FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23071

FusionGeneSummary for MYLK_USP48

check button Fusion gene summary
Fusion gene informationFusion gene name: MYLK_USP48
Fusion gene ID: 23071
HgeneTgene
Gene symbol

MYLK

USP48

Gene ID

4638

84196

Gene namemyosin light chain kinaseubiquitin specific peptidase 48
SynonymsAAT7|KRP|MLCK|MLCK1|MLCK108|MLCK210|MSTP083|MYLK1|smMLCKRAP1GA1|USP31
Cytomap

3q21.1

1p36.12

Type of geneprotein-codingprotein-coding
Descriptionmyosin light chain kinase, smooth musclekinase-related proteinmyosin, light polypeptide kinasesmooth muscle myosin light chain kinasetelokinubiquitin carboxyl-terminal hydrolase 48deubiquitinating enzyme 48ubiquitin specific protease 31ubiquitin thioesterase 48ubiquitin thiolesterase 48ubiquitin-specific-processing protease 48
Modification date2018052320180522
UniProtAcc

Q15746

Q86UV5

Ensembl transtripts involved in fusion geneENST00000360772, ENST00000359169, 
ENST00000360304, ENST00000418370, 
ENST00000578202, ENST00000354792, 
ENST00000346322, ENST00000583087, 
ENST00000475616, ENST00000510775, 
ENST00000400301, ENST00000308271, 
ENST00000374732, ENST00000529637, 
ENST00000479177, ENST00000421625, 
Fusion gene scores* DoF score10 X 8 X 5=4007 X 8 X 6=336
# samples 118
** MAII scorelog2(11/400*10)=-1.86249647625006
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/336*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MYLK [Title/Abstract] AND USP48 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMYLK

GO:0030335

positive regulation of cell migration

19826488

HgeneMYLK

GO:0051928

positive regulation of calcium ion transport

16284075

HgeneMYLK

GO:0071476

cellular hypotonic response

11976941

HgeneMYLK

GO:0090303

positive regulation of wound healing

15825080


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-WP-A9GB-01AMYLKchr3

123512524

-USP48chr1

22016592

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000360772ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
In-frameENST00000360772ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
In-frameENST00000360772ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
In-frameENST00000360772ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000360772ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000360772ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000359169ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000359169ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000359169ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000359169ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000359169ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000359169ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000360304ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000360304ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000360304ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000360304ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000360304ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000360304ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000418370ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000418370ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000418370ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000418370ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000418370ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000418370ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000578202ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000578202ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000578202ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000578202ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000578202ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000578202ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000354792ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000354792ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000354792ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000354792ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000354792ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000354792ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000346322ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000346322ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000346322ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
Frame-shitENST00000346322ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000346322ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000346322ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000583087ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000583087ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000583087ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000583087ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000583087ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000583087ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-
In-frameENST00000475616ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
In-frameENST00000475616ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
In-frameENST00000475616ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
In-frameENST00000475616ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000475616ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
5CDS-intronENST00000475616ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000510775ENST00000400301MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000510775ENST00000308271MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000510775ENST00000374732MYLKchr3

123512524

-USP48chr1

22016592

-
intron-3CDSENST00000510775ENST00000529637MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000510775ENST00000479177MYLKchr3

123512524

-USP48chr1

22016592

-
intron-intronENST00000510775ENST00000421625MYLKchr3

123512524

-USP48chr1

22016592

-

Top

FusionProtFeatures for MYLK_USP48


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MYLK

Q15746

USP48

Q86UV5


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneUSP48chr3:123512524chr1:22016592ENST00000400301-2126929_1009909984DomainUbiquitin-like
TgeneUSP48chr3:123512524chr1:22016592ENST00000421625-011460_554-217486DomainDUSP 1
TgeneUSP48chr3:123512524chr1:22016592ENST00000421625-011569_691-217486DomainDUSP 2
TgeneUSP48chr3:123512524chr1:22016592ENST00000421625-011711_824-217486DomainDUSP 3
TgeneUSP48chr3:123512524chr1:22016592ENST00000421625-01189_421-217486DomainNote=USP
TgeneUSP48chr3:123512524chr1:22016592ENST00000421625-011929_1009-217486DomainUbiquitin-like

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331906_1914551846Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331906_1914551864Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341906_1914551915Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341906_1914551864Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131906_1914-1674155Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311906_1914551915Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141906_1914-58155Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331098_1186551846DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331238_1326551846DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331334_1426551846DomainFibronectin type-III
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331464_1719551846DomainProtein kinase
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433161_249551846DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331809_1898551846DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-43333_122551846DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433414_503551846DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433514_599551846DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433620_711551846DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433721_821551846DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331098_1186551864DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331238_1326551864DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331334_1426551864DomainFibronectin type-III
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331464_1719551864DomainProtein kinase
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433161_249551864DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331809_1898551864DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-43333_122551864DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433414_503551864DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433514_599551864DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433620_711551864DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433721_821551864DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341098_1186551915DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341238_1326551915DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341334_1426551915DomainFibronectin type-III
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341464_1719551915DomainProtein kinase
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434161_249551915DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341809_1898551915DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-43433_122551915DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434414_503551915DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434514_599551915DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434620_711551915DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434721_821551915DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341098_1186551864DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341238_1326551864DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341334_1426551864DomainFibronectin type-III
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341464_1719551864DomainProtein kinase
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534161_249551864DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341809_1898551864DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-53433_122551864DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534414_503551864DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534514_599551864DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534620_711551864DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534721_821551864DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131098_1186-1674155DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131238_1326-1674155DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131334_1426-1674155DomainFibronectin type-III
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131464_1719-1674155DomainProtein kinase
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13161_249-1674155DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131809_1898-1674155DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-1333_122-1674155DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13414_503-1674155DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13514_599-1674155DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13620_711-1674155DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13721_821-1674155DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311098_1186551915DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311238_1326551915DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311334_1426551915DomainFibronectin type-III
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311464_1719551915DomainProtein kinase
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131161_249551915DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311809_1898551915DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-13133_122551915DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131414_503551915DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131514_599551915DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131620_711551915DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131721_821551915DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141098_1186-58155DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141238_1326-58155DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141334_1426-58155DomainFibronectin type-III
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141464_1719-58155DomainProtein kinase
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14161_249-58155DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141809_1898-58155DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-1433_122-58155DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14414_503-58155DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14514_599-58155DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14620_711-58155DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14721_821-58155DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331470_1478551846Nucleotide bindingATP
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331470_1478551864Nucleotide bindingATP
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341470_1478551915Nucleotide bindingATP
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341470_1478551864Nucleotide bindingATP
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131470_1478-1674155Nucleotide bindingATP
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311470_1478551915Nucleotide bindingATP
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141470_1478-58155Nucleotide bindingATP
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331061_1460551846RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331711_1774551846RegionNote=Calmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433868_998551846RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433923_963551846RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433948_963551846RegionCalmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433999_1063551846RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331061_1460551864RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331711_1774551864RegionNote=Calmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433868_998551864RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433923_963551864RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433948_963551864RegionCalmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433999_1063551864RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341061_1460551915RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341711_1774551915RegionNote=Calmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434868_998551915RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434923_963551915RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434948_963551915RegionCalmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434999_1063551915RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341061_1460551864RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341711_1774551864RegionNote=Calmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534868_998551864RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534923_963551864RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534948_963551864RegionCalmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534999_1063551864RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131061_1460-1674155RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131711_1774-1674155RegionNote=Calmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13868_998-1674155RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13923_963-1674155RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13948_963-1674155RegionCalmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13999_1063-1674155RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311061_1460551915RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311711_1774551915RegionNote=Calmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131868_998551915RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131923_963551915RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131948_963551915RegionCalmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131999_1063551915RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141061_1460-58155RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141711_1774-58155RegionNote=Calmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14868_998-58155RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14923_963-58155RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14948_963-58155RegionCalmodulin-binding
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14999_1063-58155RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331004_1015551846RepeatNote=2-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331016_1027551846RepeatNote=2-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331028_1039551846RepeatNote=2-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331040_1051551846RepeatNote=2-5
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-4331052_1063551846RepeatNote=2-6
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433868_895551846RepeatNote=1-1
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433896_923551846RepeatNote=1-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433924_951551846RepeatNote=1-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433952_979551846RepeatNote=1-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433980_998551846RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000346322-433999_1003551846RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331004_1015551864RepeatNote=2-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331016_1027551864RepeatNote=2-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331028_1039551864RepeatNote=2-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331040_1051551864RepeatNote=2-5
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-4331052_1063551864RepeatNote=2-6
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433868_895551864RepeatNote=1-1
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433896_923551864RepeatNote=1-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433924_951551864RepeatNote=1-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433952_979551864RepeatNote=1-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433980_998551864RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000359169-433999_1003551864RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341004_1015551915RepeatNote=2-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341016_1027551915RepeatNote=2-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341028_1039551915RepeatNote=2-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341040_1051551915RepeatNote=2-5
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-4341052_1063551915RepeatNote=2-6
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434868_895551915RepeatNote=1-1
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434896_923551915RepeatNote=1-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434924_951551915RepeatNote=1-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434952_979551915RepeatNote=1-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434980_998551915RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000360304-434999_1003551915RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341004_1015551864RepeatNote=2-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341016_1027551864RepeatNote=2-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341028_1039551864RepeatNote=2-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341040_1051551864RepeatNote=2-5
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-5341052_1063551864RepeatNote=2-6
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534868_895551864RepeatNote=1-1
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534896_923551864RepeatNote=1-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534924_951551864RepeatNote=1-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534952_979551864RepeatNote=1-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534980_998551864RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000360772-534999_1003551864RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131004_1015-1674155RepeatNote=2-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131016_1027-1674155RepeatNote=2-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131028_1039-1674155RepeatNote=2-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131040_1051-1674155RepeatNote=2-5
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-131052_1063-1674155RepeatNote=2-6
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13868_895-1674155RepeatNote=1-1
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13896_923-1674155RepeatNote=1-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13924_951-1674155RepeatNote=1-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13952_979-1674155RepeatNote=1-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13980_998-1674155RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000418370-13999_1003-1674155RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311004_1015551915RepeatNote=2-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311016_1027551915RepeatNote=2-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311028_1039551915RepeatNote=2-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311040_1051551915RepeatNote=2-5
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-1311052_1063551915RepeatNote=2-6
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131868_895551915RepeatNote=1-1
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131896_923551915RepeatNote=1-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131924_951551915RepeatNote=1-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131952_979551915RepeatNote=1-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131980_998551915RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000475616-131999_1003551915RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141004_1015-58155RepeatNote=2-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141016_1027-58155RepeatNote=2-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141028_1039-58155RepeatNote=2-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141040_1051-58155RepeatNote=2-5
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-141052_1063-58155RepeatNote=2-6
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14868_895-58155RepeatNote=1-1
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14896_923-58155RepeatNote=1-2
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14924_951-58155RepeatNote=1-3
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14952_979-58155RepeatNote=1-4
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14980_998-58155RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123512524chr1:22016592ENST00000583087-14999_1003-58155RepeatNote=2-1%3B truncated
TgeneUSP48chr3:123512524chr1:22016592ENST00000308271-2227460_5549611036DomainDUSP 1
TgeneUSP48chr3:123512524chr1:22016592ENST00000308271-2227569_6919611036DomainDUSP 2
TgeneUSP48chr3:123512524chr1:22016592ENST00000308271-2227711_8249611036DomainDUSP 3
TgeneUSP48chr3:123512524chr1:22016592ENST00000308271-222789_4219611036DomainNote=USP
TgeneUSP48chr3:123512524chr1:22016592ENST00000308271-2227929_10099611036DomainUbiquitin-like
TgeneUSP48chr3:123512524chr1:22016592ENST00000400301-2126460_554909984DomainDUSP 1
TgeneUSP48chr3:123512524chr1:22016592ENST00000400301-2126569_691909984DomainDUSP 2
TgeneUSP48chr3:123512524chr1:22016592ENST00000400301-2126711_824909984DomainDUSP 3
TgeneUSP48chr3:123512524chr1:22016592ENST00000400301-212689_421909984DomainNote=USP


Top

FusionGeneSequence for MYLK_USP48


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000400301_chr1_22016592_-_130aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIP

>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000308271_chr1_22016592_-_130aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIP

>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000374732_chr1_22016592_-_130aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIP

>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000529637_chr1_22016592_-_130aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIP

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000400301_chr1_22016592_-_130aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIP

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000308271_chr1_22016592_-_130aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIP

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000374732_chr1_22016592_-_130aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIP

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000529637_chr1_22016592_-_130aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000400301_chr1_22016592_-_390nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG

>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000308271_chr1_22016592_-_390nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG

>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000374732_chr1_22016592_-_390nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG

>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000529637_chr1_22016592_-_390nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000400301_chr1_22016592_-_390nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000308271_chr1_22016592_-_390nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000374732_chr1_22016592_-_390nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000529637_chr1_22016592_-_390nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000400301_chr1_22016592_-_1888nt
GGCTCCCCGCGCCGCCCGGTCGGCAGCAGGGCGCTGAGCGAGCTCGGAGCCCGCGCTGTGCGCCTGCGGCCGGGGCGCCCCGCCGAGCGC
CGGTGCCCCGGCTCCCGGGCCGCCTTCGCCGCGCGGGAAGGATTCTTCAAAATTAACAGAAACCAATTCGGGCCAGCTGAAGAGAAAAAA
TAAAGCATTTCTTCCTTCTGATGGGGCAAGACTCTCTCTGGAATGGGGCTCTTATGACCTACAGTCAAACAAGGTGGCTCCCGGCTGCCT
CTGCTGCAGTTCAGAGCAACTTCAGGAGCTTCCCAGCCGAGAGCTTCAGGACGCCTTTCCTGTCCCACTGGCCCAGTTGCCACAACAAAC
AACAGAGAAGACGGTGACCATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGT
TGACTCCATGCCCCTGACAGAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGG
GCGGATCATGCATGCATTTTCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGG
CACCCTTGGCGTCATTCCTGAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGT
TTGTATGCCAGAAGAAGGGTTTAAAGGTACTGGTCTTCTTGGACATTAATCTTTGAATACTTGCTGACTGCTAAGAAATGACCAGAGGGG
AAGAGGAGTTTGACATGTTAGGGCATTAAAGCAAAGGTGGATTTAAGAATTAAACCATTACATGCCCCTTCCAAAAGGCAGAAATCCATT
CAAACGTGACTGTCCCAAATGCCTTATGTCAAATAAAGCAGATTGCACTGATGGACATCAGACTTGAAGGAAATGTTTCCAATTTTATAT
TTAAGGGGGGTGGTGGGTGGGAGGGGGCAAGTAAAGACGGAACAAGTTTAGTAGCAGTAATAGTAAATCATGTTTACATATGAGATTTAT
AGTCGTGGGAGGGGAATAAAGTTCTGTTATATTTCCTTGCTCGAGTTTCATACCAGATGCGTTGGTCCATAAAGGATTGTATCAAGTAGA
TGGGACAACATTCTGCTCTGAACGAAAAGTAATTTTAGAGACATAACCTGCTTACCAATGCCTGTCTTTGATTCATATTCTACTTTCAAT
AAAGCATGAAAGTGAAGAACTTGTCCTAAGTGTGGAAAAGTGTCTTCAGATTTAGACTCTTCTCCATGTCAGCTGCAGCGCCACCCGCCT
TACACCTGCCCGGCCGTCTGTCTCTTGGTATTGGGTAAAGGAGGGGGCACCTGCATGTCTCCTGCAATGAGCAAGGAATTATGTCTCATG
TTTTGACTTCAGAGGCTTTTTGCTTTGGTGCATTTCAGAAAGGATGGAGAACATTTATTATGTGTGAAAGCATCCTCTTCCGGTTTTGCT
GTTATTCAAAAGTGGGAAATGTACCTGGCACGTTTGAAAATAAAAAATCTGACTACCTATCAGAAGAGTAAATCAGACTGAAGTACATTT
GGATAACACAAGGTTTCTATAAAATTTGTTCTTCCTGTCCTCCATGTCACTGTTTCTTGGACCTCAGTTCTCTTTTTGAAAGCATTATTC
CAAAATGCCCTGAGAGGGTCTCTTAGATCATTGTTTAAAAAAGGAAAAAAGTATATGGATGTGCTGTCCATCCAACTCAGGATTATCATT

>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000308271_chr1_22016592_-_1607nt
GGCTCCCCGCGCCGCCCGGTCGGCAGCAGGGCGCTGAGCGAGCTCGGAGCCCGCGCTGTGCGCCTGCGGCCGGGGCGCCCCGCCGAGCGC
CGGTGCCCCGGCTCCCGGGCCGCCTTCGCCGCGCGGGAAGGATTCTTCAAAATTAACAGAAACCAATTCGGGCCAGCTGAAGAGAAAAAA
TAAAGCATTTCTTCCTTCTGATGGGGCAAGACTCTCTCTGGAATGGGGCTCTTATGACCTACAGTCAAACAAGGTGGCTCCCGGCTGCCT
CTGCTGCAGTTCAGAGCAACTTCAGGAGCTTCCCAGCCGAGAGCTTCAGGACGCCTTTCCTGTCCCACTGGCCCAGTTGCCACAACAAAC
AACAGAGAAGACGGTGACCATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGT
TGACTCCATGCCCCTGACAGAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGG
GCGGATCATGCATGCATTTTCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGG
CACCCTTGGCGTCATTCCTGAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGT
TTGTATGCCAGAAGAAGGGTTTAAAGGTACTGGTCTTCTTGGACATTAATCTTTGAATACTTGCTGACTGCTAAGAAATGACCAGAGGGG
AAGAGGAGTTTGACATGTTAGGGCATTAAAGCAAAGGTGGATTTAAGAATTAAACCATTACATGCCCCTTCCAAAAGGCAGAAATCCATT
CAAACGTGACTGTCCCAAATGCCTTATGTCAAATAAAGCAGATTGCACTGATGGACATCAGACTTGAAGGAAATGTTTCCAATTTTATAT
TTAAGGGGGGTGGTGGGTGGGAGGGGGCAAGTAAAGACGGAACAAGTTTAGTAGCAGTAATAGTAAATCATGTTTACATATGAGATTTAT
AGTCGTGGGAGGGGAATAAAGTTCTGTTATATTTCCTTGCTCGAGTTTCATACCAGATGCGTTGGTCCATAAAGGATTGTATCAAGTAGA
TGGGACAACATTCTGCTCTGAACGAAAAGTAATTTTAGAGACATAACCTGCTTACCAATGCCTGTCTTTGATTCATATTCTACTTTCAAT
AAAGCATGAAAGTGAAGAACTTGTCCTAAGTGTGGAAAAGTGTCTTCAGATTTAGACTCTTCTCCATGTCAGCTGCAGCGCCACCCGCCT
TACACCTGCCCGGCCGTCTGTCTCTTGGTATTGGGTAAAGGAGGGGGCACCTGCATGTCTCCTGCAATGAGCAAGGAATTATGTCTCATG
TTTTGACTTCAGAGGCTTTTTGCTTTGGTGCATTTCAGAAAGGATGGAGAACATTTATTATGTGTGAAAGCATCCTCTTCCGGTTTTGCT

>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000374732_chr1_22016592_-_1283nt
GGCTCCCCGCGCCGCCCGGTCGGCAGCAGGGCGCTGAGCGAGCTCGGAGCCCGCGCTGTGCGCCTGCGGCCGGGGCGCCCCGCCGAGCGC
CGGTGCCCCGGCTCCCGGGCCGCCTTCGCCGCGCGGGAAGGATTCTTCAAAATTAACAGAAACCAATTCGGGCCAGCTGAAGAGAAAAAA
TAAAGCATTTCTTCCTTCTGATGGGGCAAGACTCTCTCTGGAATGGGGCTCTTATGACCTACAGTCAAACAAGGTGGCTCCCGGCTGCCT
CTGCTGCAGTTCAGAGCAACTTCAGGAGCTTCCCAGCCGAGAGCTTCAGGACGCCTTTCCTGTCCCACTGGCCCAGTTGCCACAACAAAC
AACAGAGAAGACGGTGACCATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGT
TGACTCCATGCCCCTGACAGAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGG
GCGGATCATGCATGCATTTTCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGG
CACCCTTGGCGTCATTCCTGAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGT
TTGTATGCCAGAAGAAGGGTTTAAAGGTACTGGTCTTCTTGGACATTAATCTTTGAATACTTGCTGACTGCTAAGAAATGACCAGAGGGG
AAGAGGAGTTTGACATGTTAGGGCATTAAAGCAAAGGTGGATTTAAGAATTAAACCATTACATGCCCCTTCCAAAAGGCAGAAATCCATT
CAAACGTGACTGTCCCAAATGCCTTATGTCAAATAAAGCAGATTGCACTGATGGACATCAGACTTGAAGGAAATGTTTCCAATTTTATAT
TTAAGGGGGGTGGTGGGTGGGAGGGGGCAAGTAAAGACGGAACAAGTTTAGTAGCAGTAATAGTAAATCATGTTTACATATGAGATTTAT
AGTCGTGGGAGGGGAATAAAGTTCTGTTATATTTCCTTGCTCGAGTTTCATACCAGATGCGTTGGTCCATAAAGGATTGTATCAAGTAGA
TGGGACAACATTCTGCTCTGAACGAAAAGTAATTTTAGAGACATAACCTGCTTACCAATGCCTGTCTTTGATTCATATTCTACTTTCAAT

>In-frame_MYLK_ENST00000360772_chr3_123512524_-_USP48_ENST00000529637_chr1_22016592_-_819nt
GGCTCCCCGCGCCGCCCGGTCGGCAGCAGGGCGCTGAGCGAGCTCGGAGCCCGCGCTGTGCGCCTGCGGCCGGGGCGCCCCGCCGAGCGC
CGGTGCCCCGGCTCCCGGGCCGCCTTCGCCGCGCGGGAAGGATTCTTCAAAATTAACAGAAACCAATTCGGGCCAGCTGAAGAGAAAAAA
TAAAGCATTTCTTCCTTCTGATGGGGCAAGACTCTCTCTGGAATGGGGCTCTTATGACCTACAGTCAAACAAGGTGGCTCCCGGCTGCCT
CTGCTGCAGTTCAGAGCAACTTCAGGAGCTTCCCAGCCGAGAGCTTCAGGACGCCTTTCCTGTCCCACTGGCCCAGTTGCCACAACAAAC
AACAGAGAAGACGGTGACCATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGT
TGACTCCATGCCCCTGACAGAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGG
GCGGATCATGCATGCATTTTCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGG
CACCCTTGGCGTCATTCCTGAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGT
TTGTATGCCAGAAGAAGGGTTTAAAGGTACTGGTCTTCTTGGACATTAATCTTTGAATACTTGCTGACTGCTAAGAAATGACCAGAGGGG

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000400301_chr1_22016592_-_1509nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG
TTTAAAGGTACTGGTCTTCTTGGACATTAATCTTTGAATACTTGCTGACTGCTAAGAAATGACCAGAGGGGAAGAGGAGTTTGACATGTT
AGGGCATTAAAGCAAAGGTGGATTTAAGAATTAAACCATTACATGCCCCTTCCAAAAGGCAGAAATCCATTCAAACGTGACTGTCCCAAA
TGCCTTATGTCAAATAAAGCAGATTGCACTGATGGACATCAGACTTGAAGGAAATGTTTCCAATTTTATATTTAAGGGGGGTGGTGGGTG
GGAGGGGGCAAGTAAAGACGGAACAAGTTTAGTAGCAGTAATAGTAAATCATGTTTACATATGAGATTTATAGTCGTGGGAGGGGAATAA
AGTTCTGTTATATTTCCTTGCTCGAGTTTCATACCAGATGCGTTGGTCCATAAAGGATTGTATCAAGTAGATGGGACAACATTCTGCTCT
GAACGAAAAGTAATTTTAGAGACATAACCTGCTTACCAATGCCTGTCTTTGATTCATATTCTACTTTCAATAAAGCATGAAAGTGAAGAA
CTTGTCCTAAGTGTGGAAAAGTGTCTTCAGATTTAGACTCTTCTCCATGTCAGCTGCAGCGCCACCCGCCTTACACCTGCCCGGCCGTCT
GTCTCTTGGTATTGGGTAAAGGAGGGGGCACCTGCATGTCTCCTGCAATGAGCAAGGAATTATGTCTCATGTTTTGACTTCAGAGGCTTT
TTGCTTTGGTGCATTTCAGAAAGGATGGAGAACATTTATTATGTGTGAAAGCATCCTCTTCCGGTTTTGCTGTTATTCAAAAGTGGGAAA
TGTACCTGGCACGTTTGAAAATAAAAAATCTGACTACCTATCAGAAGAGTAAATCAGACTGAAGTACATTTGGATAACACAAGGTTTCTA
TAAAATTTGTTCTTCCTGTCCTCCATGTCACTGTTTCTTGGACCTCAGTTCTCTTTTTGAAAGCATTATTCCAAAATGCCCTGAGAGGGT
CTCTTAGATCATTGTTTAAAAAAGGAAAAAAGTATATGGATGTGCTGTCCATCCAACTCAGGATTATCATTCTTAGCAACACGTAACCGA

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000308271_chr1_22016592_-_1228nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG
TTTAAAGGTACTGGTCTTCTTGGACATTAATCTTTGAATACTTGCTGACTGCTAAGAAATGACCAGAGGGGAAGAGGAGTTTGACATGTT
AGGGCATTAAAGCAAAGGTGGATTTAAGAATTAAACCATTACATGCCCCTTCCAAAAGGCAGAAATCCATTCAAACGTGACTGTCCCAAA
TGCCTTATGTCAAATAAAGCAGATTGCACTGATGGACATCAGACTTGAAGGAAATGTTTCCAATTTTATATTTAAGGGGGGTGGTGGGTG
GGAGGGGGCAAGTAAAGACGGAACAAGTTTAGTAGCAGTAATAGTAAATCATGTTTACATATGAGATTTATAGTCGTGGGAGGGGAATAA
AGTTCTGTTATATTTCCTTGCTCGAGTTTCATACCAGATGCGTTGGTCCATAAAGGATTGTATCAAGTAGATGGGACAACATTCTGCTCT
GAACGAAAAGTAATTTTAGAGACATAACCTGCTTACCAATGCCTGTCTTTGATTCATATTCTACTTTCAATAAAGCATGAAAGTGAAGAA
CTTGTCCTAAGTGTGGAAAAGTGTCTTCAGATTTAGACTCTTCTCCATGTCAGCTGCAGCGCCACCCGCCTTACACCTGCCCGGCCGTCT
GTCTCTTGGTATTGGGTAAAGGAGGGGGCACCTGCATGTCTCCTGCAATGAGCAAGGAATTATGTCTCATGTTTTGACTTCAGAGGCTTT
TTGCTTTGGTGCATTTCAGAAAGGATGGAGAACATTTATTATGTGTGAAAGCATCCTCTTCCGGTTTTGCTGTTATTCAAAAGTGGGAAA

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000374732_chr1_22016592_-_904nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG
TTTAAAGGTACTGGTCTTCTTGGACATTAATCTTTGAATACTTGCTGACTGCTAAGAAATGACCAGAGGGGAAGAGGAGTTTGACATGTT
AGGGCATTAAAGCAAAGGTGGATTTAAGAATTAAACCATTACATGCCCCTTCCAAAAGGCAGAAATCCATTCAAACGTGACTGTCCCAAA
TGCCTTATGTCAAATAAAGCAGATTGCACTGATGGACATCAGACTTGAAGGAAATGTTTCCAATTTTATATTTAAGGGGGGTGGTGGGTG
GGAGGGGGCAAGTAAAGACGGAACAAGTTTAGTAGCAGTAATAGTAAATCATGTTTACATATGAGATTTATAGTCGTGGGAGGGGAATAA
AGTTCTGTTATATTTCCTTGCTCGAGTTTCATACCAGATGCGTTGGTCCATAAAGGATTGTATCAAGTAGATGGGACAACATTCTGCTCT
GAACGAAAAGTAATTTTAGAGACATAACCTGCTTACCAATGCCTGTCTTTGATTCATATTCTACTTTCAATAAAGCATGAAAGTGAAGAA

>In-frame_MYLK_ENST00000475616_chr3_123512524_-_USP48_ENST00000529637_chr1_22016592_-_440nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGATCATGCATGCATTT
TCAGTTGCTCCTTTTGACCAGAATTTGTCAATTGATGGAAAGATTTTAAGTGATGACTGTGCCACCCTAGGCACCCTTGGCGTCATTCCT
GAATCTGTCATTTTATTGAAGGCTGATGAACCAATTGCAGATTATGCTGCAATGGATGATGTCATGCAAGTTTGTATGCCAGAAGAAGGG


Top

FusionGenePPI for MYLK_USP48


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MYLKPRKG2, CALM1, CTTN, PAK1, MLC1, SRC, ALK, MYC, TP53, GOPC, HSPB1, MYH9, PPP1CB, ANLN, MYO19USP48USP21, EEF1B2P5, APP, UCHL3, ZC3HAV1, ZFR, UBA6, UACA, VPS35, UBC, PSAP, SEC24D, BRAT1, DRD3, SLC9A3, SIRT6, GPS1, CSNK2A1, DYNC1LI1, NCBP2, NUP188, NTRK1, HIST1H2BG, HIST1H3A, SNW1, NDUFAF7, NR1D2, RNF123, UBB, HIST1H2BJ, PXK, UBAC1, ZNF232


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MYLK_USP48


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MYLK_USP48


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMYLKC0027626Neoplasm Invasiveness2CTD_human
HgeneMYLKC0027627Neoplasm Metastasis2CTD_human
HgeneMYLKC0017178Gastrointestinal Diseases1CTD_human
HgeneMYLKC0017601Glaucoma1CTD_human
HgeneMYLKC0017638Glioma1CTD_human
HgeneMYLKC0020443Hypercholesterolemia1CTD_human
HgeneMYLKC0020517Hypersensitivity1CTD_human
HgeneMYLKC0032285Pneumonia1CTD_human
HgeneMYLKC0042373Vascular Diseases1CTD_human
HgeneMYLKC0242488Acute Lung Injury1CTD_human
HgeneMYLKC1527311Brain Edema1CTD_human
HgeneMYLKC3151077AORTIC ANEURYSM, FAMILIAL THORACIC 71UNIPROT
TgeneUSP48C0236733Amphetamine-Related Disorders1CTD_human