FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23268

FusionGeneSummary for NAA15_HHIP

check button Fusion gene summary
Fusion gene informationFusion gene name: NAA15_HHIP
Fusion gene ID: 23268
HgeneTgene
Gene symbol

NAA15

HHIP

Gene ID

80155

64399

Gene nameN(alpha)-acetyltransferase 15, NatA auxiliary subunithedgehog interacting protein
SynonymsGa19|MRD50|NARG1|NAT1P|NATH|TBDN|TBDN100HIP
Cytomap

4q31.1

4q31.21

Type of geneprotein-codingprotein-coding
DescriptionN-alpha-acetyltransferase 15, NatA auxiliary subunitN-terminal acetyltransferaseNMDA receptor regulated 1NMDA receptor-regulated protein 1gastric cancer antigen Ga19protein tubedown-1transcriptional coactivator tubedown-100tubedown-1hedgehog-interacting protein
Modification date2018052320180523
UniProtAcc

Q9BXJ9

Q96QV1

Ensembl transtripts involved in fusion geneENST00000296543, ENST00000398947, 
ENST00000480277, ENST00000515576, 
ENST00000296575, ENST00000434550, 
ENST00000511314, 
Fusion gene scores* DoF score5 X 4 X 6=1201 X 1 X 1=1
# samples 61
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: NAA15 [Title/Abstract] AND HHIP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNAA15

GO:0006474

N-terminal protein amino acid acetylation

15496142

HgeneNAA15

GO:0045893

positive regulation of transcription, DNA-templated

12145306

TgeneHHIP

GO:0009968

negative regulation of signal transduction

19561609


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-V1-A9OQ-01ANAA15chr4

140222985

+HHIPchr4

145580789

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000296543ENST00000296575NAA15chr4

140222985

+HHIPchr4

145580789

+
In-frameENST00000296543ENST00000434550NAA15chr4

140222985

+HHIPchr4

145580789

+
5CDS-3UTRENST00000296543ENST00000511314NAA15chr4

140222985

+HHIPchr4

145580789

+
Frame-shiftENST00000398947ENST00000296575NAA15chr4

140222985

+HHIPchr4

145580789

+
In-frameENST00000398947ENST00000434550NAA15chr4

140222985

+HHIPchr4

145580789

+
5CDS-3UTRENST00000398947ENST00000511314NAA15chr4

140222985

+HHIPchr4

145580789

+
intron-3CDSENST00000480277ENST00000296575NAA15chr4

140222985

+HHIPchr4

145580789

+
intron-3CDSENST00000480277ENST00000434550NAA15chr4

140222985

+HHIPchr4

145580789

+
intron-3UTRENST00000480277ENST00000511314NAA15chr4

140222985

+HHIPchr4

145580789

+
intron-3CDSENST00000515576ENST00000296575NAA15chr4

140222985

+HHIPchr4

145580789

+
intron-3CDSENST00000515576ENST00000434550NAA15chr4

140222985

+HHIPchr4

145580789

+
intron-3UTRENST00000515576ENST00000511314NAA15chr4

140222985

+HHIPchr4

145580789

+

Top

FusionProtFeatures for NAA15_HHIP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NAA15

Q9BXJ9

HHIP

Q96QV1

Auxillary subunit of the N-terminal acetyltransferase A(NatA) complex which displays alpha (N-terminal) acetyltransferaseactivity. The NAT activity may be important for vascular,hematopoietic and neuronal growth and development. Required tocontrol retinal neovascularization in adult ocular endothelialcells. In complex with XRCC6 and XRCC5 (Ku80), up-regulatestranscription from the osteocalcin promoter.{ECO:0000269|PubMed:11687548, ECO:0000269|PubMed:12145306,ECO:0000269|PubMed:15496142}. Modulates hedgehog signaling in several cell typesincluding brain and lung through direct interaction with membersof the hedgehog family. {ECO:0000269|PubMed:11472839,ECO:0000269|PubMed:19561609}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for NAA15_HHIP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NAA15_ENST00000296543_chr4_140222985_+_HHIP_ENST00000434550_chr4_145580789_+_129aa
MPAVSLPPKENALFKRILKAQTQLLLYSGGCEWAAAARWCPAXWGWLATSLHSGKRRLCEDTYPXRRNFQGALFGHSQTCSKWNKGWLFK

>In-frame_NAA15_ENST00000398947_chr4_140222985_+_HHIP_ENST00000434550_chr4_145580789_+_129aa
MPAVSLPPKENALFKRILKAQTQLLLYSGGCEWAAAARWCPAXWGWLATSLHSGKRRLCEDTYPXRRNFQGALFGHSQTCSKWNKGWLFK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NAA15_ENST00000296543_chr4_140222985_+_HHIP_ENST00000434550_chr4_145580789_+_388nt
ATGCCGGCCGTGAGCCTCCCGCCCAAGGAGAATGCGCTCTTCAAGCGGATCTTGAAAGCACAAACACAACTGCTTCTGTATTCAGGAGGT
TGTGAGTGGGCTGCGGCAGCCCGTTGGTGCCCTGCATAGTGGGGATGGCTCGCAACGTCTCTTCATTCTGGAAAAAGAAGGTTATGTGAA
GATACTTACCCCTGAAGGAGAAATTTTCAAGGAGCCTTATTTGGACATTCACAAACTTGTTCAAAGTGGAATAAAGGTTGGCTTTTTAAA
TTTTATTTATTTTTGTGCTGGCTACGTTAATTTTATTTTAGTGTTACCTTCCTCACTGAAGGTATTTCTTTGTAATAAAAGAAAGAATCT

>In-frame_NAA15_ENST00000398947_chr4_140222985_+_HHIP_ENST00000434550_chr4_145580789_+_388nt
ATGCCGGCCGTGAGCCTCCCGCCCAAGGAGAATGCGCTCTTCAAGCGGATCTTGAAAGCACAAACACAACTGCTTCTGTATTCAGGAGGT
TGTGAGTGGGCTGCGGCAGCCCGTTGGTGCCCTGCATAGTGGGGATGGCTCGCAACGTCTCTTCATTCTGGAAAAAGAAGGTTATGTGAA
GATACTTACCCCTGAAGGAGAAATTTTCAAGGAGCCTTATTTGGACATTCACAAACTTGTTCAAAGTGGAATAAAGGTTGGCTTTTTAAA
TTTTATTTATTTTTGTGCTGGCTACGTTAATTTTATTTTAGTGTTACCTTCCTCACTGAAGGTATTTCTTTGTAATAAAAGAAAGAATCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NAA15_ENST00000296543_chr4_140222985_+_HHIP_ENST00000434550_chr4_145580789_+_1014nt
GTGTTAGGAAGCGTGACCCGGGTGGGAAAACCCTCCGCGTCCGCCATTTTGGCTGCCTCTGTCGGTCTGTTCAGTTACCACGTGAACCGC
CGACGGAGACCCGTAGTGGGGGAGGCGGCGGCAGCGTTAAGTGAGAAAGGAAAAAAGACAACGAGGAAAAAGGAGGTGTCCGGGTAGGGC
AACGCGGCGACACCCGAGGCCTGGTGGTGGCGGCGGATCGAGATATTCAAGGCTGAAGCAGCTACGGAACGGCAGCGGCGGCGGTCGGAC
AAACTGACTGACCGAGCCGGGTGGTGGCGGGAGCAGCGGGAGCAGCCGGAACGATGCCGGCCGTGAGCCTCCCGCCCAAGGAGAATGCGC
TCTTCAAGCGGATCTTGAAAGCACAAACACAACTGCTTCTGTATTCAGGAGGTTGTGAGTGGGCTGCGGCAGCCCGTTGGTGCCCTGCAT
AGTGGGGATGGCTCGCAACGTCTCTTCATTCTGGAAAAAGAAGGTTATGTGAAGATACTTACCCCTGAAGGAGAAATTTTCAAGGAGCCT
TATTTGGACATTCACAAACTTGTTCAAAGTGGAATAAAGGTTGGCTTTTTAAATTTTATTTATTTTTGTGCTGGCTACGTTAATTTTATT
TTAGTGTTACCTTCCTCACTGAAGGTATTTCTTTGTAATAAAAGAAAGAATCTTGCAGGAGAAAATAAGGGGGCAACATAAGAAACAATA
ATTATGGCACCTGAATTAGGACAGTGACATTAAATTTCTGTTATTTGTTGACTATTGTGCGCTGCAATCGAATTGATATTTGACATGCTT
TCCCCATGTAATTGACACATTTAAAGGAATCTTTGGCTTTATAAAGTATTGTTTAAATATTGTTTAATGGGCATAACACAGGACTGTACA
TCAGCATTTGCTAGTAGAAACAAAGAGGTCTTTTGGTTATTTTGGCAATTGCAAATCATTCTTTCACCATCTCTGTTTTTGAGTCTGTCT

>In-frame_NAA15_ENST00000398947_chr4_140222985_+_HHIP_ENST00000434550_chr4_145580789_+_881nt
AGAAAGGAAAAAAGACAACGAGGAAAAAGGAGGTGTCCGGGTAGGGCAACGCGGCGACACCCGAGGCCTGGTGGTGGCGGCGGATCGAGA
TATTCAAGGCTGAAGCAGCTACGGAACGGCAGCGGCGGCGGTCGGACAAACTGACTGACCGAGCCGGGTGGTGGCGGGAGCAGCGGGAGC
AGCCGGAACGATGCCGGCCGTGAGCCTCCCGCCCAAGGAGAATGCGCTCTTCAAGCGGATCTTGAAAGCACAAACACAACTGCTTCTGTA
TTCAGGAGGTTGTGAGTGGGCTGCGGCAGCCCGTTGGTGCCCTGCATAGTGGGGATGGCTCGCAACGTCTCTTCATTCTGGAAAAAGAAG
GTTATGTGAAGATACTTACCCCTGAAGGAGAAATTTTCAAGGAGCCTTATTTGGACATTCACAAACTTGTTCAAAGTGGAATAAAGGTTG
GCTTTTTAAATTTTATTTATTTTTGTGCTGGCTACGTTAATTTTATTTTAGTGTTACCTTCCTCACTGAAGGTATTTCTTTGTAATAAAA
GAAAGAATCTTGCAGGAGAAAATAAGGGGGCAACATAAGAAACAATAATTATGGCACCTGAATTAGGACAGTGACATTAAATTTCTGTTA
TTTGTTGACTATTGTGCGCTGCAATCGAATTGATATTTGACATGCTTTCCCCATGTAATTGACACATTTAAAGGAATCTTTGGCTTTATA
AAGTATTGTTTAAATATTGTTTAATGGGCATAACACAGGACTGTACATCAGCATTTGCTAGTAGAAACAAAGAGGTCTTTTGGTTATTTT


Top

FusionGenePPI for NAA15_HHIP


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NAA15UBA5, XRCC6, XRCC5, RAD21, SIRT7, NAA10, HYPK, ASUN, MATR3, FN1, VCAM1, ITGA4, DDI2, STAT1, TSNAX, VPS26A, NAA50, PYCARD, MBD5, CYP1A1, CAND2, CMAS, DHX9, DRG1, FBL, HNRNPR, PSMC3, PSMD12, PSMD3, YARS, NAA20, NTRK1, KRAS, CEP97, CNTRL, DCTN1, POC5, STIL, SRPR, RNF126, ZNF746, NAA16, ARRB2, TRAFD1, FGB, SNRNP27, GTF2E2, USP47, MRPS11, FGF9, BRCA1HHIPHDAC11


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NAA15_HHIP


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NAA15_HHIP


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneHHIPC2239176Liver carcinoma1CTD_human