FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23164

FusionGeneSummary for MYO5A_OIP5

check button Fusion gene summary
Fusion gene informationFusion gene name: MYO5A_OIP5
Fusion gene ID: 23164
HgeneTgene
Gene symbol

MYO5A

OIP5

Gene ID

4644

11339

Gene namemyosin VAOpa interacting protein 5
SynonymsGS1|MYH12|MYO5|MYR125730547N13Rik|CT86|LINT-25|MIS18B|MIS18beta|hMIS18beta
Cytomap

15q21.2

15q15.1

Type of geneprotein-codingprotein-coding
Descriptionunconventional myosin-Vadilute myosin heavy chain, non-musclemyosin Vmyosin VA (heavy chain 12, myoxin)myosin, heavy polypeptide kinasemyosin-12myosin-Vamyoxinprotein Mis18-betaLAP2alpha interactor-25MIS18 kinetochore protein homolog Bcancer/testis antigen 86opa-interacting protein 5
Modification date2018051920180523
UniProtAcc

Q9Y4I1

O43482

Ensembl transtripts involved in fusion geneENST00000399231, ENST00000356338, 
ENST00000358212, ENST00000399233, 
ENST00000553916, 
ENST00000220514, 
Fusion gene scores* DoF score8 X 8 X 4=2562 X 2 X 2=8
# samples 82
** MAII scorelog2(8/256*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: MYO5A [Title/Abstract] AND OIP5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-JL-A3YX-01AMYO5Achr15

52689398

-OIP5chr15

41611978

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000399231ENST00000220514MYO5Achr15

52689398

-OIP5chr15

41611978

-
In-frameENST00000356338ENST00000220514MYO5Achr15

52689398

-OIP5chr15

41611978

-
In-frameENST00000358212ENST00000220514MYO5Achr15

52689398

-OIP5chr15

41611978

-
In-frameENST00000399233ENST00000220514MYO5Achr15

52689398

-OIP5chr15

41611978

-
In-frameENST00000553916ENST00000220514MYO5Achr15

52689398

-OIP5chr15

41611978

-

Top

FusionProtFeatures for MYO5A_OIP5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MYO5A

Q9Y4I1

OIP5

O43482

Processive actin-based motor that can move in largesteps approximating the 36-nm pseudo-repeat of the actin filament.Involved in melanosome transport. Also mediates the transport ofvesicles to the plasma membrane. May also be required for somepolarization process involved in dendrite formation.{ECO:0000269|PubMed:10448864}. Required for recruitment of CENPA to centromeres andnormal chromosome segregation during mitosis.{ECO:0000269|PubMed:17199038}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-10408_604391829DomainMyosin N-terminal SH3-like
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-10418_604391856DomainMyosin N-terminal SH3-like
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-1040163_1704391829Nucleotide bindingATP
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-1041163_1704391856Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-10401338_14454391829Coiled coilOntology_term=ECO:0000255
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-1040914_12374391829Coiled coilOntology_term=ECO:0000255
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-10411338_14454391856Coiled coilOntology_term=ECO:0000255
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-1041914_12374391856Coiled coilOntology_term=ECO:0000255
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-10401534_18104391829DomainDilute
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-104069_7634391829DomainMyosin motor
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-1040766_7884391829DomainIQ 1
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-1040789_8184391829DomainIQ 2
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-1040814_8364391829DomainIQ 3
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-1040837_8614391829DomainIQ 4
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-1040862_8834391829DomainIQ 5
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-1040885_9144391829DomainIQ 6
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-10411534_18104391856DomainDilute
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-104169_7634391856DomainMyosin motor
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-1041766_7884391856DomainIQ 1
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-1041789_8184391856DomainIQ 2
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-1041814_8364391856DomainIQ 3
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-1041837_8614391856DomainIQ 4
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-1041862_8834391856DomainIQ 5
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-1041885_9144391856DomainIQ 6
HgeneMYO5Achr15:52689398chr15:41611978ENST00000356338-1040643_6654391829RegionActin-binding
HgeneMYO5Achr15:52689398chr15:41611978ENST00000399231-1041643_6654391856RegionActin-binding
TgeneOIP5chr15:52689398chr15:41611978ENST00000220514-1575_174129230DomainMis18


Top

FusionGeneSequence for MYO5A_OIP5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MYO5A_ENST00000399231_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_540aa
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLR
VRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAK
LPEFKMLRLGNADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIF
CELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVKQHSFIGVLDIYGTYNLLFCGSC
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPENX

>In-frame_MYO5A_ENST00000356338_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_540aa
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLR
VRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAK
LPEFKMLRLGNADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIF
CELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVKQHSFIGVLDIYGTYNLLFCGSC
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPENX

>In-frame_MYO5A_ENST00000358212_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_540aa
MKSSSLETMFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLR
VRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAK
LPEFKMLRLGNADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIF
CELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVKQHSFIGVLDIYGTYNLLFCGSC
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPENX

>In-frame_MYO5A_ENST00000399233_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_540aa
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLR
VRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAK
LPEFKMLRLGNADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIF
CELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVKQHSFIGVLDIYGTYNLLFCGSC
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPENX

>In-frame_MYO5A_ENST00000553916_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_540aa
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLR
VRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAK
LPEFKMLRLGNADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIF
CELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVKQHSFIGVLDIYGTYNLLFCGSC
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPENX


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MYO5A_ENST00000399231_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_1620nt
ATGGCTGCGTCGGAGCTCTACACAAAGTTTGCCAGGGTTTGGATACCTGATCCAGAGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGAT
TATAAGCCAGGAGATAAAGTCCTCCTGCTTCACCTCGAGGAAGGAAAGGATTTGGAATACCATCTAGATCCAAAGACCAAGGAGCTGCCT
CACTTACGAAATCCTGACATACTTGTTGGTGAAAATGACCTCACAGCCCTCAGCTATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGA
GTCCGCTTTATTGATTCCAAACTTATTTATACGTATTGTGGTATAGTCCTAGTAGCTATAAATCCCTATGAACAGCTGCCTATTTATGGA
GAAGATATTATTAATGCATACAGTGGTCAGAACATGGGTGATATGGATCCACATATCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATG
GCCAGAGATGAACGAAATCAGTCCATCATCGTAAGTGGAGAGTCTGGGGCAGGAAAAACAGTCTCAGCTAAGTATGCCATGCGATACTTT
GCAACTGTGAGTGGTTCTGCCAGTGAGGCCAATGTGGAGGAAAAGGTCTTGGCCTCCAACCCCATCATGGAGTCCATTGGAAATGCTAAA
ACAACCAGGAATGATAATAGCAGCCGTTTTGGGAAGTATATTGAGATTGGTTTTGATAAGAGATATCGAATCATTGGTGCCAATATGAGA
ACTTATCTTTTAGAGAAATCCAGAGTGGTATTCCAGGCAGAAGAGGAGAGAAACTATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAG
TTACCTGAATTTAAAATGCTACGATTAGGAAATGCAGATAACTTTAATTACACAAAACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGAT
GATGCAAAGGAGATGGCACATACTAGGCAGGCCTGCACTTTGCTAGGAATTAGTGAATCTCATCAAATGGGAATTTTCCGAATACTTGCT
GGCATCCTTCACTTAGGCAATGTTGGATTTACATCCCGAGATGCAGACAGCTGCACAATACCTCCCAAGCATGAACCTCTCTGCATCTTC
TGTGAACTCATGGGTGTGGACTATGAGGAGATGTGTCACTGGCTCTGCCATCGGAAACTGGCTACTGCCACAGAGACATACATCAAGCCC
ATCTCCAAGCTGCAGGCCACAAATGCCCGCGATGCTTTGGCCAAGCACATCTATGCCAAGCTCTTTAACTGGATTGTAGATAATGTCAAT
CAGGCTCTCCATTCTGCTGTCAAACAGCACTCTTTTATTGGTGTGCTAGACATTTACGGTACTTACAACCTTTTATTCTGTGGTTCTTGT
GGGATTCCCGTTGGTTTCCATCTGTATTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTG
TGCTATCTCTTAAAAACAAAAGCCATAGTAAATGCATCAGAGATGGATATTCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAA
GAGAAGATAGTGCTAACGCACAATCGCTTAAAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGA

>In-frame_MYO5A_ENST00000356338_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_1620nt
ATGGCTGCGTCGGAGCTCTACACAAAGTTTGCCAGGGTTTGGATACCTGATCCAGAGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGAT
TATAAGCCAGGAGATAAAGTCCTCCTGCTTCACCTCGAGGAAGGAAAGGATTTGGAATACCATCTAGATCCAAAGACCAAGGAGCTGCCT
CACTTACGAAATCCTGACATACTTGTTGGTGAAAATGACCTCACAGCCCTCAGCTATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGA
GTCCGCTTTATTGATTCCAAACTTATTTATACGTATTGTGGTATAGTCCTAGTAGCTATAAATCCCTATGAACAGCTGCCTATTTATGGA
GAAGATATTATTAATGCATACAGTGGTCAGAACATGGGTGATATGGATCCACATATCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATG
GCCAGAGATGAACGAAATCAGTCCATCATCGTAAGTGGAGAGTCTGGGGCAGGAAAAACAGTCTCAGCTAAGTATGCCATGCGATACTTT
GCAACTGTGAGTGGTTCTGCCAGTGAGGCCAATGTGGAGGAAAAGGTCTTGGCCTCCAACCCCATCATGGAGTCCATTGGAAATGCTAAA
ACAACCAGGAATGATAATAGCAGCCGTTTTGGGAAGTATATTGAGATTGGTTTTGATAAGAGATATCGAATCATTGGTGCCAATATGAGA
ACTTATCTTTTAGAGAAATCCAGAGTGGTATTCCAGGCAGAAGAGGAGAGAAACTATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAG
TTACCTGAATTTAAAATGCTACGATTAGGAAATGCAGATAACTTTAATTACACAAAACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGAT
GATGCAAAGGAGATGGCACATACTAGGCAGGCCTGCACTTTGCTAGGAATTAGTGAATCTCATCAAATGGGAATTTTCCGAATACTTGCT
GGCATCCTTCACTTAGGCAATGTTGGATTTACATCCCGAGATGCAGACAGCTGCACAATACCTCCCAAGCATGAACCTCTCTGCATCTTC
TGTGAACTCATGGGTGTGGACTATGAGGAGATGTGTCACTGGCTCTGCCATCGGAAACTGGCTACTGCCACAGAGACATACATCAAGCCC
ATCTCCAAGCTGCAGGCCACAAATGCCCGCGATGCTTTGGCCAAGCACATCTATGCCAAGCTCTTTAACTGGATTGTAGATAATGTCAAT
CAGGCTCTCCATTCTGCTGTCAAACAGCACTCTTTTATTGGTGTGCTAGACATTTACGGTACTTACAACCTTTTATTCTGTGGTTCTTGT
GGGATTCCCGTTGGTTTCCATCTGTATTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTG
TGCTATCTCTTAAAAACAAAAGCCATAGTAAATGCATCAGAGATGGATATTCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAA
GAGAAGATAGTGCTAACGCACAATCGCTTAAAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGA

>In-frame_MYO5A_ENST00000358212_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_1620nt
ATGAAATCTAGTAGTTTGGAAACTATGTTTGCCAGGGTTTGGATACCTGATCCAGAGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGAT
TATAAGCCAGGAGATAAAGTCCTCCTGCTTCACCTCGAGGAAGGAAAGGATTTGGAATACCATCTAGATCCAAAGACCAAGGAGCTGCCT
CACTTACGAAATCCTGACATACTTGTTGGTGAAAATGACCTCACAGCCCTCAGCTATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGA
GTCCGCTTTATTGATTCCAAACTTATTTATACGTATTGTGGTATAGTCCTAGTAGCTATAAATCCCTATGAACAGCTGCCTATTTATGGA
GAAGATATTATTAATGCATACAGTGGTCAGAACATGGGTGATATGGATCCACATATCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATG
GCCAGAGATGAACGAAATCAGTCCATCATCGTAAGTGGAGAGTCTGGGGCAGGAAAAACAGTCTCAGCTAAGTATGCCATGCGATACTTT
GCAACTGTGAGTGGTTCTGCCAGTGAGGCCAATGTGGAGGAAAAGGTCTTGGCCTCCAACCCCATCATGGAGTCCATTGGAAATGCTAAA
ACAACCAGGAATGATAATAGCAGCCGTTTTGGGAAGTATATTGAGATTGGTTTTGATAAGAGATATCGAATCATTGGTGCCAATATGAGA
ACTTATCTTTTAGAGAAATCCAGAGTGGTATTCCAGGCAGAAGAGGAGAGAAACTATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAG
TTACCTGAATTTAAAATGCTACGATTAGGAAATGCAGATAACTTTAATTACACAAAACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGAT
GATGCAAAGGAGATGGCACATACTAGGCAGGCCTGCACTTTGCTAGGAATTAGTGAATCTCATCAAATGGGAATTTTCCGAATACTTGCT
GGCATCCTTCACTTAGGCAATGTTGGATTTACATCCCGAGATGCAGACAGCTGCACAATACCTCCCAAGCATGAACCTCTCTGCATCTTC
TGTGAACTCATGGGTGTGGACTATGAGGAGATGTGTCACTGGCTCTGCCATCGGAAACTGGCTACTGCCACAGAGACATACATCAAGCCC
ATCTCCAAGCTGCAGGCCACAAATGCCCGCGATGCTTTGGCCAAGCACATCTATGCCAAGCTCTTTAACTGGATTGTAGATAATGTCAAT
CAGGCTCTCCATTCTGCTGTCAAACAGCACTCTTTTATTGGTGTGCTAGACATTTACGGTACTTACAACCTTTTATTCTGTGGTTCTTGT
GGGATTCCCGTTGGTTTCCATCTGTATTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTG
TGCTATCTCTTAAAAACAAAAGCCATAGTAAATGCATCAGAGATGGATATTCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAA
GAGAAGATAGTGCTAACGCACAATCGCTTAAAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGA

>In-frame_MYO5A_ENST00000399233_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_1620nt
ATGGCTGCGTCGGAGCTCTACACAAAGTTTGCCAGGGTTTGGATACCTGATCCAGAGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGAT
TATAAGCCAGGAGATAAAGTCCTCCTGCTTCACCTCGAGGAAGGAAAGGATTTGGAATACCATCTAGATCCAAAGACCAAGGAGCTGCCT
CACTTACGAAATCCTGACATACTTGTTGGTGAAAATGACCTCACAGCCCTCAGCTATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGA
GTCCGCTTTATTGATTCCAAACTTATTTATACGTATTGTGGTATAGTCCTAGTAGCTATAAATCCCTATGAACAGCTGCCTATTTATGGA
GAAGATATTATTAATGCATACAGTGGTCAGAACATGGGTGATATGGATCCACATATCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATG
GCCAGAGATGAACGAAATCAGTCCATCATCGTAAGTGGAGAGTCTGGGGCAGGAAAAACAGTCTCAGCTAAGTATGCCATGCGATACTTT
GCAACTGTGAGTGGTTCTGCCAGTGAGGCCAATGTGGAGGAAAAGGTCTTGGCCTCCAACCCCATCATGGAGTCCATTGGAAATGCTAAA
ACAACCAGGAATGATAATAGCAGCCGTTTTGGGAAGTATATTGAGATTGGTTTTGATAAGAGATATCGAATCATTGGTGCCAATATGAGA
ACTTATCTTTTAGAGAAATCCAGAGTGGTATTCCAGGCAGAAGAGGAGAGAAACTATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAG
TTACCTGAATTTAAAATGCTACGATTAGGAAATGCAGATAACTTTAATTACACAAAACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGAT
GATGCAAAGGAGATGGCACATACTAGGCAGGCCTGCACTTTGCTAGGAATTAGTGAATCTCATCAAATGGGAATTTTCCGAATACTTGCT
GGCATCCTTCACTTAGGCAATGTTGGATTTACATCCCGAGATGCAGACAGCTGCACAATACCTCCCAAGCATGAACCTCTCTGCATCTTC
TGTGAACTCATGGGTGTGGACTATGAGGAGATGTGTCACTGGCTCTGCCATCGGAAACTGGCTACTGCCACAGAGACATACATCAAGCCC
ATCTCCAAGCTGCAGGCCACAAATGCCCGCGATGCTTTGGCCAAGCACATCTATGCCAAGCTCTTTAACTGGATTGTAGATAATGTCAAT
CAGGCTCTCCATTCTGCTGTCAAACAGCACTCTTTTATTGGTGTGCTAGACATTTACGGTACTTACAACCTTTTATTCTGTGGTTCTTGT
GGGATTCCCGTTGGTTTCCATCTGTATTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTG
TGCTATCTCTTAAAAACAAAAGCCATAGTAAATGCATCAGAGATGGATATTCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAA
GAGAAGATAGTGCTAACGCACAATCGCTTAAAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGA

>In-frame_MYO5A_ENST00000553916_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_1620nt
ATGGCTGCGTCGGAGCTCTACACAAAGTTTGCCAGGGTTTGGATACCTGATCCAGAGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGAT
TATAAGCCAGGAGATAAAGTCCTCCTGCTTCACCTCGAGGAAGGAAAGGATTTGGAATACCATCTAGATCCAAAGACCAAGGAGCTGCCT
CACTTACGAAATCCTGACATACTTGTTGGTGAAAATGACCTCACAGCCCTCAGCTATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGA
GTCCGCTTTATTGATTCCAAACTTATTTATACGTATTGTGGTATAGTCCTAGTAGCTATAAATCCCTATGAACAGCTGCCTATTTATGGA
GAAGATATTATTAATGCATACAGTGGTCAGAACATGGGTGATATGGATCCACATATCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATG
GCCAGAGATGAACGAAATCAGTCCATCATCGTAAGTGGAGAGTCTGGGGCAGGAAAAACAGTCTCAGCTAAGTATGCCATGCGATACTTT
GCAACTGTGAGTGGTTCTGCCAGTGAGGCCAATGTGGAGGAAAAGGTCTTGGCCTCCAACCCCATCATGGAGTCCATTGGAAATGCTAAA
ACAACCAGGAATGATAATAGCAGCCGTTTTGGGAAGTATATTGAGATTGGTTTTGATAAGAGATATCGAATCATTGGTGCCAATATGAGA
ACTTATCTTTTAGAGAAATCCAGAGTGGTATTCCAGGCAGAAGAGGAGAGAAACTATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAG
TTACCTGAATTTAAAATGCTACGATTAGGAAATGCAGATAACTTTAATTACACAAAACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGAT
GATGCAAAGGAGATGGCACATACTAGGCAGGCCTGCACTTTGCTAGGAATTAGTGAATCTCATCAAATGGGAATTTTCCGAATACTTGCT
GGCATCCTTCACTTAGGCAATGTTGGATTTACATCCCGAGATGCAGACAGCTGCACAATACCTCCCAAGCATGAACCTCTCTGCATCTTC
TGTGAACTCATGGGTGTGGACTATGAGGAGATGTGTCACTGGCTCTGCCATCGGAAACTGGCTACTGCCACAGAGACATACATCAAGCCC
ATCTCCAAGCTGCAGGCCACAAATGCCCGCGATGCTTTGGCCAAGCACATCTATGCCAAGCTCTTTAACTGGATTGTAGATAATGTCAAT
CAGGCTCTCCATTCTGCTGTCAAACAGCACTCTTTTATTGGTGTGCTAGACATTTACGGTACTTACAACCTTTTATTCTGTGGTTCTTGT
GGGATTCCCGTTGGTTTCCATCTGTATTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTG
TGCTATCTCTTAAAAACAAAAGCCATAGTAAATGCATCAGAGATGGATATTCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAA
GAGAAGATAGTGCTAACGCACAATCGCTTAAAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MYO5A_ENST00000399231_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_2350nt
ACCCCGGGCAGGTGGAGCGCTCGCGGCTGCTCGCGGCGAGCCCGGGAGTGATGGCGAGGCCCCTGCGGGCGGCCAGCGCCTGAGGCGCCC
CGCCCCGCCCCGCCCCGCGCGGCCCTCCCCGCCCGGCCCTGCCCTGCCCTGCTCCCTGCCGGCGGCTGCGGGCGCTTCCTAGTCCGCTCG
GGCGGCCGCCCAGGCGAGGTGCGGCCTCCGCACAGGCGGGGGGCGTAGGCGCGCGGGGCCCGCCATGGCTGCGTCGGAGCTCTACACAAA
GTTTGCCAGGGTTTGGATACCTGATCCAGAGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGATTATAAGCCAGGAGATAAAGTCCTCCT
GCTTCACCTCGAGGAAGGAAAGGATTTGGAATACCATCTAGATCCAAAGACCAAGGAGCTGCCTCACTTACGAAATCCTGACATACTTGT
TGGTGAAAATGACCTCACAGCCCTCAGCTATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGAGTCCGCTTTATTGATTCCAAACTTAT
TTATACGTATTGTGGTATAGTCCTAGTAGCTATAAATCCCTATGAACAGCTGCCTATTTATGGAGAAGATATTATTAATGCATACAGTGG
TCAGAACATGGGTGATATGGATCCACATATCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATGGCCAGAGATGAACGAAATCAGTCCAT
CATCGTAAGTGGAGAGTCTGGGGCAGGAAAAACAGTCTCAGCTAAGTATGCCATGCGATACTTTGCAACTGTGAGTGGTTCTGCCAGTGA
GGCCAATGTGGAGGAAAAGGTCTTGGCCTCCAACCCCATCATGGAGTCCATTGGAAATGCTAAAACAACCAGGAATGATAATAGCAGCCG
TTTTGGGAAGTATATTGAGATTGGTTTTGATAAGAGATATCGAATCATTGGTGCCAATATGAGAACTTATCTTTTAGAGAAATCCAGAGT
GGTATTCCAGGCAGAAGAGGAGAGAAACTATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAGTTACCTGAATTTAAAATGCTACGATT
AGGAAATGCAGATAACTTTAATTACACAAAACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGATGATGCAAAGGAGATGGCACATACTAG
GCAGGCCTGCACTTTGCTAGGAATTAGTGAATCTCATCAAATGGGAATTTTCCGAATACTTGCTGGCATCCTTCACTTAGGCAATGTTGG
ATTTACATCCCGAGATGCAGACAGCTGCACAATACCTCCCAAGCATGAACCTCTCTGCATCTTCTGTGAACTCATGGGTGTGGACTATGA
GGAGATGTGTCACTGGCTCTGCCATCGGAAACTGGCTACTGCCACAGAGACATACATCAAGCCCATCTCCAAGCTGCAGGCCACAAATGC
CCGCGATGCTTTGGCCAAGCACATCTATGCCAAGCTCTTTAACTGGATTGTAGATAATGTCAATCAGGCTCTCCATTCTGCTGTCAAACA
GCACTCTTTTATTGGTGTGCTAGACATTTACGGTACTTACAACCTTTTATTCTGTGGTTCTTGTGGGATTCCCGTTGGTTTCCATCTGTA
TTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTGTGCTATCTCTTAAAAACAAAAGCCAT
AGTAAATGCATCAGAGATGGATATTCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAAGAGAAGATAGTGCTAACGCACAATCG
CTTAAAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGATCCTGTACCAAAGCTTGAGTGTCAGG
TTCAGGCTTTATTGCTGTCTTCAACAACAGGTGCTGCTTAGTCATTTCTTGAAAAAGATTGGCTTCAAGAATGGAGGGGAAATGCAGTTT
CTATTTACCTTTAGGCTGATTTTCCAAATTATTTGTGAAGCTGTTTTTAGAAGATGAGAGACTAAGGATTCTTCTCTTTTATAGCTATTT
GCCTTAAGAACTTACTTTAGATTCTTATTGAATTCATAATACTTATCTCTGAAAATGTCTTTGACTGTAAATTTAGGAATTAAGATGCAG
AGTCCCATGTGTCCTCTGATCTAAAGTTGCATGGTTGGTCTGAAAATAGAGTTGGGCTTAATGTTGACTTCTATTACTCCTGCATGGAGC
AGTTGTTATGAATACTAATACATCACTTTTTAACTTCTGTAAAATACAGATCATAATATTCTATAGGTAATGTTTAATAAATTGCCTGAA

>In-frame_MYO5A_ENST00000356338_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_2180nt
AGTCCGCTCGGGCGGCCGCCCAGGCGAGGTGCGGCCTCCGCACAGGCGGGGGGCGTAGGCGCGCGGGGCCCGCCATGGCTGCGTCGGAGC
TCTACACAAAGTTTGCCAGGGTTTGGATACCTGATCCAGAGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGATTATAAGCCAGGAGATA
AAGTCCTCCTGCTTCACCTCGAGGAAGGAAAGGATTTGGAATACCATCTAGATCCAAAGACCAAGGAGCTGCCTCACTTACGAAATCCTG
ACATACTTGTTGGTGAAAATGACCTCACAGCCCTCAGCTATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGAGTCCGCTTTATTGATT
CCAAACTTATTTATACGTATTGTGGTATAGTCCTAGTAGCTATAAATCCCTATGAACAGCTGCCTATTTATGGAGAAGATATTATTAATG
CATACAGTGGTCAGAACATGGGTGATATGGATCCACATATCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATGGCCAGAGATGAACGAA
ATCAGTCCATCATCGTAAGTGGAGAGTCTGGGGCAGGAAAAACAGTCTCAGCTAAGTATGCCATGCGATACTTTGCAACTGTGAGTGGTT
CTGCCAGTGAGGCCAATGTGGAGGAAAAGGTCTTGGCCTCCAACCCCATCATGGAGTCCATTGGAAATGCTAAAACAACCAGGAATGATA
ATAGCAGCCGTTTTGGGAAGTATATTGAGATTGGTTTTGATAAGAGATATCGAATCATTGGTGCCAATATGAGAACTTATCTTTTAGAGA
AATCCAGAGTGGTATTCCAGGCAGAAGAGGAGAGAAACTATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAGTTACCTGAATTTAAAA
TGCTACGATTAGGAAATGCAGATAACTTTAATTACACAAAACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGATGATGCAAAGGAGATGG
CACATACTAGGCAGGCCTGCACTTTGCTAGGAATTAGTGAATCTCATCAAATGGGAATTTTCCGAATACTTGCTGGCATCCTTCACTTAG
GCAATGTTGGATTTACATCCCGAGATGCAGACAGCTGCACAATACCTCCCAAGCATGAACCTCTCTGCATCTTCTGTGAACTCATGGGTG
TGGACTATGAGGAGATGTGTCACTGGCTCTGCCATCGGAAACTGGCTACTGCCACAGAGACATACATCAAGCCCATCTCCAAGCTGCAGG
CCACAAATGCCCGCGATGCTTTGGCCAAGCACATCTATGCCAAGCTCTTTAACTGGATTGTAGATAATGTCAATCAGGCTCTCCATTCTG
CTGTCAAACAGCACTCTTTTATTGGTGTGCTAGACATTTACGGTACTTACAACCTTTTATTCTGTGGTTCTTGTGGGATTCCCGTTGGTT
TCCATCTGTATTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTGTGCTATCTCTTAAAAA
CAAAAGCCATAGTAAATGCATCAGAGATGGATATTCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAAGAGAAGATAGTGCTAA
CGCACAATCGCTTAAAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGATCCTGTACCAAAGCTT
GAGTGTCAGGTTCAGGCTTTATTGCTGTCTTCAACAACAGGTGCTGCTTAGTCATTTCTTGAAAAAGATTGGCTTCAAGAATGGAGGGGA
AATGCAGTTTCTATTTACCTTTAGGCTGATTTTCCAAATTATTTGTGAAGCTGTTTTTAGAAGATGAGAGACTAAGGATTCTTCTCTTTT
ATAGCTATTTGCCTTAAGAACTTACTTTAGATTCTTATTGAATTCATAATACTTATCTCTGAAAATGTCTTTGACTGTAAATTTAGGAAT
TAAGATGCAGAGTCCCATGTGTCCTCTGATCTAAAGTTGCATGGTTGGTCTGAAAATAGAGTTGGGCTTAATGTTGACTTCTATTACTCC
TGCATGGAGCAGTTGTTATGAATACTAATACATCACTTTTTAACTTCTGTAAAATACAGATCATAATATTCTATAGGTAATGTTTAATAA

>In-frame_MYO5A_ENST00000358212_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_2106nt
ATGAAATCTAGTAGTTTGGAAACTATGTTTGCCAGGGTTTGGATACCTGATCCAGAGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGAT
TATAAGCCAGGAGATAAAGTCCTCCTGCTTCACCTCGAGGAAGGAAAGGATTTGGAATACCATCTAGATCCAAAGACCAAGGAGCTGCCT
CACTTACGAAATCCTGACATACTTGTTGGTGAAAATGACCTCACAGCCCTCAGCTATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGA
GTCCGCTTTATTGATTCCAAACTTATTTATACGTATTGTGGTATAGTCCTAGTAGCTATAAATCCCTATGAACAGCTGCCTATTTATGGA
GAAGATATTATTAATGCATACAGTGGTCAGAACATGGGTGATATGGATCCACATATCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATG
GCCAGAGATGAACGAAATCAGTCCATCATCGTAAGTGGAGAGTCTGGGGCAGGAAAAACAGTCTCAGCTAAGTATGCCATGCGATACTTT
GCAACTGTGAGTGGTTCTGCCAGTGAGGCCAATGTGGAGGAAAAGGTCTTGGCCTCCAACCCCATCATGGAGTCCATTGGAAATGCTAAA
ACAACCAGGAATGATAATAGCAGCCGTTTTGGGAAGTATATTGAGATTGGTTTTGATAAGAGATATCGAATCATTGGTGCCAATATGAGA
ACTTATCTTTTAGAGAAATCCAGAGTGGTATTCCAGGCAGAAGAGGAGAGAAACTATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAG
TTACCTGAATTTAAAATGCTACGATTAGGAAATGCAGATAACTTTAATTACACAAAACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGAT
GATGCAAAGGAGATGGCACATACTAGGCAGGCCTGCACTTTGCTAGGAATTAGTGAATCTCATCAAATGGGAATTTTCCGAATACTTGCT
GGCATCCTTCACTTAGGCAATGTTGGATTTACATCCCGAGATGCAGACAGCTGCACAATACCTCCCAAGCATGAACCTCTCTGCATCTTC
TGTGAACTCATGGGTGTGGACTATGAGGAGATGTGTCACTGGCTCTGCCATCGGAAACTGGCTACTGCCACAGAGACATACATCAAGCCC
ATCTCCAAGCTGCAGGCCACAAATGCCCGCGATGCTTTGGCCAAGCACATCTATGCCAAGCTCTTTAACTGGATTGTAGATAATGTCAAT
CAGGCTCTCCATTCTGCTGTCAAACAGCACTCTTTTATTGGTGTGCTAGACATTTACGGTACTTACAACCTTTTATTCTGTGGTTCTTGT
GGGATTCCCGTTGGTTTCCATCTGTATTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTG
TGCTATCTCTTAAAAACAAAAGCCATAGTAAATGCATCAGAGATGGATATTCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAA
GAGAAGATAGTGCTAACGCACAATCGCTTAAAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGA
TCCTGTACCAAAGCTTGAGTGTCAGGTTCAGGCTTTATTGCTGTCTTCAACAACAGGTGCTGCTTAGTCATTTCTTGAAAAAGATTGGCT
TCAAGAATGGAGGGGAAATGCAGTTTCTATTTACCTTTAGGCTGATTTTCCAAATTATTTGTGAAGCTGTTTTTAGAAGATGAGAGACTA
AGGATTCTTCTCTTTTATAGCTATTTGCCTTAAGAACTTACTTTAGATTCTTATTGAATTCATAATACTTATCTCTGAAAATGTCTTTGA
CTGTAAATTTAGGAATTAAGATGCAGAGTCCCATGTGTCCTCTGATCTAAAGTTGCATGGTTGGTCTGAAAATAGAGTTGGGCTTAATGT
TGACTTCTATTACTCCTGCATGGAGCAGTTGTTATGAATACTAATACATCACTTTTTAACTTCTGTAAAATACAGATCATAATATTCTAT

>In-frame_MYO5A_ENST00000399233_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_2350nt
ACCCCGGGCAGGTGGAGCGCTCGCGGCTGCTCGCGGCGAGCCCGGGAGTGATGGCGAGGCCCCTGCGGGCGGCCAGCGCCTGAGGCGCCC
CGCCCCGCCCCGCCCCGCGCGGCCCTCCCCGCCCGGCCCTGCCCTGCCCTGCTCCCTGCCGGCGGCTGCGGGCGCTTCCTAGTCCGCTCG
GGCGGCCGCCCAGGCGAGGTGCGGCCTCCGCACAGGCGGGGGGCGTAGGCGCGCGGGGCCCGCCATGGCTGCGTCGGAGCTCTACACAAA
GTTTGCCAGGGTTTGGATACCTGATCCAGAGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGATTATAAGCCAGGAGATAAAGTCCTCCT
GCTTCACCTCGAGGAAGGAAAGGATTTGGAATACCATCTAGATCCAAAGACCAAGGAGCTGCCTCACTTACGAAATCCTGACATACTTGT
TGGTGAAAATGACCTCACAGCCCTCAGCTATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGAGTCCGCTTTATTGATTCCAAACTTAT
TTATACGTATTGTGGTATAGTCCTAGTAGCTATAAATCCCTATGAACAGCTGCCTATTTATGGAGAAGATATTATTAATGCATACAGTGG
TCAGAACATGGGTGATATGGATCCACATATCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATGGCCAGAGATGAACGAAATCAGTCCAT
CATCGTAAGTGGAGAGTCTGGGGCAGGAAAAACAGTCTCAGCTAAGTATGCCATGCGATACTTTGCAACTGTGAGTGGTTCTGCCAGTGA
GGCCAATGTGGAGGAAAAGGTCTTGGCCTCCAACCCCATCATGGAGTCCATTGGAAATGCTAAAACAACCAGGAATGATAATAGCAGCCG
TTTTGGGAAGTATATTGAGATTGGTTTTGATAAGAGATATCGAATCATTGGTGCCAATATGAGAACTTATCTTTTAGAGAAATCCAGAGT
GGTATTCCAGGCAGAAGAGGAGAGAAACTATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAGTTACCTGAATTTAAAATGCTACGATT
AGGAAATGCAGATAACTTTAATTACACAAAACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGATGATGCAAAGGAGATGGCACATACTAG
GCAGGCCTGCACTTTGCTAGGAATTAGTGAATCTCATCAAATGGGAATTTTCCGAATACTTGCTGGCATCCTTCACTTAGGCAATGTTGG
ATTTACATCCCGAGATGCAGACAGCTGCACAATACCTCCCAAGCATGAACCTCTCTGCATCTTCTGTGAACTCATGGGTGTGGACTATGA
GGAGATGTGTCACTGGCTCTGCCATCGGAAACTGGCTACTGCCACAGAGACATACATCAAGCCCATCTCCAAGCTGCAGGCCACAAATGC
CCGCGATGCTTTGGCCAAGCACATCTATGCCAAGCTCTTTAACTGGATTGTAGATAATGTCAATCAGGCTCTCCATTCTGCTGTCAAACA
GCACTCTTTTATTGGTGTGCTAGACATTTACGGTACTTACAACCTTTTATTCTGTGGTTCTTGTGGGATTCCCGTTGGTTTCCATCTGTA
TTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTGTGCTATCTCTTAAAAACAAAAGCCAT
AGTAAATGCATCAGAGATGGATATTCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAAGAGAAGATAGTGCTAACGCACAATCG
CTTAAAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGATCCTGTACCAAAGCTTGAGTGTCAGG
TTCAGGCTTTATTGCTGTCTTCAACAACAGGTGCTGCTTAGTCATTTCTTGAAAAAGATTGGCTTCAAGAATGGAGGGGAAATGCAGTTT
CTATTTACCTTTAGGCTGATTTTCCAAATTATTTGTGAAGCTGTTTTTAGAAGATGAGAGACTAAGGATTCTTCTCTTTTATAGCTATTT
GCCTTAAGAACTTACTTTAGATTCTTATTGAATTCATAATACTTATCTCTGAAAATGTCTTTGACTGTAAATTTAGGAATTAAGATGCAG
AGTCCCATGTGTCCTCTGATCTAAAGTTGCATGGTTGGTCTGAAAATAGAGTTGGGCTTAATGTTGACTTCTATTACTCCTGCATGGAGC
AGTTGTTATGAATACTAATACATCACTTTTTAACTTCTGTAAAATACAGATCATAATATTCTATAGGTAATGTTTAATAAATTGCCTGAA

>In-frame_MYO5A_ENST00000553916_chr15_52689398_-_OIP5_ENST00000220514_chr15_41611978_-_2141nt
GCACAGGCGGGGGGCGTAGGCGCGCGGGGCCCGCCATGGCTGCGTCGGAGCTCTACACAAAGTTTGCCAGGGTTTGGATACCTGATCCAG
AGGAAGTCTGGAAGTCAGCAGAGCTGCTCAAAGATTATAAGCCAGGAGATAAAGTCCTCCTGCTTCACCTCGAGGAAGGAAAGGATTTGG
AATACCATCTAGATCCAAAGACCAAGGAGCTGCCTCACTTACGAAATCCTGACATACTTGTTGGTGAAAATGACCTCACAGCCCTCAGCT
ATCTTCATGAGCCTGCTGTGCTCCATAATCTCAGAGTCCGCTTTATTGATTCCAAACTTATTTATACGTATTGTGGTATAGTCCTAGTAG
CTATAAATCCCTATGAACAGCTGCCTATTTATGGAGAAGATATTATTAATGCATACAGTGGTCAGAACATGGGTGATATGGATCCACATA
TCTTTGCAGTAGCTGAAGAAGCTTACAAGCAAATGGCCAGAGATGAACGAAATCAGTCCATCATCGTAAGTGGAGAGTCTGGGGCAGGAA
AAACAGTCTCAGCTAAGTATGCCATGCGATACTTTGCAACTGTGAGTGGTTCTGCCAGTGAGGCCAATGTGGAGGAAAAGGTCTTGGCCT
CCAACCCCATCATGGAGTCCATTGGAAATGCTAAAACAACCAGGAATGATAATAGCAGCCGTTTTGGGAAGTATATTGAGATTGGTTTTG
ATAAGAGATATCGAATCATTGGTGCCAATATGAGAACTTATCTTTTAGAGAAATCCAGAGTGGTATTCCAGGCAGAAGAGGAGAGAAACT
ATCATATCTTCTATCAGCTTTGTGCCTCAGCAAAGTTACCTGAATTTAAAATGCTACGATTAGGAAATGCAGATAACTTTAATTACACAA
AACAAGGAGGCAGTCCTGTGATTGAAGGAGTGGATGATGCAAAGGAGATGGCACATACTAGGCAGGCCTGCACTTTGCTAGGAATTAGTG
AATCTCATCAAATGGGAATTTTCCGAATACTTGCTGGCATCCTTCACTTAGGCAATGTTGGATTTACATCCCGAGATGCAGACAGCTGCA
CAATACCTCCCAAGCATGAACCTCTCTGCATCTTCTGTGAACTCATGGGTGTGGACTATGAGGAGATGTGTCACTGGCTCTGCCATCGGA
AACTGGCTACTGCCACAGAGACATACATCAAGCCCATCTCCAAGCTGCAGGCCACAAATGCCCGCGATGCTTTGGCCAAGCACATCTATG
CCAAGCTCTTTAACTGGATTGTAGATAATGTCAATCAGGCTCTCCATTCTGCTGTCAAACAGCACTCTTTTATTGGTGTGCTAGACATTT
ACGGTACTTACAACCTTTTATTCTGTGGTTCTTGTGGGATTCCCGTTGGTTTCCATCTGTATTCTACCCATGCTGCCCTGGCTGCCTTGA
GAGGTCACTTCTGCCTTTCCAGTGACAAAATGGTGTGCTATCTCTTAAAAACAAAAGCCATAGTAAATGCATCAGAGATGGATATTCAAA
ATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAAGAGAAGATAGTGCTAACGCACAATCGCTTAAAATCACTAATGAAGATTCTGAGTG
AAGTGACTCCTGACCAGTCCAAGCCAGAAAACTGATCCTGTACCAAAGCTTGAGTGTCAGGTTCAGGCTTTATTGCTGTCTTCAACAACA
GGTGCTGCTTAGTCATTTCTTGAAAAAGATTGGCTTCAAGAATGGAGGGGAAATGCAGTTTCTATTTACCTTTAGGCTGATTTTCCAAAT
TATTTGTGAAGCTGTTTTTAGAAGATGAGAGACTAAGGATTCTTCTCTTTTATAGCTATTTGCCTTAAGAACTTACTTTAGATTCTTATT
GAATTCATAATACTTATCTCTGAAAATGTCTTTGACTGTAAATTTAGGAATTAAGATGCAGAGTCCCATGTGTCCTCTGATCTAAAGTTG
CATGGTTGGTCTGAAAATAGAGTTGGGCTTAATGTTGACTTCTATTACTCCTGCATGGAGCAGTTGTTATGAATACTAATACATCACTTT


Top

FusionGenePPI for MYO5A_OIP5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MYO5AMLPH, DYNLL2, DLGAP1, DYNLL1, SHANK2, RAB27A, BMF, EXOC3, EXOC4, EXOC6, SIRT7, FBXO25, HGS, TRIM3, GRIA2, GRIA1, PAN2, CCDC8, PEX19, CREB3, SCP2, DTNBP1, MYH11, CAPZA2, MYO1E, PLS3, NTRK1, CDK2, DBN1, FLNA, MYH9, MYO1C, PPP1CB, IQGAP1, PDLIM7, SYNPO, LIMA1, ANLN, MYO5C, MYO19, MYO18A, FBXW7, SSH1, DKK3, CDH5, TMOD4, UBE2O, TMOD3, EID1, FEZ1, OS9, PPP6R2, MYL2, LRRIQ1, AVIL, FAM160B2, IL20RA, TRIM25OIP5RAF1, TMPO, ABL2, PEX19, CASP10, FOXJ1, RARG, TSSK3, KDM1A, CUL1, CUL3, CUL4B, BTRC, KRT15, SKIL, TPM3, TRIP6, NUP62, TFIP11, MIS18A, EIF4ENIF1, GCC1, C1orf94, CEP170P1, CEP170, UBE2T, RNF40, QKI, TRAF7, SNAP47, PDZRN3, CYTH3, MED29, STX1A, MIS18BP1, CUEDC1, C9orf16, KRAS, EZH2, GTF2E2, TACC3, CENPA, NCAPH2, CAV3, NOS1AP, PKN3, NCKAP5L, TFPT, CCHCR1, YEATS4, TUFT1, RABGAP1L, GOLGA5, CLOCK, PSMD9, VPS53, DZIP3, GRIPAP1, RCOR1, HMG20A, CCDC132, CCDC93, PHF21A, PTRF, PHLDB3, HAUS6, RPRD1A, ARNTL, MAX, GIT2, RABGEF1, NUF2, THAP11, VPS51, TSSC1, JUN, OIP5, HJURP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MYO5A_OIP5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MYO5A_OIP5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMYO5AC0023893Liver Cirrhosis, Experimental1CTD_human
HgeneMYO5AC0031117Peripheral Neuropathy1CTD_human