FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23187

FusionGeneSummary for MYO6_SENP6

check button Fusion gene summary
Fusion gene informationFusion gene name: MYO6_SENP6
Fusion gene ID: 23187
HgeneTgene
Gene symbol

MYO6

SENP6

Gene ID

4646

26054

Gene namemyosin VISUMO specific peptidase 6
SynonymsDFNA22|DFNB37|Myo6-007|Myo6-008SSP1|SUSP1
Cytomap

6q14.1

6q14.1

Type of geneprotein-codingprotein-coding
Descriptionunconventional myosin-VImyosin VI transcript variant 007myosin VI transcript variant 008unconventional myosin-6sentrin-specific protease 62810017C20RikSUMO-1-specific protease 1SUMO1/sentrin specific peptidase 6SUMO1/sentrin specific protease 6sentrin/SUMO-specific protease SENP6
Modification date2018052720180523
UniProtAcc

Q9UM54

Q9GZR1

Ensembl transtripts involved in fusion geneENST00000369981, ENST00000369985, 
ENST00000369977, ENST00000369975, 
ENST00000462633, 
ENST00000370010, 
ENST00000370014, ENST00000447266, 
ENST00000541192, ENST00000327284, 
ENST00000436928, 
Fusion gene scores* DoF score9 X 8 X 8=5768 X 12 X 6=576
# samples 1714
** MAII scorelog2(17/576*10)=-1.76053406530461
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(14/576*10)=-2.04064198449735
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MYO6 [Title/Abstract] AND SENP6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMYO6

GO:0030330

DNA damage response, signal transduction by p53 class mediator

16507995

TgeneSENP6

GO:0070646

protein modification by small protein removal

20212317


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-D8-A1JM-01AMYO6chr6

76459140

+SENP6chr6

76405520

+
TCGARVHNSCTCGA-DQ-7589-01AMYO6chr6

76459140

+SENP6chr6

76419243

+
TCGARVLUADTCGA-44-4112-01AMYO6chr6

76459140

+SENP6chr6

76405520

+
TCGARVLUADTCGA-05-4244-01AMYO6chr6

76459140

+SENP6chr6

76385151

+
TCGARVUCECTCGA-B5-A0JN-01AMYO6chr6

76459140

+SENP6chr6

76423229

+
TCGARVUCECTCGA-AJ-A3EM-01AMYO6chr6

76459140

+SENP6chr6

76405520

+
TCGARVUCSTCGA-N5-A4RJ-01AMYO6chr6

76527381

+SENP6chr6

76421044

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5UTR-3CDSENST00000369981ENST00000370010MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369981ENST00000370014MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369981ENST00000447266MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369981ENST00000541192MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-intronENST00000369981ENST00000327284MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-intronENST00000369981ENST00000436928MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369985ENST00000370010MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369985ENST00000370014MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369985ENST00000447266MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369985ENST00000541192MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-intronENST00000369985ENST00000327284MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-intronENST00000369985ENST00000436928MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369977ENST00000370010MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369977ENST00000370014MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369977ENST00000447266MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369977ENST00000541192MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-intronENST00000369977ENST00000327284MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-intronENST00000369977ENST00000436928MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-3CDSENST00000369975ENST00000370010MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-3CDSENST00000369975ENST00000370014MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-3CDSENST00000369975ENST00000447266MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-3CDSENST00000369975ENST00000541192MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-intronENST00000369975ENST00000327284MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-intronENST00000369975ENST00000436928MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-3CDSENST00000462633ENST00000370010MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-3CDSENST00000462633ENST00000370014MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-3CDSENST00000462633ENST00000447266MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-3CDSENST00000462633ENST00000541192MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-intronENST00000462633ENST00000327284MYO6chr6

76459140

+SENP6chr6

76405520

+
intron-intronENST00000462633ENST00000436928MYO6chr6

76459140

+SENP6chr6

76405520

+
5UTR-3CDSENST00000369981ENST00000370010MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369981ENST00000370014MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369981ENST00000447266MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369981ENST00000541192MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-intronENST00000369981ENST00000327284MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-intronENST00000369981ENST00000436928MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369985ENST00000370010MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369985ENST00000370014MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369985ENST00000447266MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369985ENST00000541192MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-intronENST00000369985ENST00000327284MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-intronENST00000369985ENST00000436928MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369977ENST00000370010MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369977ENST00000370014MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369977ENST00000447266MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369977ENST00000541192MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-intronENST00000369977ENST00000327284MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-intronENST00000369977ENST00000436928MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-3CDSENST00000369975ENST00000370010MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-3CDSENST00000369975ENST00000370014MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-3CDSENST00000369975ENST00000447266MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-3CDSENST00000369975ENST00000541192MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-intronENST00000369975ENST00000327284MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-intronENST00000369975ENST00000436928MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-3CDSENST00000462633ENST00000370010MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-3CDSENST00000462633ENST00000370014MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-3CDSENST00000462633ENST00000447266MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-3CDSENST00000462633ENST00000541192MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-intronENST00000462633ENST00000327284MYO6chr6

76459140

+SENP6chr6

76419243

+
intron-intronENST00000462633ENST00000436928MYO6chr6

76459140

+SENP6chr6

76419243

+
5UTR-3CDSENST00000369981ENST00000370010MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369981ENST00000370014MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369981ENST00000447266MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369981ENST00000541192MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369981ENST00000327284MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-intronENST00000369981ENST00000436928MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369985ENST00000370010MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369985ENST00000370014MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369985ENST00000447266MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369985ENST00000541192MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369985ENST00000327284MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-intronENST00000369985ENST00000436928MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369977ENST00000370010MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369977ENST00000370014MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369977ENST00000447266MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369977ENST00000541192MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369977ENST00000327284MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-intronENST00000369977ENST00000436928MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000369975ENST00000370010MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000369975ENST00000370014MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000369975ENST00000447266MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000369975ENST00000541192MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000369975ENST00000327284MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-intronENST00000369975ENST00000436928MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000462633ENST00000370010MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000462633ENST00000370014MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000462633ENST00000447266MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000462633ENST00000541192MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-3CDSENST00000462633ENST00000327284MYO6chr6

76459140

+SENP6chr6

76385151

+
intron-intronENST00000462633ENST00000436928MYO6chr6

76459140

+SENP6chr6

76385151

+
5UTR-3CDSENST00000369981ENST00000370010MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3CDSENST00000369981ENST00000370014MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3CDSENST00000369981ENST00000447266MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3UTRENST00000369981ENST00000541192MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-intronENST00000369981ENST00000327284MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-intronENST00000369981ENST00000436928MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3CDSENST00000369985ENST00000370010MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3CDSENST00000369985ENST00000370014MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3CDSENST00000369985ENST00000447266MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3UTRENST00000369985ENST00000541192MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-intronENST00000369985ENST00000327284MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-intronENST00000369985ENST00000436928MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3CDSENST00000369977ENST00000370010MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3CDSENST00000369977ENST00000370014MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3CDSENST00000369977ENST00000447266MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-3UTRENST00000369977ENST00000541192MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-intronENST00000369977ENST00000327284MYO6chr6

76459140

+SENP6chr6

76423229

+
5UTR-intronENST00000369977ENST00000436928MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-3CDSENST00000369975ENST00000370010MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-3CDSENST00000369975ENST00000370014MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-3CDSENST00000369975ENST00000447266MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-3UTRENST00000369975ENST00000541192MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-intronENST00000369975ENST00000327284MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-intronENST00000369975ENST00000436928MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-3CDSENST00000462633ENST00000370010MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-3CDSENST00000462633ENST00000370014MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-3CDSENST00000462633ENST00000447266MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-3UTRENST00000462633ENST00000541192MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-intronENST00000462633ENST00000327284MYO6chr6

76459140

+SENP6chr6

76423229

+
intron-intronENST00000462633ENST00000436928MYO6chr6

76459140

+SENP6chr6

76423229

+
In-frameENST00000369981ENST00000370010MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369981ENST00000370014MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369981ENST00000447266MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-3UTRENST00000369981ENST00000541192MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-intronENST00000369981ENST00000327284MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-intronENST00000369981ENST00000436928MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369985ENST00000370010MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369985ENST00000370014MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369985ENST00000447266MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-3UTRENST00000369985ENST00000541192MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-intronENST00000369985ENST00000327284MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-intronENST00000369985ENST00000436928MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369977ENST00000370010MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369977ENST00000370014MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369977ENST00000447266MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-3UTRENST00000369977ENST00000541192MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-intronENST00000369977ENST00000327284MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-intronENST00000369977ENST00000436928MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369975ENST00000370010MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369975ENST00000370014MYO6chr6

76527381

+SENP6chr6

76421044

+
In-frameENST00000369975ENST00000447266MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-3UTRENST00000369975ENST00000541192MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-intronENST00000369975ENST00000327284MYO6chr6

76527381

+SENP6chr6

76421044

+
5CDS-intronENST00000369975ENST00000436928MYO6chr6

76527381

+SENP6chr6

76421044

+
intron-3CDSENST00000462633ENST00000370010MYO6chr6

76527381

+SENP6chr6

76421044

+
intron-3CDSENST00000462633ENST00000370014MYO6chr6

76527381

+SENP6chr6

76421044

+
intron-3CDSENST00000462633ENST00000447266MYO6chr6

76527381

+SENP6chr6

76421044

+
intron-3UTRENST00000462633ENST00000541192MYO6chr6

76527381

+SENP6chr6

76421044

+
intron-intronENST00000462633ENST00000327284MYO6chr6

76527381

+SENP6chr6

76421044

+
intron-intronENST00000462633ENST00000436928MYO6chr6

76527381

+SENP6chr6

76421044

+

Top

FusionProtFeatures for MYO6_SENP6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MYO6

Q9UM54

SENP6

Q9GZR1

Myosins are actin-based motor molecules with ATPaseactivity. Unconventional myosins serve in intracellular movements.Myosin 6 is a reverse-direction motor protein that moves towardsthe minus-end of actin filaments. Has slow rate of actin-activatedADP release due to weak ATP binding. Functions in a variety ofintracellular processes such as vesicular membrane trafficking andcell migration. Required for the structural integrity of the Golgiapparatus via the p53-dependent pro-survival pathway. Appears tobe involved in a very early step of clathrin-mediated endocytosisin polarized epithelial cells. May act as a regulator of F-actindynamics. May play a role in transporting DAB2 from the plasmamembrane to specific cellular targets. Required for structuralintegrity of inner ear hair cells (By similarity). {ECO:0000250,ECO:0000269|PubMed:10519557, ECO:0000269|PubMed:11447109,ECO:0000269|PubMed:16507995, ECO:0000269|PubMed:16949370}. Protease that deconjugates SUMO1, SUMO2 and SUMO3 fromtargeted proteins. Processes preferentially poly-SUMO2 and poly-SUMO3 chains, but does not efficiently process SUMO1, SUMO2 andSUMO3 precursors. Deconjugates SUMO1 from RXRA, leading totranscriptional activation. Involved in chromosome alignment andspindle assembly, by regulating the kinetochore CENPH-CENPI-CENPKcomplex. Desumoylates PML and CENPI, protecting them fromdegradation by the ubiquitin ligase RNF4, which targetspolysumoylated proteins for proteasomal degradation. Desumoylatesalso RPA1, thus preventing recruitment of RAD51 to the DNA damagefoci to initiate DNA repair through homologous recombination.{ECO:0000269|PubMed:16912044, ECO:0000269|PubMed:17000875,ECO:0000269|PubMed:18799455, ECO:0000269|PubMed:20212317,ECO:0000269|PubMed:20705237, ECO:0000269|PubMed:21148299}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+235920_1027391286Compositional biasNote=Glu-rich
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+233920_1027391263Compositional biasNote=Glu-rich
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+2352_53391286DomainMyosin N-terminal SH3-like
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+23557_771391286DomainMyosin motor
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+235814_834391286DomainNote=IQ
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+2332_53391263DomainMyosin N-terminal SH3-like
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+23357_771391263DomainMyosin motor
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+233814_834391263DomainNote=IQ
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+235151_158391286Nucleotide bindingATP
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+233151_158391263Nucleotide bindingATP
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+235273_317391286RegionResponsible for slow ATPase activity
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+235665_672391286RegionActin-binding
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+235782_810391286RegionRequired for binding calmodulin
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+235835_916391286RegionNote=Three-helix bundle
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+235917_984391286RegionSAH
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+233273_317391263RegionResponsible for slow ATPase activity
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+233665_672391263RegionActin-binding
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+233782_810391263RegionRequired for binding calmodulin
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+233835_916391263RegionNote=Three-helix bundle
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+233917_984391263RegionSAH
TgeneSENP6chr6:76527381chr6:76421044ENST00000370010+1823666_11129331106RegionNote=Protease
TgeneSENP6chr6:76527381chr6:76421044ENST00000447266+1924666_11129401113RegionNote=Protease


Top

FusionGeneSequence for MYO6_SENP6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MYO6_ENST00000369981_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369981_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369981_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369985_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369985_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369985_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369977_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369977_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369977_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369975_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369975_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED

>In-frame_MYO6_ENST00000369975_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_212aa
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLRGPSRSNVVKIL
REYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQED


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MYO6_ENST00000369981_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369981_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369981_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369985_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369985_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369985_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369977_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369977_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369977_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369975_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369975_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA

>In-frame_MYO6_ENST00000369975_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_636nt
ATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACA
ATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGG
CATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTA
AGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTA
CCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTA
CCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGAT
CAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MYO6_ENST00000369981_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_1225nt
GTGCACGCCGCAGTGCCGGGGACTCGGCGGGGCGCCGGCCGGCGGGCGGAGACCGACTCGGGATCTGTCCGAGCAGGAAGCCAGCCTCAG
CCCGGCCGCTGTCGCCGCCCTGTCCTGGTGCCCGTCCGCGTCGTCGCCCTCTTCACTGGCCCTCATCACTTCTCACCGCGCCCTCCAGCT
TCACCCGTACAGGTAGCCCCGCCGCCGCGCACCTGCCTTCGCTCCCGCACCGGTGACAGTGGATAGTGGAAACAGGAGATCGTGGATCCT
CCTTCAAAAATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGAC
AGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATA
GGACAGTGGCATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTC
AAAATTTTAAGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAAT
CCAAAAGTACCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGT
TTTGAACTACCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTA
CAGGAAGATCAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAAT
AGTATCTCAGATTGACCATTTCTGTTACTTGTCATTTCTACTTTCAGAAACTAAATGACTTTCAAATTTGGGTATAGACAATAAAGAACT
GAAGTGCTCACTACTCAGTGATTTGGAAATTTTGATGCTTGTATAAATGTCAGATAATTAATTTCCAAAGGCGTATGTATTAAGTAAAAG
TCTGTAAATATGTTAATGAGGCCAATTTTTCCAGCATTTATAATTATTTTTTTCACTTGTTAGGAAGCTTTTGTTATGTATTTTCTGTTA

>In-frame_MYO6_ENST00000369981_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_3602nt
GTGCACGCCGCAGTGCCGGGGACTCGGCGGGGCGCCGGCCGGCGGGCGGAGACCGACTCGGGATCTGTCCGAGCAGGAAGCCAGCCTCAG
CCCGGCCGCTGTCGCCGCCCTGTCCTGGTGCCCGTCCGCGTCGTCGCCCTCTTCACTGGCCCTCATCACTTCTCACCGCGCCCTCCAGCT
TCACCCGTACAGGTAGCCCCGCCGCCGCGCACCTGCCTTCGCTCCCGCACCGGTGACAGTGGATAGTGGAAACAGGAGATCGTGGATCCT
CCTTCAAAAATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGAC
AGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATA
GGACAGTGGCATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTC
AAAATTTTAAGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAAT
CCAAAAGTACCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGT
TTTGAACTACCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTA
CAGGAAGATCAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAAT
AGTATCTCAGATTGACCATTTCTGTTACTTGTCATTTCTACTTTCAGAAACTAAATGACTTTCAAATTTGGGTATAGACAATAAAGAACT
GAAGTGCTCACTACTCAGTGATTTGGAAATTTTGATGCTTGTATAAATGTCAGATAATTAATTTCCAAAGGCGTATGTATTAAGTAAAAG
TCTGTAAATATGTTAATGAGGCCAATTTTTCCAGCATTTATAATTATTTTTTTCACTTGTTAGGAAGCTTTTGTTATGTATTTTCTGTTA
ATAGTACCTAAAATTGCAACTTCTAAACACAAATAAAAAGAAAATATTTATAGGAGGAAATGATTAATTTGATATTCTTTAGTGAACTTG
TTTAATTCCTCAGTGGGTGTGACATATTTCATGGGAATATTCAAATATCTATGGTAATATTTTGACCCTTTATATTTGTTCTAAAATAAG
TCAAAATGTGAAAATAATATTAAATCTAAGATATTTTGAACTAAGCATCTTTATATGCTTGTGTAACAGGAACAAAGTAACAGCCTTTCA
ATTCATATACTGCCTTGTGTTCAGTGAACCCAAGAAATGTAATAAATATTTGTAATTTTACACAAATATTTAAGAGGAAAGAGTATTAAG
AGCAATTCAAAAAAAGTAACCTTATACTACTAAAAAAAAAATTCTTGCATATATTATCATCAAATGCATTTTTGAAGACATCAAAGACTC
AGGTTAAAACTATTTTGGTAAGTGCAGCTTGAATTTCAAATATCCCGTGTTACCTTTCTCTATTACAGCTTAAAGTATGCTACAATCTGT
GTCATATAGTTAATTGATAAGCATTTTTAATCTGTGTAAACACAGGAATTTAAATAGGAATTTACTATTTTTTTATAAAGCTTTTGCTAT
TTTTTCATTGCTCATTTTGTTCTTATTATTTTGATAAAGTATCAGACTTTTTGCTTGAGTTCTTCAGTGTAAATTATTTTTTACATGTAA
AAGTACTGTATTCAACCAGTTGCATAATACAGCAAAAATCTTTGAATTCCCCTTTAAAATAACTAAAATTTGATGGTTTCCATGACAGAT
TTATAGCACATATAGGGATCTTGCATGTATCTGCAGAAACTTCATTATTTTTCAAATGAAATGGTGTATACTTCTTTCAAATGAACTTTG
AGACTTGAAACATATTTTAGTCATTTTTTGTTAAATATTGAATTTTTAAATACACATATATCAAAAATAGTTGAGAATAAAAAGAAAGCC
TAATCATCAGCAATTATTTTATTTTTAATTTGGCCATCTCTGACATTGCAGTCAATATCTTAGGGTATTTTCTTGAATTTAATAAAGTCC
CATGGGTGGGTTCAGGGTGAATGGGAGTATTAACAACAACCAAAAAATATCTATTGAGACACAGTAGAGTCTCAGTAAGAGAAATATTAA
AATGTAAGAAAGGTCACCATTAGTGATATCAACTGTAGTTTGTTACTTTGAACTATATTTCTGATTAACTCTTTATAGTAATAACTTAGA
GCTGTTAGCTCAGATATCTTAATTAGCTCATATGAAAAACAAGTTTAATTTTATTATTTACTGAACATGGCAAAATGCTTTTCAATCTAT
AATAAAACTGGGATAAAAAATTGAAGTTGTTTTTTTTAAAACCTAATAGCAATAAGCAAAATTGGCATACATAATTTTTTTAATGAACTA
TATTTTGTCAGAATCTGAAGGTACTGAAAAACTATTCTAAAATGCCTACTTGTTTTTGCATTAATTTGTAATGCTTACATTTTGCACCCT
TAGATAATGTTTGATAAGATAAAAATATAATTTATCCCTTGTACCAACTCAAGTCAATCAGATTTTAACATGAAAAATATAGATTAATGT
ATGTCAGCTTTCTAGAGGTAGAATACTCAGCTATTTGATGGCATTTTTCCCACCCCATGTGAAATTTTATTTTTGGAAGTTATGCTAGTG
ACATTGCAATATATATTGAAATCTTCGGAGGCTGCCAGGTTGAGCTTCAAAACTAGACTTGAGAATCTTTCGTGTATATGCACATTCACT
TGATAATTGTGTATTCTATGTAGTTTAAAGTGGGATCAAGCCTTTTAAAATGTGTTATTAGTACTTAGAAGTTGTAAAACAGAACTTATA
GAGGTTTGTTACTAGACACTGAAACTGCATGACAAGTATCTGGTGTCTTAACTAATTAGATAGATCTGTTGTATTGGTTTTCTTGTTGGA
TAGAATAACAGTTAATCATTTTTAGAAGAGTTTTAGATTACTTGCCATAAAATTTGTATGTCTCAGCTCTTGTTGGTTTAGGAGCAGAAG
TGGTGTTTAGTCCCTTCCCGTTAATGTTGCTGTGCTACTTCAGACAGCTGAAAACTTAATGGTATTATTTCAAGTTCACATAACCCTAAA
AAAGGTTTTCTTTGTGTAGTAACTTGTGCTTAAACTTTTAGTCAATTAAATGTAGGAGGTTTTATTTGAAAACATAAAATGATTCTCTAA
ATTACATCTTGTTTTAAGCCACCAAAATGAATGCAGTAATTTTTCTTTAAAAAAATGATCTCTGAAAACTGTGAGACAATGTAAAAAGAA
TAAGTTTTAATTCCCCCAAAATCAAAAATTGTACTTAAAATCTCAGACAATTCACTGAACAGGAATAATAAAGAACATATTTTAATATAT

>In-frame_MYO6_ENST00000369981_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_3599nt
GTGCACGCCGCAGTGCCGGGGACTCGGCGGGGCGCCGGCCGGCGGGCGGAGACCGACTCGGGATCTGTCCGAGCAGGAAGCCAGCCTCAG
CCCGGCCGCTGTCGCCGCCCTGTCCTGGTGCCCGTCCGCGTCGTCGCCCTCTTCACTGGCCCTCATCACTTCTCACCGCGCCCTCCAGCT
TCACCCGTACAGGTAGCCCCGCCGCCGCGCACCTGCCTTCGCTCCCGCACCGGTGACAGTGGATAGTGGAAACAGGAGATCGTGGATCCT
CCTTCAAAAATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGAC
AGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATA
GGACAGTGGCATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTC
AAAATTTTAAGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAAT
CCAAAAGTACCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGT
TTTGAACTACCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTA
CAGGAAGATCAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAAT
AGTATCTCAGATTGACCATTTCTGTTACTTGTCATTTCTACTTTCAGAAACTAAATGACTTTCAAATTTGGGTATAGACAATAAAGAACT
GAAGTGCTCACTACTCAGTGATTTGGAAATTTTGATGCTTGTATAAATGTCAGATAATTAATTTCCAAAGGCGTATGTATTAAGTAAAAG
TCTGTAAATATGTTAATGAGGCCAATTTTTCCAGCATTTATAATTATTTTTTTCACTTGTTAGGAAGCTTTTGTTATGTATTTTCTGTTA
ATAGTACCTAAAATTGCAACTTCTAAACACAAATAAAAAGAAAATATTTATAGGAGGAAATGATTAATTTGATATTCTTTAGTGAACTTG
TTTAATTCCTCAGTGGGTGTGACATATTTCATGGGAATATTCAAATATCTATGGTAATATTTTGACCCTTTATATTTGTTCTAAAATAAG
TCAAAATGTGAAAATAATATTAAATCTAAGATATTTTGAACTAAGCATCTTTATATGCTTGTGTAACAGGAACAAAGTAACAGCCTTTCA
ATTCATATACTGCCTTGTGTTCAGTGAACCCAAGAAATGTAATAAATATTTGTAATTTTACACAAATATTTAAGAGGAAAGAGTATTAAG
AGCAATTCAAAAAAAGTAACCTTATACTACTAAAAAAAAAATTCTTGCATATATTATCATCAAATGCATTTTTGAAGACATCAAAGACTC
AGGTTAAAACTATTTTGGTAAGTGCAGCTTGAATTTCAAATATCCCGTGTTACCTTTCTCTATTACAGCTTAAAGTATGCTACAATCTGT
GTCATATAGTTAATTGATAAGCATTTTTAATCTGTGTAAACACAGGAATTTAAATAGGAATTTACTATTTTTTTATAAAGCTTTTGCTAT
TTTTTCATTGCTCATTTTGTTCTTATTATTTTGATAAAGTATCAGACTTTTTGCTTGAGTTCTTCAGTGTAAATTATTTTTTACATGTAA
AAGTACTGTATTCAACCAGTTGCATAATACAGCAAAAATCTTTGAATTCCCCTTTAAAATAACTAAAATTTGATGGTTTCCATGACAGAT
TTATAGCACATATAGGGATCTTGCATGTATCTGCAGAAACTTCATTATTTTTCAAATGAAATGGTGTATACTTCTTTCAAATGAACTTTG
AGACTTGAAACATATTTTAGTCATTTTTTGTTAAATATTGAATTTTTAAATACACATATATCAAAAATAGTTGAGAATAAAAAGAAAGCC
TAATCATCAGCAATTATTTTATTTTTAATTTGGCCATCTCTGACATTGCAGTCAATATCTTAGGGTATTTTCTTGAATTTAATAAAGTCC
CATGGGTGGGTTCAGGGTGAATGGGAGTATTAACAACAACCAAAAAATATCTATTGAGACACAGTAGAGTCTCAGTAAGAGAAATATTAA
AATGTAAGAAAGGTCACCATTAGTGATATCAACTGTAGTTTGTTACTTTGAACTATATTTCTGATTAACTCTTTATAGTAATAACTTAGA
GCTGTTAGCTCAGATATCTTAATTAGCTCATATGAAAAACAAGTTTAATTTTATTATTTACTGAACATGGCAAAATGCTTTTCAATCTAT
AATAAAACTGGGATAAAAAATTGAAGTTGTTTTTTTTAAAACCTAATAGCAATAAGCAAAATTGGCATACATAATTTTTTTAATGAACTA
TATTTTGTCAGAATCTGAAGGTACTGAAAAACTATTCTAAAATGCCTACTTGTTTTTGCATTAATTTGTAATGCTTACATTTTGCACCCT
TAGATAATGTTTGATAAGATAAAAATATAATTTATCCCTTGTACCAACTCAAGTCAATCAGATTTTAACATGAAAAATATAGATTAATGT
ATGTCAGCTTTCTAGAGGTAGAATACTCAGCTATTTGATGGCATTTTTCCCACCCCATGTGAAATTTTATTTTTGGAAGTTATGCTAGTG
ACATTGCAATATATATTGAAATCTTCGGAGGCTGCCAGGTTGAGCTTCAAAACTAGACTTGAGAATCTTTCGTGTATATGCACATTCACT
TGATAATTGTGTATTCTATGTAGTTTAAAGTGGGATCAAGCCTTTTAAAATGTGTTATTAGTACTTAGAAGTTGTAAAACAGAACTTATA
GAGGTTTGTTACTAGACACTGAAACTGCATGACAAGTATCTGGTGTCTTAACTAATTAGATAGATCTGTTGTATTGGTTTTCTTGTTGGA
TAGAATAACAGTTAATCATTTTTAGAAGAGTTTTAGATTACTTGCCATAAAATTTGTATGTCTCAGCTCTTGTTGGTTTAGGAGCAGAAG
TGGTGTTTAGTCCCTTCCCGTTAATGTTGCTGTGCTACTTCAGACAGCTGAAAACTTAATGGTATTATTTCAAGTTCACATAACCCTAAA
AAAGGTTTTCTTTGTGTAGTAACTTGTGCTTAAACTTTTAGTCAATTAAATGTAGGAGGTTTTATTTGAAAACATAAAATGATTCTCTAA
ATTACATCTTGTTTTAAGCCACCAAAATGAATGCAGTAATTTTTCTTTAAAAAAATGATCTCTGAAAACTGTGAGACAATGTAAAAAGAA

>In-frame_MYO6_ENST00000369985_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_1208nt
GGGGACTCGGCGGGGCGCCGGCCGGCGGGCGGAGACCGACTCGGGATCTGTCCGAGCAGGAAGCCAGCCTCAGCCCGGCCGCTGTCGCCG
CCCTGTCCTGGTGCCCGTCCGCGTCGTCGCCCTCTTCACTGGCCCTCATCACTTCTCACCGCGCCCTCCAGCTTCACCCGTACAGGTAGC
CCCGCCGCCGCGCACCTGCCTTCGCTCCCGCACCGGTGACAGTGGATAGTGGAAACAGGAGATCGTGGATCCTCCTTCAAAAATGGAGGA
TGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACAATTGAACC
CTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGGCATTTAAA
GCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTAAGAGAGTA
TTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTACCACAGCA
AAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTACCTATGAA
TTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGATCAGAGCAA
AGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCAGATTGACC
ATTTCTGTTACTTGTCATTTCTACTTTCAGAAACTAAATGACTTTCAAATTTGGGTATAGACAATAAAGAACTGAAGTGCTCACTACTCA
GTGATTTGGAAATTTTGATGCTTGTATAAATGTCAGATAATTAATTTCCAAAGGCGTATGTATTAAGTAAAAGTCTGTAAATATGTTAAT
GAGGCCAATTTTTCCAGCATTTATAATTATTTTTTTCACTTGTTAGGAAGCTTTTGTTATGTATTTTCTGTTAATAGTACCTAAAATTGC

>In-frame_MYO6_ENST00000369985_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_3585nt
GGGGACTCGGCGGGGCGCCGGCCGGCGGGCGGAGACCGACTCGGGATCTGTCCGAGCAGGAAGCCAGCCTCAGCCCGGCCGCTGTCGCCG
CCCTGTCCTGGTGCCCGTCCGCGTCGTCGCCCTCTTCACTGGCCCTCATCACTTCTCACCGCGCCCTCCAGCTTCACCCGTACAGGTAGC
CCCGCCGCCGCGCACCTGCCTTCGCTCCCGCACCGGTGACAGTGGATAGTGGAAACAGGAGATCGTGGATCCTCCTTCAAAAATGGAGGA
TGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACAATTGAACC
CTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGGCATTTAAA
GCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTAAGAGAGTA
TTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTACCACAGCA
AAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTACCTATGAA
TTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGATCAGAGCAA
AGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCAGATTGACC
ATTTCTGTTACTTGTCATTTCTACTTTCAGAAACTAAATGACTTTCAAATTTGGGTATAGACAATAAAGAACTGAAGTGCTCACTACTCA
GTGATTTGGAAATTTTGATGCTTGTATAAATGTCAGATAATTAATTTCCAAAGGCGTATGTATTAAGTAAAAGTCTGTAAATATGTTAAT
GAGGCCAATTTTTCCAGCATTTATAATTATTTTTTTCACTTGTTAGGAAGCTTTTGTTATGTATTTTCTGTTAATAGTACCTAAAATTGC
AACTTCTAAACACAAATAAAAAGAAAATATTTATAGGAGGAAATGATTAATTTGATATTCTTTAGTGAACTTGTTTAATTCCTCAGTGGG
TGTGACATATTTCATGGGAATATTCAAATATCTATGGTAATATTTTGACCCTTTATATTTGTTCTAAAATAAGTCAAAATGTGAAAATAA
TATTAAATCTAAGATATTTTGAACTAAGCATCTTTATATGCTTGTGTAACAGGAACAAAGTAACAGCCTTTCAATTCATATACTGCCTTG
TGTTCAGTGAACCCAAGAAATGTAATAAATATTTGTAATTTTACACAAATATTTAAGAGGAAAGAGTATTAAGAGCAATTCAAAAAAAGT
AACCTTATACTACTAAAAAAAAAATTCTTGCATATATTATCATCAAATGCATTTTTGAAGACATCAAAGACTCAGGTTAAAACTATTTTG
GTAAGTGCAGCTTGAATTTCAAATATCCCGTGTTACCTTTCTCTATTACAGCTTAAAGTATGCTACAATCTGTGTCATATAGTTAATTGA
TAAGCATTTTTAATCTGTGTAAACACAGGAATTTAAATAGGAATTTACTATTTTTTTATAAAGCTTTTGCTATTTTTTCATTGCTCATTT
TGTTCTTATTATTTTGATAAAGTATCAGACTTTTTGCTTGAGTTCTTCAGTGTAAATTATTTTTTACATGTAAAAGTACTGTATTCAACC
AGTTGCATAATACAGCAAAAATCTTTGAATTCCCCTTTAAAATAACTAAAATTTGATGGTTTCCATGACAGATTTATAGCACATATAGGG
ATCTTGCATGTATCTGCAGAAACTTCATTATTTTTCAAATGAAATGGTGTATACTTCTTTCAAATGAACTTTGAGACTTGAAACATATTT
TAGTCATTTTTTGTTAAATATTGAATTTTTAAATACACATATATCAAAAATAGTTGAGAATAAAAAGAAAGCCTAATCATCAGCAATTAT
TTTATTTTTAATTTGGCCATCTCTGACATTGCAGTCAATATCTTAGGGTATTTTCTTGAATTTAATAAAGTCCCATGGGTGGGTTCAGGG
TGAATGGGAGTATTAACAACAACCAAAAAATATCTATTGAGACACAGTAGAGTCTCAGTAAGAGAAATATTAAAATGTAAGAAAGGTCAC
CATTAGTGATATCAACTGTAGTTTGTTACTTTGAACTATATTTCTGATTAACTCTTTATAGTAATAACTTAGAGCTGTTAGCTCAGATAT
CTTAATTAGCTCATATGAAAAACAAGTTTAATTTTATTATTTACTGAACATGGCAAAATGCTTTTCAATCTATAATAAAACTGGGATAAA
AAATTGAAGTTGTTTTTTTTAAAACCTAATAGCAATAAGCAAAATTGGCATACATAATTTTTTTAATGAACTATATTTTGTCAGAATCTG
AAGGTACTGAAAAACTATTCTAAAATGCCTACTTGTTTTTGCATTAATTTGTAATGCTTACATTTTGCACCCTTAGATAATGTTTGATAA
GATAAAAATATAATTTATCCCTTGTACCAACTCAAGTCAATCAGATTTTAACATGAAAAATATAGATTAATGTATGTCAGCTTTCTAGAG
GTAGAATACTCAGCTATTTGATGGCATTTTTCCCACCCCATGTGAAATTTTATTTTTGGAAGTTATGCTAGTGACATTGCAATATATATT
GAAATCTTCGGAGGCTGCCAGGTTGAGCTTCAAAACTAGACTTGAGAATCTTTCGTGTATATGCACATTCACTTGATAATTGTGTATTCT
ATGTAGTTTAAAGTGGGATCAAGCCTTTTAAAATGTGTTATTAGTACTTAGAAGTTGTAAAACAGAACTTATAGAGGTTTGTTACTAGAC
ACTGAAACTGCATGACAAGTATCTGGTGTCTTAACTAATTAGATAGATCTGTTGTATTGGTTTTCTTGTTGGATAGAATAACAGTTAATC
ATTTTTAGAAGAGTTTTAGATTACTTGCCATAAAATTTGTATGTCTCAGCTCTTGTTGGTTTAGGAGCAGAAGTGGTGTTTAGTCCCTTC
CCGTTAATGTTGCTGTGCTACTTCAGACAGCTGAAAACTTAATGGTATTATTTCAAGTTCACATAACCCTAAAAAAGGTTTTCTTTGTGT
AGTAACTTGTGCTTAAACTTTTAGTCAATTAAATGTAGGAGGTTTTATTTGAAAACATAAAATGATTCTCTAAATTACATCTTGTTTTAA
GCCACCAAAATGAATGCAGTAATTTTTCTTTAAAAAAATGATCTCTGAAAACTGTGAGACAATGTAAAAAGAATAAGTTTTAATTCCCCC

>In-frame_MYO6_ENST00000369985_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_3582nt
GGGGACTCGGCGGGGCGCCGGCCGGCGGGCGGAGACCGACTCGGGATCTGTCCGAGCAGGAAGCCAGCCTCAGCCCGGCCGCTGTCGCCG
CCCTGTCCTGGTGCCCGTCCGCGTCGTCGCCCTCTTCACTGGCCCTCATCACTTCTCACCGCGCCCTCCAGCTTCACCCGTACAGGTAGC
CCCGCCGCCGCGCACCTGCCTTCGCTCCCGCACCGGTGACAGTGGATAGTGGAAACAGGAGATCGTGGATCCTCCTTCAAAAATGGAGGA
TGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACAATTGAACC
CTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGGCATTTAAA
GCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTAAGAGAGTA
TTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTACCACAGCA
AAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTACCTATGAA
TTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGATCAGAGCAA
AGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCAGATTGACC
ATTTCTGTTACTTGTCATTTCTACTTTCAGAAACTAAATGACTTTCAAATTTGGGTATAGACAATAAAGAACTGAAGTGCTCACTACTCA
GTGATTTGGAAATTTTGATGCTTGTATAAATGTCAGATAATTAATTTCCAAAGGCGTATGTATTAAGTAAAAGTCTGTAAATATGTTAAT
GAGGCCAATTTTTCCAGCATTTATAATTATTTTTTTCACTTGTTAGGAAGCTTTTGTTATGTATTTTCTGTTAATAGTACCTAAAATTGC
AACTTCTAAACACAAATAAAAAGAAAATATTTATAGGAGGAAATGATTAATTTGATATTCTTTAGTGAACTTGTTTAATTCCTCAGTGGG
TGTGACATATTTCATGGGAATATTCAAATATCTATGGTAATATTTTGACCCTTTATATTTGTTCTAAAATAAGTCAAAATGTGAAAATAA
TATTAAATCTAAGATATTTTGAACTAAGCATCTTTATATGCTTGTGTAACAGGAACAAAGTAACAGCCTTTCAATTCATATACTGCCTTG
TGTTCAGTGAACCCAAGAAATGTAATAAATATTTGTAATTTTACACAAATATTTAAGAGGAAAGAGTATTAAGAGCAATTCAAAAAAAGT
AACCTTATACTACTAAAAAAAAAATTCTTGCATATATTATCATCAAATGCATTTTTGAAGACATCAAAGACTCAGGTTAAAACTATTTTG
GTAAGTGCAGCTTGAATTTCAAATATCCCGTGTTACCTTTCTCTATTACAGCTTAAAGTATGCTACAATCTGTGTCATATAGTTAATTGA
TAAGCATTTTTAATCTGTGTAAACACAGGAATTTAAATAGGAATTTACTATTTTTTTATAAAGCTTTTGCTATTTTTTCATTGCTCATTT
TGTTCTTATTATTTTGATAAAGTATCAGACTTTTTGCTTGAGTTCTTCAGTGTAAATTATTTTTTACATGTAAAAGTACTGTATTCAACC
AGTTGCATAATACAGCAAAAATCTTTGAATTCCCCTTTAAAATAACTAAAATTTGATGGTTTCCATGACAGATTTATAGCACATATAGGG
ATCTTGCATGTATCTGCAGAAACTTCATTATTTTTCAAATGAAATGGTGTATACTTCTTTCAAATGAACTTTGAGACTTGAAACATATTT
TAGTCATTTTTTGTTAAATATTGAATTTTTAAATACACATATATCAAAAATAGTTGAGAATAAAAAGAAAGCCTAATCATCAGCAATTAT
TTTATTTTTAATTTGGCCATCTCTGACATTGCAGTCAATATCTTAGGGTATTTTCTTGAATTTAATAAAGTCCCATGGGTGGGTTCAGGG
TGAATGGGAGTATTAACAACAACCAAAAAATATCTATTGAGACACAGTAGAGTCTCAGTAAGAGAAATATTAAAATGTAAGAAAGGTCAC
CATTAGTGATATCAACTGTAGTTTGTTACTTTGAACTATATTTCTGATTAACTCTTTATAGTAATAACTTAGAGCTGTTAGCTCAGATAT
CTTAATTAGCTCATATGAAAAACAAGTTTAATTTTATTATTTACTGAACATGGCAAAATGCTTTTCAATCTATAATAAAACTGGGATAAA
AAATTGAAGTTGTTTTTTTTAAAACCTAATAGCAATAAGCAAAATTGGCATACATAATTTTTTTAATGAACTATATTTTGTCAGAATCTG
AAGGTACTGAAAAACTATTCTAAAATGCCTACTTGTTTTTGCATTAATTTGTAATGCTTACATTTTGCACCCTTAGATAATGTTTGATAA
GATAAAAATATAATTTATCCCTTGTACCAACTCAAGTCAATCAGATTTTAACATGAAAAATATAGATTAATGTATGTCAGCTTTCTAGAG
GTAGAATACTCAGCTATTTGATGGCATTTTTCCCACCCCATGTGAAATTTTATTTTTGGAAGTTATGCTAGTGACATTGCAATATATATT
GAAATCTTCGGAGGCTGCCAGGTTGAGCTTCAAAACTAGACTTGAGAATCTTTCGTGTATATGCACATTCACTTGATAATTGTGTATTCT
ATGTAGTTTAAAGTGGGATCAAGCCTTTTAAAATGTGTTATTAGTACTTAGAAGTTGTAAAACAGAACTTATAGAGGTTTGTTACTAGAC
ACTGAAACTGCATGACAAGTATCTGGTGTCTTAACTAATTAGATAGATCTGTTGTATTGGTTTTCTTGTTGGATAGAATAACAGTTAATC
ATTTTTAGAAGAGTTTTAGATTACTTGCCATAAAATTTGTATGTCTCAGCTCTTGTTGGTTTAGGAGCAGAAGTGGTGTTTAGTCCCTTC
CCGTTAATGTTGCTGTGCTACTTCAGACAGCTGAAAACTTAATGGTATTATTTCAAGTTCACATAACCCTAAAAAAGGTTTTCTTTGTGT
AGTAACTTGTGCTTAAACTTTTAGTCAATTAAATGTAGGAGGTTTTATTTGAAAACATAAAATGATTCTCTAAATTACATCTTGTTTTAA
GCCACCAAAATGAATGCAGTAATTTTTCTTTAAAAAAATGATCTCTGAAAACTGTGAGACAATGTAAAAAGAATAAGTTTTAATTCCCCC

>In-frame_MYO6_ENST00000369977_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_1085nt
CTTCACTGGCCCTCATCACTTCTCACCGCGCCCTCCAGCTTCACCCGTACAGGTAGCCCCGCCGCCGCGCACCTGCCTTCGCTCCCGCAC
CGGTGACAGTGGATAGTGGAAACAGGAGATCGTGGATCCTCCTTCAAAAATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGA
TGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGA
CGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGGCATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACT
TATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTAAGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAG
CAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTACCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATT
GCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTACCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAG
AACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGATCAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAAC
AGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCAGATTGACCATTTCTGTTACTTGTCATTTCTACTTTCAGAAA
CTAAATGACTTTCAAATTTGGGTATAGACAATAAAGAACTGAAGTGCTCACTACTCAGTGATTTGGAAATTTTGATGCTTGTATAAATGT
CAGATAATTAATTTCCAAAGGCGTATGTATTAAGTAAAAGTCTGTAAATATGTTAATGAGGCCAATTTTTCCAGCATTTATAATTATTTT
TTTCACTTGTTAGGAAGCTTTTGTTATGTATTTTCTGTTAATAGTACCTAAAATTGCAACTTCTAAACACAAATAAAAAGAAAATATTTA

>In-frame_MYO6_ENST00000369977_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_3462nt
CTTCACTGGCCCTCATCACTTCTCACCGCGCCCTCCAGCTTCACCCGTACAGGTAGCCCCGCCGCCGCGCACCTGCCTTCGCTCCCGCAC
CGGTGACAGTGGATAGTGGAAACAGGAGATCGTGGATCCTCCTTCAAAAATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGA
TGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGA
CGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGGCATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACT
TATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTAAGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAG
CAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTACCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATT
GCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTACCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAG
AACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGATCAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAAC
AGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCAGATTGACCATTTCTGTTACTTGTCATTTCTACTTTCAGAAA
CTAAATGACTTTCAAATTTGGGTATAGACAATAAAGAACTGAAGTGCTCACTACTCAGTGATTTGGAAATTTTGATGCTTGTATAAATGT
CAGATAATTAATTTCCAAAGGCGTATGTATTAAGTAAAAGTCTGTAAATATGTTAATGAGGCCAATTTTTCCAGCATTTATAATTATTTT
TTTCACTTGTTAGGAAGCTTTTGTTATGTATTTTCTGTTAATAGTACCTAAAATTGCAACTTCTAAACACAAATAAAAAGAAAATATTTA
TAGGAGGAAATGATTAATTTGATATTCTTTAGTGAACTTGTTTAATTCCTCAGTGGGTGTGACATATTTCATGGGAATATTCAAATATCT
ATGGTAATATTTTGACCCTTTATATTTGTTCTAAAATAAGTCAAAATGTGAAAATAATATTAAATCTAAGATATTTTGAACTAAGCATCT
TTATATGCTTGTGTAACAGGAACAAAGTAACAGCCTTTCAATTCATATACTGCCTTGTGTTCAGTGAACCCAAGAAATGTAATAAATATT
TGTAATTTTACACAAATATTTAAGAGGAAAGAGTATTAAGAGCAATTCAAAAAAAGTAACCTTATACTACTAAAAAAAAAATTCTTGCAT
ATATTATCATCAAATGCATTTTTGAAGACATCAAAGACTCAGGTTAAAACTATTTTGGTAAGTGCAGCTTGAATTTCAAATATCCCGTGT
TACCTTTCTCTATTACAGCTTAAAGTATGCTACAATCTGTGTCATATAGTTAATTGATAAGCATTTTTAATCTGTGTAAACACAGGAATT
TAAATAGGAATTTACTATTTTTTTATAAAGCTTTTGCTATTTTTTCATTGCTCATTTTGTTCTTATTATTTTGATAAAGTATCAGACTTT
TTGCTTGAGTTCTTCAGTGTAAATTATTTTTTACATGTAAAAGTACTGTATTCAACCAGTTGCATAATACAGCAAAAATCTTTGAATTCC
CCTTTAAAATAACTAAAATTTGATGGTTTCCATGACAGATTTATAGCACATATAGGGATCTTGCATGTATCTGCAGAAACTTCATTATTT
TTCAAATGAAATGGTGTATACTTCTTTCAAATGAACTTTGAGACTTGAAACATATTTTAGTCATTTTTTGTTAAATATTGAATTTTTAAA
TACACATATATCAAAAATAGTTGAGAATAAAAAGAAAGCCTAATCATCAGCAATTATTTTATTTTTAATTTGGCCATCTCTGACATTGCA
GTCAATATCTTAGGGTATTTTCTTGAATTTAATAAAGTCCCATGGGTGGGTTCAGGGTGAATGGGAGTATTAACAACAACCAAAAAATAT
CTATTGAGACACAGTAGAGTCTCAGTAAGAGAAATATTAAAATGTAAGAAAGGTCACCATTAGTGATATCAACTGTAGTTTGTTACTTTG
AACTATATTTCTGATTAACTCTTTATAGTAATAACTTAGAGCTGTTAGCTCAGATATCTTAATTAGCTCATATGAAAAACAAGTTTAATT
TTATTATTTACTGAACATGGCAAAATGCTTTTCAATCTATAATAAAACTGGGATAAAAAATTGAAGTTGTTTTTTTTAAAACCTAATAGC
AATAAGCAAAATTGGCATACATAATTTTTTTAATGAACTATATTTTGTCAGAATCTGAAGGTACTGAAAAACTATTCTAAAATGCCTACT
TGTTTTTGCATTAATTTGTAATGCTTACATTTTGCACCCTTAGATAATGTTTGATAAGATAAAAATATAATTTATCCCTTGTACCAACTC
AAGTCAATCAGATTTTAACATGAAAAATATAGATTAATGTATGTCAGCTTTCTAGAGGTAGAATACTCAGCTATTTGATGGCATTTTTCC
CACCCCATGTGAAATTTTATTTTTGGAAGTTATGCTAGTGACATTGCAATATATATTGAAATCTTCGGAGGCTGCCAGGTTGAGCTTCAA
AACTAGACTTGAGAATCTTTCGTGTATATGCACATTCACTTGATAATTGTGTATTCTATGTAGTTTAAAGTGGGATCAAGCCTTTTAAAA
TGTGTTATTAGTACTTAGAAGTTGTAAAACAGAACTTATAGAGGTTTGTTACTAGACACTGAAACTGCATGACAAGTATCTGGTGTCTTA
ACTAATTAGATAGATCTGTTGTATTGGTTTTCTTGTTGGATAGAATAACAGTTAATCATTTTTAGAAGAGTTTTAGATTACTTGCCATAA
AATTTGTATGTCTCAGCTCTTGTTGGTTTAGGAGCAGAAGTGGTGTTTAGTCCCTTCCCGTTAATGTTGCTGTGCTACTTCAGACAGCTG
AAAACTTAATGGTATTATTTCAAGTTCACATAACCCTAAAAAAGGTTTTCTTTGTGTAGTAACTTGTGCTTAAACTTTTAGTCAATTAAA
TGTAGGAGGTTTTATTTGAAAACATAAAATGATTCTCTAAATTACATCTTGTTTTAAGCCACCAAAATGAATGCAGTAATTTTTCTTTAA
AAAAATGATCTCTGAAAACTGTGAGACAATGTAAAAAGAATAAGTTTTAATTCCCCCAAAATCAAAAATTGTACTTAAAATCTCAGACAA

>In-frame_MYO6_ENST00000369977_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_3459nt
CTTCACTGGCCCTCATCACTTCTCACCGCGCCCTCCAGCTTCACCCGTACAGGTAGCCCCGCCGCCGCGCACCTGCCTTCGCTCCCGCAC
CGGTGACAGTGGATAGTGGAAACAGGAGATCGTGGATCCTCCTTCAAAAATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGA
TGGATTTCAGATGGGCAATATTGTGGATATTGGCCCCGACAGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGA
CGATGGATTCCTCGCTGATGACAACTGCAGTTCAGAAATAGGACAGTGGCATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACT
TATGGACTCACTCCGAGGCCCTTCTCGGTCAAATGTTGTCAAAATTTTAAGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAG
CAAAAGAAGTTTTTCCAAAGATGTTATGAAGGGCTCTAATCCAAAAGTACCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATT
GCAGTATGTAGAGAGCTTTTTTGAGAATCCAATTCTCAGTTTTGAACTACCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAG
AACAAAAAGAGAAGAAATCCGAAACATAATTCTGAAGCTACAGGAAGATCAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAAC
AGAAGCACCTTTAGGCGAAGGAACAGAACAATATGTCAATAGTATCTCAGATTGACCATTTCTGTTACTTGTCATTTCTACTTTCAGAAA
CTAAATGACTTTCAAATTTGGGTATAGACAATAAAGAACTGAAGTGCTCACTACTCAGTGATTTGGAAATTTTGATGCTTGTATAAATGT
CAGATAATTAATTTCCAAAGGCGTATGTATTAAGTAAAAGTCTGTAAATATGTTAATGAGGCCAATTTTTCCAGCATTTATAATTATTTT
TTTCACTTGTTAGGAAGCTTTTGTTATGTATTTTCTGTTAATAGTACCTAAAATTGCAACTTCTAAACACAAATAAAAAGAAAATATTTA
TAGGAGGAAATGATTAATTTGATATTCTTTAGTGAACTTGTTTAATTCCTCAGTGGGTGTGACATATTTCATGGGAATATTCAAATATCT
ATGGTAATATTTTGACCCTTTATATTTGTTCTAAAATAAGTCAAAATGTGAAAATAATATTAAATCTAAGATATTTTGAACTAAGCATCT
TTATATGCTTGTGTAACAGGAACAAAGTAACAGCCTTTCAATTCATATACTGCCTTGTGTTCAGTGAACCCAAGAAATGTAATAAATATT
TGTAATTTTACACAAATATTTAAGAGGAAAGAGTATTAAGAGCAATTCAAAAAAAGTAACCTTATACTACTAAAAAAAAAATTCTTGCAT
ATATTATCATCAAATGCATTTTTGAAGACATCAAAGACTCAGGTTAAAACTATTTTGGTAAGTGCAGCTTGAATTTCAAATATCCCGTGT
TACCTTTCTCTATTACAGCTTAAAGTATGCTACAATCTGTGTCATATAGTTAATTGATAAGCATTTTTAATCTGTGTAAACACAGGAATT
TAAATAGGAATTTACTATTTTTTTATAAAGCTTTTGCTATTTTTTCATTGCTCATTTTGTTCTTATTATTTTGATAAAGTATCAGACTTT
TTGCTTGAGTTCTTCAGTGTAAATTATTTTTTACATGTAAAAGTACTGTATTCAACCAGTTGCATAATACAGCAAAAATCTTTGAATTCC
CCTTTAAAATAACTAAAATTTGATGGTTTCCATGACAGATTTATAGCACATATAGGGATCTTGCATGTATCTGCAGAAACTTCATTATTT
TTCAAATGAAATGGTGTATACTTCTTTCAAATGAACTTTGAGACTTGAAACATATTTTAGTCATTTTTTGTTAAATATTGAATTTTTAAA
TACACATATATCAAAAATAGTTGAGAATAAAAAGAAAGCCTAATCATCAGCAATTATTTTATTTTTAATTTGGCCATCTCTGACATTGCA
GTCAATATCTTAGGGTATTTTCTTGAATTTAATAAAGTCCCATGGGTGGGTTCAGGGTGAATGGGAGTATTAACAACAACCAAAAAATAT
CTATTGAGACACAGTAGAGTCTCAGTAAGAGAAATATTAAAATGTAAGAAAGGTCACCATTAGTGATATCAACTGTAGTTTGTTACTTTG
AACTATATTTCTGATTAACTCTTTATAGTAATAACTTAGAGCTGTTAGCTCAGATATCTTAATTAGCTCATATGAAAAACAAGTTTAATT
TTATTATTTACTGAACATGGCAAAATGCTTTTCAATCTATAATAAAACTGGGATAAAAAATTGAAGTTGTTTTTTTTAAAACCTAATAGC
AATAAGCAAAATTGGCATACATAATTTTTTTAATGAACTATATTTTGTCAGAATCTGAAGGTACTGAAAAACTATTCTAAAATGCCTACT
TGTTTTTGCATTAATTTGTAATGCTTACATTTTGCACCCTTAGATAATGTTTGATAAGATAAAAATATAATTTATCCCTTGTACCAACTC
AAGTCAATCAGATTTTAACATGAAAAATATAGATTAATGTATGTCAGCTTTCTAGAGGTAGAATACTCAGCTATTTGATGGCATTTTTCC
CACCCCATGTGAAATTTTATTTTTGGAAGTTATGCTAGTGACATTGCAATATATATTGAAATCTTCGGAGGCTGCCAGGTTGAGCTTCAA
AACTAGACTTGAGAATCTTTCGTGTATATGCACATTCACTTGATAATTGTGTATTCTATGTAGTTTAAAGTGGGATCAAGCCTTTTAAAA
TGTGTTATTAGTACTTAGAAGTTGTAAAACAGAACTTATAGAGGTTTGTTACTAGACACTGAAACTGCATGACAAGTATCTGGTGTCTTA
ACTAATTAGATAGATCTGTTGTATTGGTTTTCTTGTTGGATAGAATAACAGTTAATCATTTTTAGAAGAGTTTTAGATTACTTGCCATAA
AATTTGTATGTCTCAGCTCTTGTTGGTTTAGGAGCAGAAGTGGTGTTTAGTCCCTTCCCGTTAATGTTGCTGTGCTACTTCAGACAGCTG
AAAACTTAATGGTATTATTTCAAGTTCACATAACCCTAAAAAAGGTTTTCTTTGTGTAGTAACTTGTGCTTAAACTTTTAGTCAATTAAA
TGTAGGAGGTTTTATTTGAAAACATAAAATGATTCTCTAAATTACATCTTGTTTTAAGCCACCAAAATGAATGCAGTAATTTTTCTTTAA
AAAAATGATCTCTGAAAACTGTGAGACAATGTAAAAAGAATAAGTTTTAATTCCCCCAAAATCAAAAATTGTACTTAAAATCTCAGACAA

>In-frame_MYO6_ENST00000369975_chr6_76527381_+_SENP6_ENST00000370010_chr6_76421044_+_971nt
GGAGATCGTGGATCCTCCTTCAAAAATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGT
GGATATTGGCCCCGACAGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAA
CTGCAGTTCAGAAATAGGACAGTGGCATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTC
TCGGTCAAATGTTGTCAAAATTTTAAGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGT
TATGAAGGGCTCTAATCCAAAAGTACCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGA
GAATCCAATTCTCAGTTTTGAACTACCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAA
CATAATTCTGAAGCTACAGGAAGATCAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAAC
AGAACAATATGTCAATAGTATCTCAGATTGACCATTTCTGTTACTTGTCATTTCTACTTTCAGAAACTAAATGACTTTCAAATTTGGGTA
TAGACAATAAAGAACTGAAGTGCTCACTACTCAGTGATTTGGAAATTTTGATGCTTGTATAAATGTCAGATAATTAATTTCCAAAGGCGT
ATGTATTAAGTAAAAGTCTGTAAATATGTTAATGAGGCCAATTTTTCCAGCATTTATAATTATTTTTTTCACTTGTTAGGAAGCTTTTGT

>In-frame_MYO6_ENST00000369975_chr6_76527381_+_SENP6_ENST00000370014_chr6_76421044_+_3348nt
GGAGATCGTGGATCCTCCTTCAAAAATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGT
GGATATTGGCCCCGACAGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAA
CTGCAGTTCAGAAATAGGACAGTGGCATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTC
TCGGTCAAATGTTGTCAAAATTTTAAGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGT
TATGAAGGGCTCTAATCCAAAAGTACCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGA
GAATCCAATTCTCAGTTTTGAACTACCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAA
CATAATTCTGAAGCTACAGGAAGATCAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAAC
AGAACAATATGTCAATAGTATCTCAGATTGACCATTTCTGTTACTTGTCATTTCTACTTTCAGAAACTAAATGACTTTCAAATTTGGGTA
TAGACAATAAAGAACTGAAGTGCTCACTACTCAGTGATTTGGAAATTTTGATGCTTGTATAAATGTCAGATAATTAATTTCCAAAGGCGT
ATGTATTAAGTAAAAGTCTGTAAATATGTTAATGAGGCCAATTTTTCCAGCATTTATAATTATTTTTTTCACTTGTTAGGAAGCTTTTGT
TATGTATTTTCTGTTAATAGTACCTAAAATTGCAACTTCTAAACACAAATAAAAAGAAAATATTTATAGGAGGAAATGATTAATTTGATA
TTCTTTAGTGAACTTGTTTAATTCCTCAGTGGGTGTGACATATTTCATGGGAATATTCAAATATCTATGGTAATATTTTGACCCTTTATA
TTTGTTCTAAAATAAGTCAAAATGTGAAAATAATATTAAATCTAAGATATTTTGAACTAAGCATCTTTATATGCTTGTGTAACAGGAACA
AAGTAACAGCCTTTCAATTCATATACTGCCTTGTGTTCAGTGAACCCAAGAAATGTAATAAATATTTGTAATTTTACACAAATATTTAAG
AGGAAAGAGTATTAAGAGCAATTCAAAAAAAGTAACCTTATACTACTAAAAAAAAAATTCTTGCATATATTATCATCAAATGCATTTTTG
AAGACATCAAAGACTCAGGTTAAAACTATTTTGGTAAGTGCAGCTTGAATTTCAAATATCCCGTGTTACCTTTCTCTATTACAGCTTAAA
GTATGCTACAATCTGTGTCATATAGTTAATTGATAAGCATTTTTAATCTGTGTAAACACAGGAATTTAAATAGGAATTTACTATTTTTTT
ATAAAGCTTTTGCTATTTTTTCATTGCTCATTTTGTTCTTATTATTTTGATAAAGTATCAGACTTTTTGCTTGAGTTCTTCAGTGTAAAT
TATTTTTTACATGTAAAAGTACTGTATTCAACCAGTTGCATAATACAGCAAAAATCTTTGAATTCCCCTTTAAAATAACTAAAATTTGAT
GGTTTCCATGACAGATTTATAGCACATATAGGGATCTTGCATGTATCTGCAGAAACTTCATTATTTTTCAAATGAAATGGTGTATACTTC
TTTCAAATGAACTTTGAGACTTGAAACATATTTTAGTCATTTTTTGTTAAATATTGAATTTTTAAATACACATATATCAAAAATAGTTGA
GAATAAAAAGAAAGCCTAATCATCAGCAATTATTTTATTTTTAATTTGGCCATCTCTGACATTGCAGTCAATATCTTAGGGTATTTTCTT
GAATTTAATAAAGTCCCATGGGTGGGTTCAGGGTGAATGGGAGTATTAACAACAACCAAAAAATATCTATTGAGACACAGTAGAGTCTCA
GTAAGAGAAATATTAAAATGTAAGAAAGGTCACCATTAGTGATATCAACTGTAGTTTGTTACTTTGAACTATATTTCTGATTAACTCTTT
ATAGTAATAACTTAGAGCTGTTAGCTCAGATATCTTAATTAGCTCATATGAAAAACAAGTTTAATTTTATTATTTACTGAACATGGCAAA
ATGCTTTTCAATCTATAATAAAACTGGGATAAAAAATTGAAGTTGTTTTTTTTAAAACCTAATAGCAATAAGCAAAATTGGCATACATAA
TTTTTTTAATGAACTATATTTTGTCAGAATCTGAAGGTACTGAAAAACTATTCTAAAATGCCTACTTGTTTTTGCATTAATTTGTAATGC
TTACATTTTGCACCCTTAGATAATGTTTGATAAGATAAAAATATAATTTATCCCTTGTACCAACTCAAGTCAATCAGATTTTAACATGAA
AAATATAGATTAATGTATGTCAGCTTTCTAGAGGTAGAATACTCAGCTATTTGATGGCATTTTTCCCACCCCATGTGAAATTTTATTTTT
GGAAGTTATGCTAGTGACATTGCAATATATATTGAAATCTTCGGAGGCTGCCAGGTTGAGCTTCAAAACTAGACTTGAGAATCTTTCGTG
TATATGCACATTCACTTGATAATTGTGTATTCTATGTAGTTTAAAGTGGGATCAAGCCTTTTAAAATGTGTTATTAGTACTTAGAAGTTG
TAAAACAGAACTTATAGAGGTTTGTTACTAGACACTGAAACTGCATGACAAGTATCTGGTGTCTTAACTAATTAGATAGATCTGTTGTAT
TGGTTTTCTTGTTGGATAGAATAACAGTTAATCATTTTTAGAAGAGTTTTAGATTACTTGCCATAAAATTTGTATGTCTCAGCTCTTGTT
GGTTTAGGAGCAGAAGTGGTGTTTAGTCCCTTCCCGTTAATGTTGCTGTGCTACTTCAGACAGCTGAAAACTTAATGGTATTATTTCAAG
TTCACATAACCCTAAAAAAGGTTTTCTTTGTGTAGTAACTTGTGCTTAAACTTTTAGTCAATTAAATGTAGGAGGTTTTATTTGAAAACA
TAAAATGATTCTCTAAATTACATCTTGTTTTAAGCCACCAAAATGAATGCAGTAATTTTTCTTTAAAAAAATGATCTCTGAAAACTGTGA
GACAATGTAAAAAGAATAAGTTTTAATTCCCCCAAAATCAAAAATTGTACTTAAAATCTCAGACAATTCACTGAACAGGAATAATAAAGA

>In-frame_MYO6_ENST00000369975_chr6_76527381_+_SENP6_ENST00000447266_chr6_76421044_+_3345nt
GGAGATCGTGGATCCTCCTTCAAAAATGGAGGATGGAAAGCCCGTTTGGGCGCCACACCCTACAGATGGATTTCAGATGGGCAATATTGT
GGATATTGGCCCCGACAGCTTAACAATTGAACCCTTGAATCAGAAAGGCAAGGATGATAGCAGTGACGATGGATTCCTCGCTGATGACAA
CTGCAGTTCAGAAATAGGACAGTGGCATTTAAAGCCTACTATCTGTAAACAACCTTGTATCCTACTTATGGACTCACTCCGAGGCCCTTC
TCGGTCAAATGTTGTCAAAATTTTAAGAGAGTATTTAGAAGTGGAATGGGAAGTTAAAAAAGGAAGCAAAAGAAGTTTTTCCAAAGATGT
TATGAAGGGCTCTAATCCAAAAGTACCACAGCAAAACAACTTCAGTGACTGTGGTGTATATGTATTGCAGTATGTAGAGAGCTTTTTTGA
GAATCCAATTCTCAGTTTTGAACTACCTATGAATTTGGCAAACTGGTTTCCTCCACCAAGAATGAGAACAAAAAGAGAAGAAATCCGAAA
CATAATTCTGAAGCTACAGGAAGATCAGAGCAAAGAGAAAAGAAAGCATAAGGACACTTACTCAACAGAAGCACCTTTAGGCGAAGGAAC
AGAACAATATGTCAATAGTATCTCAGATTGACCATTTCTGTTACTTGTCATTTCTACTTTCAGAAACTAAATGACTTTCAAATTTGGGTA
TAGACAATAAAGAACTGAAGTGCTCACTACTCAGTGATTTGGAAATTTTGATGCTTGTATAAATGTCAGATAATTAATTTCCAAAGGCGT
ATGTATTAAGTAAAAGTCTGTAAATATGTTAATGAGGCCAATTTTTCCAGCATTTATAATTATTTTTTTCACTTGTTAGGAAGCTTTTGT
TATGTATTTTCTGTTAATAGTACCTAAAATTGCAACTTCTAAACACAAATAAAAAGAAAATATTTATAGGAGGAAATGATTAATTTGATA
TTCTTTAGTGAACTTGTTTAATTCCTCAGTGGGTGTGACATATTTCATGGGAATATTCAAATATCTATGGTAATATTTTGACCCTTTATA
TTTGTTCTAAAATAAGTCAAAATGTGAAAATAATATTAAATCTAAGATATTTTGAACTAAGCATCTTTATATGCTTGTGTAACAGGAACA
AAGTAACAGCCTTTCAATTCATATACTGCCTTGTGTTCAGTGAACCCAAGAAATGTAATAAATATTTGTAATTTTACACAAATATTTAAG
AGGAAAGAGTATTAAGAGCAATTCAAAAAAAGTAACCTTATACTACTAAAAAAAAAATTCTTGCATATATTATCATCAAATGCATTTTTG
AAGACATCAAAGACTCAGGTTAAAACTATTTTGGTAAGTGCAGCTTGAATTTCAAATATCCCGTGTTACCTTTCTCTATTACAGCTTAAA
GTATGCTACAATCTGTGTCATATAGTTAATTGATAAGCATTTTTAATCTGTGTAAACACAGGAATTTAAATAGGAATTTACTATTTTTTT
ATAAAGCTTTTGCTATTTTTTCATTGCTCATTTTGTTCTTATTATTTTGATAAAGTATCAGACTTTTTGCTTGAGTTCTTCAGTGTAAAT
TATTTTTTACATGTAAAAGTACTGTATTCAACCAGTTGCATAATACAGCAAAAATCTTTGAATTCCCCTTTAAAATAACTAAAATTTGAT
GGTTTCCATGACAGATTTATAGCACATATAGGGATCTTGCATGTATCTGCAGAAACTTCATTATTTTTCAAATGAAATGGTGTATACTTC
TTTCAAATGAACTTTGAGACTTGAAACATATTTTAGTCATTTTTTGTTAAATATTGAATTTTTAAATACACATATATCAAAAATAGTTGA
GAATAAAAAGAAAGCCTAATCATCAGCAATTATTTTATTTTTAATTTGGCCATCTCTGACATTGCAGTCAATATCTTAGGGTATTTTCTT
GAATTTAATAAAGTCCCATGGGTGGGTTCAGGGTGAATGGGAGTATTAACAACAACCAAAAAATATCTATTGAGACACAGTAGAGTCTCA
GTAAGAGAAATATTAAAATGTAAGAAAGGTCACCATTAGTGATATCAACTGTAGTTTGTTACTTTGAACTATATTTCTGATTAACTCTTT
ATAGTAATAACTTAGAGCTGTTAGCTCAGATATCTTAATTAGCTCATATGAAAAACAAGTTTAATTTTATTATTTACTGAACATGGCAAA
ATGCTTTTCAATCTATAATAAAACTGGGATAAAAAATTGAAGTTGTTTTTTTTAAAACCTAATAGCAATAAGCAAAATTGGCATACATAA
TTTTTTTAATGAACTATATTTTGTCAGAATCTGAAGGTACTGAAAAACTATTCTAAAATGCCTACTTGTTTTTGCATTAATTTGTAATGC
TTACATTTTGCACCCTTAGATAATGTTTGATAAGATAAAAATATAATTTATCCCTTGTACCAACTCAAGTCAATCAGATTTTAACATGAA
AAATATAGATTAATGTATGTCAGCTTTCTAGAGGTAGAATACTCAGCTATTTGATGGCATTTTTCCCACCCCATGTGAAATTTTATTTTT
GGAAGTTATGCTAGTGACATTGCAATATATATTGAAATCTTCGGAGGCTGCCAGGTTGAGCTTCAAAACTAGACTTGAGAATCTTTCGTG
TATATGCACATTCACTTGATAATTGTGTATTCTATGTAGTTTAAAGTGGGATCAAGCCTTTTAAAATGTGTTATTAGTACTTAGAAGTTG
TAAAACAGAACTTATAGAGGTTTGTTACTAGACACTGAAACTGCATGACAAGTATCTGGTGTCTTAACTAATTAGATAGATCTGTTGTAT
TGGTTTTCTTGTTGGATAGAATAACAGTTAATCATTTTTAGAAGAGTTTTAGATTACTTGCCATAAAATTTGTATGTCTCAGCTCTTGTT
GGTTTAGGAGCAGAAGTGGTGTTTAGTCCCTTCCCGTTAATGTTGCTGTGCTACTTCAGACAGCTGAAAACTTAATGGTATTATTTCAAG
TTCACATAACCCTAAAAAAGGTTTTCTTTGTGTAGTAACTTGTGCTTAAACTTTTAGTCAATTAAATGTAGGAGGTTTTATTTGAAAACA
TAAAATGATTCTCTAAATTACATCTTGTTTTAAGCCACCAAAATGAATGCAGTAATTTTTCTTTAAAAAAATGATCTCTGAAAACTGTGA
GACAATGTAAAAAGAATAAGTTTTAATTCCCCCAAAATCAAAAATTGTACTTAAAATCTCAGACAATTCACTGAACAGGAATAATAAAGA


Top

FusionGenePPI for MYO6_SENP6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MYO6DAB2, GIPC1, CALM2, DAB1, CYLD, USP11, USP25, CDC42, APC, UBC, SP1, TAX1BP1, CALCOCO2, FBXO25, OPTN, LMTK2, AP2A1, CLTC, PAK1, CAPZA1, POLR2A, ESR1, RNF11, TOM1, TOM1L2, MYO6, PARK2, PAN2, FBXO6, TP53, ENO1, MOV10, NXF1, ALK, ABCE1, CDH1, NTRK1, DPP9, DNAJC2, G6PD, PAK2, RAD23A, RAD23B, NHLRC2, CAPZA2, CDK2, CLTB, DBN1, FLNA, GAK, MYH9, PPP1CB, PICALM, ACTR2, SYNPO, GTSE1, ANLN, MYO5C, MYO19, MYO18A, CFTR, RNF126, UBXN1, SEC16A, AP2B1, AP2A2, AP2M1, CLINT1, PIK3C2A, EPS15, REPS2, COPB2, DDB1, EPRS, VPRBP, DCTN1, GTPBP4, ARHGEF12, YTHDC2, DCTN2, DOCK7, POTEI, FBXO34, PPP1R9A, CUEDC1, FBXO30, TMOD2, ACTBL2, GSN, REPS1, WBP2, COX15, DLST, HSD17B10, PDHA1, G3BP1SENP6RUVBL2, KAT5, SUMO2, COPS5, LMNA, SP1, SUMO1, PLA2G2A, FHL3, EXO1, PRPF19, ZDBF2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMYO6chr6:76527381chr6:76421044ENST00000369977+2351116_1118391286OPTN
HgeneMYO6chr6:76527381chr6:76421044ENST00000369985+2331116_1118391263OPTN


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MYO6_SENP6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MYO6_SENP6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMYO6C2931767Deafness, autosomal dominant nonsyndromic sensorineural 222CTD_human;ORPHANET;UNIPROT
HgeneMYO6C0236969Substance-Related Disorders1CTD_human
HgeneMYO6C1843028Deafness, Autosomal Recessive 371CTD_human;UNIPROT