus, Systemic1CTD_human