FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23064

FusionGeneSummary for MYLK_FLNA

check button Fusion gene summary
Fusion gene informationFusion gene name: MYLK_FLNA
Fusion gene ID: 23064
HgeneTgene
Gene symbol

MYLK

FLNA

Gene ID

4638

2316

Gene namemyosin light chain kinasefilamin A
SynonymsAAT7|KRP|MLCK|MLCK1|MLCK108|MLCK210|MSTP083|MYLK1|smMLCKABP-280|ABPX|CSBS|CVD1|FGS2|FLN|FLN-A|FLN1|FMD|MNS|NHBP|OPD|OPD1|OPD2|XLVD|XMVD
Cytomap

3q21.1

Xq28

Type of geneprotein-codingprotein-coding
Descriptionmyosin light chain kinase, smooth musclekinase-related proteinmyosin, light polypeptide kinasesmooth muscle myosin light chain kinasetelokinfilamin-Aactin binding protein 280alpha-filaminendothelial actin-binding proteinfilamin A, alphafilamin-1non-muscle filamin
Modification date2018052320180523
UniProtAcc

Q15746

P21333

Ensembl transtripts involved in fusion geneENST00000360772, ENST00000359169, 
ENST00000360304, ENST00000418370, 
ENST00000578202, ENST00000354792, 
ENST00000346322, ENST00000583087, 
ENST00000475616, ENST00000510775, 
ENST00000360319, ENST00000422373, 
ENST00000369850, ENST00000369856, 
ENST00000344736, ENST00000498491, 
Fusion gene scores* DoF score10 X 8 X 5=40013 X 18 X 3=702
# samples 1119
** MAII scorelog2(11/400*10)=-1.86249647625006
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(19/702*10)=-1.88547161197361
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MYLK [Title/Abstract] AND FLNA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMYLK

GO:0030335

positive regulation of cell migration

19826488

HgeneMYLK

GO:0051928

positive regulation of calcium ion transport

16284075

HgeneMYLK

GO:0071476

cellular hypotonic response

11976941

HgeneMYLK

GO:0090303

positive regulation of wound healing

15825080

TgeneFLNA

GO:0016479

negative regulation of transcription by RNA polymerase I

22307607

TgeneFLNA

GO:0030334

regulation of cell migration

16291724

TgeneFLNA

GO:0031532

actin cytoskeleton reorganization

10051605

TgeneFLNA

GO:0034394

protein localization to cell surface

18322202

TgeneFLNA

GO:0043113

receptor clustering

10692483

TgeneFLNA

GO:0043433

negative regulation of DNA binding transcription factor activity

15684392

TgeneFLNA

GO:0044319

wound healing, spreading of cells

16291724

TgeneFLNA

GO:0045184

establishment of protein localization

18322202

TgeneFLNA

GO:0051764

actin crosslink formation

10051605

TgeneFLNA

GO:0072659

protein localization to plasma membrane

24951510

TgeneFLNA

GO:0090307

mitotic spindle assembly

18548008

TgeneFLNA

GO:1901381

positive regulation of potassium ion transmembrane transport

24951510


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-3B-A9HR-01AMYLKchr3

123339054

-FLNAchrX

153578575

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000360772ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000360772ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000360772ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000360772ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000360772ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
5CDS-5UTRENST00000360772ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000359169ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000359169ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000359169ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000359169ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000359169ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
5CDS-5UTRENST00000359169ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000360304ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000360304ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000360304ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000360304ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000360304ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
5CDS-5UTRENST00000360304ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000418370ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000418370ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000418370ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000418370ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000418370ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
5CDS-5UTRENST00000418370ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000578202ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000578202ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000578202ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000578202ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000578202ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
5CDS-5UTRENST00000578202ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000354792ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000354792ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000354792ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000354792ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000354792ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
5CDS-5UTRENST00000354792ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000346322ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000346322ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000346322ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000346322ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000346322ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
5CDS-5UTRENST00000346322ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000583087ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000583087ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000583087ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000583087ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
Frame-shiftENST00000583087ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
5CDS-5UTRENST00000583087ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000475616ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000475616ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000475616ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000475616ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
In-frameENST00000475616ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
5CDS-5UTRENST00000475616ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-
intron-3CDSENST00000510775ENST00000360319MYLKchr3

123339054

-FLNAchrX

153578575

-
intron-3CDSENST00000510775ENST00000422373MYLKchr3

123339054

-FLNAchrX

153578575

-
intron-3CDSENST00000510775ENST00000369850MYLKchr3

123339054

-FLNAchrX

153578575

-
intron-3CDSENST00000510775ENST00000369856MYLKchr3

123339054

-FLNAchrX

153578575

-
intron-3CDSENST00000510775ENST00000344736MYLKchr3

123339054

-FLNAchrX

153578575

-
intron-5UTRENST00000510775ENST00000498491MYLKchr3

123339054

-FLNAchrX

153578575

-

Top

FusionProtFeatures for MYLK_FLNA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MYLK

Q15746

FLNA

P21333

Promotes orthogonal branching of actin filaments andlinks actin filaments to membrane glycoproteins. Anchors varioustransmembrane proteins to the actin cytoskeleton and serves as ascaffold for a wide range of cytoplasmic signaling proteins.Interaction with FLNA may allow neuroblast migration from theventricular zone into the cortical plate. Tethers cell surface-localized furin, modulates its rate of internalization and directsits intracellular trafficking (By similarity). Involved inciliogenesis. Plays a role in cell-cell contacts and adherensjunctions during the development of blood vessels, heart and brainorgans. Plays a role in platelets morphology through interactionwith SYK that regulates ITAM- and ITAM-like-containing receptorsignaling, resulting in by platelet cytoskeleton organizationmaintenance (By similarity). {ECO:0000250,ECO:0000250|UniProtKB:Q8BTM8, ECO:0000269|PubMed:22121117}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331098_118617201846DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331238_132617201846DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331334_142617201846DomainFibronectin type-III
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331464_171917201846DomainProtein kinase
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133161_24917201846DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-313333_12217201846DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133414_50317201846DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133514_59917201846DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133620_71117201846DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133721_82117201846DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331098_118617381864DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331238_132617381864DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331334_142617381864DomainFibronectin type-III
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331464_171917381864DomainProtein kinase
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133161_24917381864DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-313333_12217381864DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133414_50317381864DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133514_59917381864DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133620_71117381864DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133721_82117381864DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341098_118617891915DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341238_132617891915DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341334_142617891915DomainFibronectin type-III
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341464_171917891915DomainProtein kinase
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234161_24917891915DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-323433_12217891915DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234414_50317891915DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234514_59917891915DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234620_71117891915DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234721_82117891915DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341098_118617381864DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341238_132617381864DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341334_142617381864DomainFibronectin type-III
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341464_171917381864DomainProtein kinase
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234161_24917381864DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-323433_12217381864DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234414_50317381864DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234514_59917381864DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234620_71117381864DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234721_82117381864DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311098_118617891915DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311238_132617891915DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311334_142617891915DomainFibronectin type-III
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311464_171917891915DomainProtein kinase
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931161_24917891915DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-293133_12217891915DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931414_50317891915DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931514_59917891915DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931620_71117891915DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931721_82117891915DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331470_147817201846Nucleotide bindingATP
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331470_147817381864Nucleotide bindingATP
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341470_147817891915Nucleotide bindingATP
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341470_147817381864Nucleotide bindingATP
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311470_147817891915Nucleotide bindingATP
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331061_146017201846RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133868_99817201846RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133923_96317201846RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133948_96317201846RegionCalmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133999_106317201846RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331061_146017381864RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133868_99817381864RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133923_96317381864RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133948_96317381864RegionCalmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133999_106317381864RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341061_146017891915RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341711_177417891915RegionNote=Calmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234868_99817891915RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234923_96317891915RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234948_96317891915RegionCalmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234999_106317891915RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341061_146017381864RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234868_99817381864RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234923_96317381864RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234948_96317381864RegionCalmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234999_106317381864RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311061_146017891915RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311711_177417891915RegionNote=Calmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931868_99817891915RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931923_96317891915RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931948_96317891915RegionCalmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931999_106317891915RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331004_101517201846RepeatNote=2-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331016_102717201846RepeatNote=2-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331028_103917201846RepeatNote=2-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331040_105117201846RepeatNote=2-5
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331052_106317201846RepeatNote=2-6
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133868_89517201846RepeatNote=1-1
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133896_92317201846RepeatNote=1-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133924_95117201846RepeatNote=1-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133952_97917201846RepeatNote=1-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133980_99817201846RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-3133999_100317201846RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331004_101517381864RepeatNote=2-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331016_102717381864RepeatNote=2-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331028_103917381864RepeatNote=2-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331040_105117381864RepeatNote=2-5
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331052_106317381864RepeatNote=2-6
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133868_89517381864RepeatNote=1-1
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133896_92317381864RepeatNote=1-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133924_95117381864RepeatNote=1-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133952_97917381864RepeatNote=1-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133980_99817381864RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-3133999_100317381864RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341004_101517891915RepeatNote=2-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341016_102717891915RepeatNote=2-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341028_103917891915RepeatNote=2-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341040_105117891915RepeatNote=2-5
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341052_106317891915RepeatNote=2-6
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234868_89517891915RepeatNote=1-1
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234896_92317891915RepeatNote=1-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234924_95117891915RepeatNote=1-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234952_97917891915RepeatNote=1-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234980_99817891915RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-3234999_100317891915RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341004_101517381864RepeatNote=2-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341016_102717381864RepeatNote=2-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341028_103917381864RepeatNote=2-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341040_105117381864RepeatNote=2-5
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341052_106317381864RepeatNote=2-6
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234868_89517381864RepeatNote=1-1
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234896_92317381864RepeatNote=1-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234924_95117381864RepeatNote=1-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234952_97917381864RepeatNote=1-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234980_99817381864RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-3234999_100317381864RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311004_101517891915RepeatNote=2-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311016_102717891915RepeatNote=2-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311028_103917891915RepeatNote=2-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311040_105117891915RepeatNote=2-5
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311052_106317891915RepeatNote=2-6
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931868_89517891915RepeatNote=1-1
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931896_92317891915RepeatNote=1-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931924_95117891915RepeatNote=1-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931952_97917891915RepeatNote=1-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931980_99817891915RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-2931999_100317891915RepeatNote=2-1%3B truncated
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41462517_255123772640RegionNote=Hinge 2
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41462517_264723772640RegionNote=Self-association site%2C tail
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43482517_255123852648RegionNote=Hinge 2
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43482517_264723852648RegionNote=Self-association site%2C tail
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42472517_255123772640RegionNote=Hinge 2
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42472517_264723772640RegionNote=Self-association site%2C tail
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41462424_251623772640RepeatNote=Filamin 23
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41462552_264623772640RepeatNote=Filamin 24
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43482424_251623852648RepeatNote=Filamin 23
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43482552_264623852648RepeatNote=Filamin 24
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42472424_251623772640RepeatNote=Filamin 23
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42472552_264623772640RepeatNote=Filamin 24

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331906_191417201846Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331906_191417381864Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341906_191417891915Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341906_191417381864Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131906_191429155Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311906_191417891915Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241906_191429155Compositional biasNote=Poly-Glu
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331809_189817201846DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331809_189817381864DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123339054chrX:153578575ENST00000360304-32341809_189817891915DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341809_189817381864DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131098_118629155DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131238_132629155DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131334_142629155DomainFibronectin type-III
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131464_171929155DomainProtein kinase
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13161_24929155DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131809_189829155DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-1333_12229155DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13414_50329155DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13514_59929155DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13620_71129155DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13721_82129155DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123339054chrX:153578575ENST00000475616-29311809_189817891915DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241098_118629155DomainNote=Ig-like C2-type 7
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241238_132629155DomainNote=Ig-like C2-type 8
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241334_142629155DomainFibronectin type-III
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241464_171929155DomainProtein kinase
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24161_24929155DomainNote=Ig-like C2-type 2
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241809_189829155DomainNote=Ig-like C2-type 9
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-2433_12229155DomainNote=Ig-like C2-type 1
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24414_50329155DomainNote=Ig-like C2-type 3
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24514_59929155DomainNote=Ig-like C2-type 4
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24620_71129155DomainNote=Ig-like C2-type 5
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24721_82129155DomainNote=Ig-like C2-type 6
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131470_147829155Nucleotide bindingATP
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241470_147829155Nucleotide bindingATP
HgeneMYLKchr3:123339054chrX:153578575ENST00000346322-31331711_177417201846RegionNote=Calmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000359169-31331711_177417381864RegionNote=Calmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000360772-32341711_177417381864RegionNote=Calmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131061_146029155RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131711_177429155RegionNote=Calmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13868_99829155RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13923_96329155RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13948_96329155RegionCalmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13999_106329155RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241061_146029155RegionActin-binding (calcium/calmodulin-insensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241711_177429155RegionNote=Calmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24868_99829155RegionNote=5 X 28 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24923_96329155RegionActin-binding (calcium/calmodulin-sensitive)
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24948_96329155RegionCalmodulin-binding
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24999_106329155RegionNote=6 X 12 AA approximate tandem repeats
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131004_101529155RepeatNote=2-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131016_102729155RepeatNote=2-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131028_103929155RepeatNote=2-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131040_105129155RepeatNote=2-5
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-131052_106329155RepeatNote=2-6
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13868_89529155RepeatNote=1-1
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13896_92329155RepeatNote=1-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13924_95129155RepeatNote=1-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13952_97929155RepeatNote=1-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13980_99829155RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000418370-13999_100329155RepeatNote=2-1%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241004_101529155RepeatNote=2-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241016_102729155RepeatNote=2-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241028_103929155RepeatNote=2-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241040_105129155RepeatNote=2-5
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-241052_106329155RepeatNote=2-6
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24868_89529155RepeatNote=1-1
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24896_92329155RepeatNote=1-2
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24924_95129155RepeatNote=1-3
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24952_97929155RepeatNote=1-4
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24980_99829155RepeatNote=1-5%3B truncated
HgeneMYLKchr3:123339054chrX:153578575ENST00000583087-24999_100329155RepeatNote=2-1%3B truncated
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-4146166_26923772640DomainCalponin-homology (CH) 2
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-414643_14923772640DomainCalponin-homology (CH) 1
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-4348166_26923852648DomainCalponin-homology (CH) 2
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-434843_14923852648DomainCalponin-homology (CH) 1
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-4247166_26923772640DomainCalponin-homology (CH) 2
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-424743_14923772640DomainCalponin-homology (CH) 1
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461741_177823772640RegionNote=Hinge 1
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41462_27423772640RegionNote=Actin-binding
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481741_177823852648RegionNote=Hinge 1
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43482_27423852648RegionNote=Actin-binding
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471741_177823772640RegionNote=Hinge 1
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42472_27423772640RegionNote=Actin-binding
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461062_115423772640RepeatNote=Filamin 9
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461155_124923772640RepeatNote=Filamin 10
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461250_134923772640RepeatNote=Filamin 11
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461350_144223772640RepeatNote=Filamin 12
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461443_153923772640RepeatNote=Filamin 13
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461540_163623772640RepeatNote=Filamin 14
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461649_174023772640RepeatNote=Filamin 15
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461779_186023772640RepeatNote=Filamin 16
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461861_195023772640RepeatNote=Filamin 17
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461951_203923772640RepeatNote=Filamin 18
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41462042_213123772640RepeatNote=Filamin 19
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41462132_223023772640RepeatNote=Filamin 20
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41462233_232523772640RepeatNote=Filamin 21
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41462327_242023772640RepeatNote=Filamin 22
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-4146276_37423772640RepeatNote=Filamin 1
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-4146376_47423772640RepeatNote=Filamin 2
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-4146475_57023772640RepeatNote=Filamin 3
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-4146571_66323772640RepeatNote=Filamin 4
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-4146667_76323772640RepeatNote=Filamin 5
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-4146764_86623772640RepeatNote=Filamin 6
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-4146867_96523772640RepeatNote=Filamin 7
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-4146966_106123772640RepeatNote=Filamin 8
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481062_115423852648RepeatNote=Filamin 9
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481155_124923852648RepeatNote=Filamin 10
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481250_134923852648RepeatNote=Filamin 11
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481350_144223852648RepeatNote=Filamin 12
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481443_153923852648RepeatNote=Filamin 13
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481540_163623852648RepeatNote=Filamin 14
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481649_174023852648RepeatNote=Filamin 15
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481779_186023852648RepeatNote=Filamin 16
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481861_195023852648RepeatNote=Filamin 17
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481951_203923852648RepeatNote=Filamin 18
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43482042_213123852648RepeatNote=Filamin 19
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43482132_223023852648RepeatNote=Filamin 20
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43482233_232523852648RepeatNote=Filamin 21
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43482327_242023852648RepeatNote=Filamin 22
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-4348276_37423852648RepeatNote=Filamin 1
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-4348376_47423852648RepeatNote=Filamin 2
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-4348475_57023852648RepeatNote=Filamin 3
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-4348571_66323852648RepeatNote=Filamin 4
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-4348667_76323852648RepeatNote=Filamin 5
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-4348764_86623852648RepeatNote=Filamin 6
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-4348867_96523852648RepeatNote=Filamin 7
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-4348966_106123852648RepeatNote=Filamin 8
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471062_115423772640RepeatNote=Filamin 9
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471155_124923772640RepeatNote=Filamin 10
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471250_134923772640RepeatNote=Filamin 11
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471350_144223772640RepeatNote=Filamin 12
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471443_153923772640RepeatNote=Filamin 13
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471540_163623772640RepeatNote=Filamin 14
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471649_174023772640RepeatNote=Filamin 15
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471779_186023772640RepeatNote=Filamin 16
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471861_195023772640RepeatNote=Filamin 17
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471951_203923772640RepeatNote=Filamin 18
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42472042_213123772640RepeatNote=Filamin 19
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42472132_223023772640RepeatNote=Filamin 20
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42472233_232523772640RepeatNote=Filamin 21
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42472327_242023772640RepeatNote=Filamin 22
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-4247276_37423772640RepeatNote=Filamin 1
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-4247376_47423772640RepeatNote=Filamin 2
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-4247475_57023772640RepeatNote=Filamin 3
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-4247571_66323772640RepeatNote=Filamin 4
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-4247667_76323772640RepeatNote=Filamin 5
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-4247764_86623772640RepeatNote=Filamin 6
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-4247867_96523772640RepeatNote=Filamin 7
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-4247966_106123772640RepeatNote=Filamin 8


Top

FusionGeneSequence for MYLK_FLNA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000360319_chrX_153578575_-_262aa
ISMLCASSLGRMAFTXLTSSSTAPTSLEAPSRSELGSLGMEGTQAWCLLTEQVWKAVSQGTQLSSSXTRAMRELVPCRXPLTAPPRXRWI
ARSALRATASPIPPWHLAATSSPSSTAAPTTLGAAPSRPKSQAPVSSATTASTRHHQCLXTLXPRPPVPPSMGPRVLGLLTPARWWPRAW

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000422373_chrX_153578575_-_262aa
ISMLCASSLGRMAFTXLTSSSTAPTSLEAPSRSELGSLGMEGTQAWCLLTEQVWKAVSQGTQLSSSXTRAMRELVPCRXPLTAPPRXRWI
ARSALRATASPIPPWHLAATSSPSSTAAPTTLGAAPSRPKSQAPVSSATTASTRHHQCLXTLXPRPPVPPSMGPRVLGLLTPARWWPRAW

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000369850_chrX_153578575_-_262aa
ISMLCASSLGRMAFTXLTSSSTAPTSLEAPSRSELGSLGMEGTQAWCLLTEQVWKAVSQGTQLSSSXTRAMRELVPCRXPLTAPPRXRWI
ARSALRATASPIPPWHLAATSSPSSTAAPTTLGAAPSRPKSQAPVSSATTASTRHHQCLXTLXPRPPVPPSMGPRVLGLLTPARWWPRAW

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000369856_chrX_153578575_-_262aa
ISMLCASSLGRMAFTXLTSSSTAPTSLEAPSRSELGSLGMEGTQAWCLLTEQVWKAVSQGTQLSSSXTRAMRELVPCRXPLTAPPRXRWI
ARSALRATASPIPPWHLAATSSPSSTAAPTTLGAAPSRPKSQAPVSSATTASTRHHQCLXTLXPRPPVPPSMGPRVLGLLTPARWWPRAW

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000344736_chrX_153578575_-_262aa
ISMLCASSLGRMAFTXLTSSSTAPTSLEAPSRSELGSLGMEGTQAWCLLTEQVWKAVSQGTQLSSSXTRAMRELVPCRXPLTAPPRXRWI
ARSALRATASPIPPWHLAATSSPSSTAAPTTLGAAPSRPKSQAPVSSATTASTRHHQCLXTLXPRPPVPPSMGPRVLGLLTPARWWPRAW

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000360319_chrX_153578575_-_852aa
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE
NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERL
GSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVI
CYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHG
GDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV
TGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILV

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000422373_chrX_153578575_-_852aa
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE
NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERL
GSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVI
CYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHG
GDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV
TGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILV

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000369850_chrX_153578575_-_852aa
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE
NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERL
GSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVI
CYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHG
GDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV
TGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILV

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000369856_chrX_153578575_-_852aa
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE
NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERL
GSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVI
CYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHG
GDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV
TGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILV

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000344736_chrX_153578575_-_852aa
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE
NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERL
GSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVI
CYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHG
GDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV
TGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILV

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000360319_chrX_153578575_-_2052aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS
LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSD
VRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEVSGIPKPEVAWFLE
GTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS
DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLM
LQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKK
LPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKC
VAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL
SWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEE
KANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDC
TQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRE
NGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVT
YTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKS

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000422373_chrX_153578575_-_2052aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS
LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSD
VRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEVSGIPKPEVAWFLE
GTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS
DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLM
LQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKK
LPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKC
VAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL
SWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEE
KANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDC
TQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRE
NGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVT
YTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKS

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000369850_chrX_153578575_-_2052aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS
LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSD
VRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEVSGIPKPEVAWFLE
GTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS
DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLM
LQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKK
LPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKC
VAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL
SWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEE
KANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDC
TQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRE
NGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVT
YTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKS

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000369856_chrX_153578575_-_2052aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS
LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSD
VRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEVSGIPKPEVAWFLE
GTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS
DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLM
LQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKK
LPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKC
VAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL
SWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEE
KANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDC
TQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRE
NGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVT
YTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKS

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000344736_chrX_153578575_-_2052aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS
LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSD
VRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEVSGIPKPEVAWFLE
GTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS
DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLM
LQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKK
LPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKC
VAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL
SWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEE
KANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDC
TQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDKYAVRFIPRE
NGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVT
YTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000360319_chrX_153578575_-_788nt
ATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCT
TCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGA
ACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATT
GCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACC
ACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAG
ACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGG
GGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATG
GCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGT

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000422373_chrX_153578575_-_788nt
ATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCT
TCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGA
ACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATT
GCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACC
ACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAG
ACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGG
GGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATG
GCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGT

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000369850_chrX_153578575_-_788nt
ATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCT
TCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGA
ACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATT
GCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACC
ACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAG
ACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGG
GGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATG
GCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGT

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000369856_chrX_153578575_-_788nt
ATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCT
TCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGA
ACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATT
GCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACC
ACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAG
ACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGG
GGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATG
GCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGT

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000344736_chrX_153578575_-_788nt
ATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCT
TCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGA
ACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATT
GCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACC
ACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAG
ACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGG
GGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATG
GCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGT

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000360319_chrX_153578575_-_2556nt
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000422373_chrX_153578575_-_2556nt
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000369850_chrX_153578575_-_2556nt
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000369856_chrX_153578575_-_2556nt
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000344736_chrX_153578575_-_2556nt
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000360319_chrX_153578575_-_6156nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000422373_chrX_153578575_-_6156nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000369850_chrX_153578575_-_6156nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000369856_chrX_153578575_-_6156nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000344736_chrX_153578575_-_6156nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000360319_chrX_153578575_-_6705nt
GGCTCCCCGCGCCGCCCGGTCGGCAGCAGGGCGCTGAGCGAGCTCGGAGCCCGCGCTGTGCGCCTGCGGCCGGGGCGCCCCGCCGAGCGC
CGGTGCCCCGGCTCCCGGGCCGCCTTCGCCGCGCGGGAAGGATTCTTCAAAATTAACAGAAACCAATTCGGGCCAGCTGAAGAGAAAAAA
TAAAGCATTTCTTCCTTCTGATGGGGCAAGACTCTCTCTGGAATGGGGCTCTTATGACCTACAGTCAAACAAGGTGGCTCCCGGCTGCCT
CTGCTGCAGTTCAGAGCAACTTCAGGAGCTTCCCAGCCGAGAGCTTCAGGACGCCTTTCCTGTCCCACTGGCCCAGTTGCCACAACAAAC
AACAGAGAAGACGGTGACCATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGT
TGACTCCATGCCCCTGACAGAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGG
GCGGGTCCGGGGTTACCCAGAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGG
CATCCGGGGGACTTTCAGCCTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGC
TCGCCAGGTGACAGTGGAGTTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATT
TTCAGCTCCAGCAGTGGAGACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGA
AGGACAGATGGGACGATTCTCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAG
TGCCCGTGTGTCTGTGTCTGAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCT
GGTGGTGAACGGGTCGGGGAAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAAC
AAAAGCCACCAATTCAGATGTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAG
CAAGAACTGCTCCAGCCCCCAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTC
ATGCAAGGACTCGCCCAGAACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCC
GGAACCAAGAGCACCAGGCCTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCAC
CAGGCAGCCTGGCCTGGGGAGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCC
CAAATTTGAGAGCAAGCCCCAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGA
AGTGGCCTGGTTCCTGGAAGGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCT
GCTGAAAGCCCGGACCAGGGACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGT
GGAAAGGCTTGCCGTGATGGAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCA
GTGCTCCGTACGGGGGACCCCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGG
CGTGGCTGAGCTCCACATCCAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTG
CAGCGCCTGGGTCACCGTCCATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCAT
CTTCCTGCAGGGCCTCTCTGATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGT
CATCTGGCTGCACAATGGGAATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGA
AGTGTTCCCGGAGGACACGGGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGA
GCCTCACGATGGCACCCAGCCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCAT
AGCTGGTGACCCCTTTCCTACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGA
GGACGTGTTCACCCTGGTTCTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAG
TTGCCAGGTGTCACTGATGCTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGG
AGGAGTTGGTGCTGATGGTGGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGA
AGACGGCGAGGACGTGCGAGGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCA
GCTGGACTTCCGAGACCTCCTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGA
TTTCCGTGCCAACCTGCAGCGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCG
CTCTGTCCTGGCCAAGAAGGGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGT
GCTGGGTGGCAAGAAGAAATTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCT
GAGCAATGCACAGCCTTCAGGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGC
CGAGACCCTGAAGCCCATGGGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGA
TGTGAACTGCAAGAGAGGCCATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCT
GCAAGATGTTCATGTGGCAGAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAA
CGGAAAGACCCTCAAGACCACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGA
CAGAGGCTTATACAAGTGTGTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGA
GAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAA
GAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTC
AGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACAT
GAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAA
CAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCG
GAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGC
CAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGT
ACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGA
AGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTA
CGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTT
CTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTG
TGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGA
CTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCT
GGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAA
TGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACAT
GTGGAGCATCGGGGTCATCTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAA
CATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCAT
TGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAA
ACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACAT
CCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGG
CGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAA
GGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTA
CGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATC
ATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGT
GGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCT
GGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAA
GGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGG
CCCGTGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAGCCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCG
CCCGCCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTCACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGG
GCAGAGGGAGCCATTTGGTGGCGCTGCTTGTCTTCTTTGGTTCTGGGAGGGGTGAGGGATGGGGGTCCTGTACACAACCACCCACTAGTT

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000422373_chrX_153578575_-_6699nt
GGCTCCCCGCGCCGCCCGGTCGGCAGCAGGGCGCTGAGCGAGCTCGGAGCCCGCGCTGTGCGCCTGCGGCCGGGGCGCCCCGCCGAGCGC
CGGTGCCCCGGCTCCCGGGCCGCCTTCGCCGCGCGGGAAGGATTCTTCAAAATTAACAGAAACCAATTCGGGCCAGCTGAAGAGAAAAAA
TAAAGCATTTCTTCCTTCTGATGGGGCAAGACTCTCTCTGGAATGGGGCTCTTATGACCTACAGTCAAACAAGGTGGCTCCCGGCTGCCT
CTGCTGCAGTTCAGAGCAACTTCAGGAGCTTCCCAGCCGAGAGCTTCAGGACGCCTTTCCTGTCCCACTGGCCCAGTTGCCACAACAAAC
AACAGAGAAGACGGTGACCATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGT
TGACTCCATGCCCCTGACAGAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGG
GCGGGTCCGGGGTTACCCAGAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGG
CATCCGGGGGACTTTCAGCCTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGC
TCGCCAGGTGACAGTGGAGTTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATT
TTCAGCTCCAGCAGTGGAGACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGA
AGGACAGATGGGACGATTCTCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAG
TGCCCGTGTGTCTGTGTCTGAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCT
GGTGGTGAACGGGTCGGGGAAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAAC
AAAAGCCACCAATTCAGATGTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAG
CAAGAACTGCTCCAGCCCCCAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTC
ATGCAAGGACTCGCCCAGAACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCC
GGAACCAAGAGCACCAGGCCTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCAC
CAGGCAGCCTGGCCTGGGGAGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCC
CAAATTTGAGAGCAAGCCCCAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGA
AGTGGCCTGGTTCCTGGAAGGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCT
GCTGAAAGCCCGGACCAGGGACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGT
GGAAAGGCTTGCCGTGATGGAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCA
GTGCTCCGTACGGGGGACCCCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGG
CGTGGCTGAGCTCCACATCCAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTG
CAGCGCCTGGGTCACCGTCCATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCAT
CTTCCTGCAGGGCCTCTCTGATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGT
CATCTGGCTGCACAATGGGAATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGA
AGTGTTCCCGGAGGACACGGGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGA
GCCTCACGATGGCACCCAGCCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCAT
AGCTGGTGACCCCTTTCCTACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGA
GGACGTGTTCACCCTGGTTCTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAG
TTGCCAGGTGTCACTGATGCTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGG
AGGAGTTGGTGCTGATGGTGGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGA
AGACGGCGAGGACGTGCGAGGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCA
GCTGGACTTCCGAGACCTCCTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGA
TTTCCGTGCCAACCTGCAGCGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCG
CTCTGTCCTGGCCAAGAAGGGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGT
GCTGGGTGGCAAGAAGAAATTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCT
GAGCAATGCACAGCCTTCAGGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGC
CGAGACCCTGAAGCCCATGGGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGA
TGTGAACTGCAAGAGAGGCCATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCT
GCAAGATGTTCATGTGGCAGAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAA
CGGAAAGACCCTCAAGACCACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGA
CAGAGGCTTATACAAGTGTGTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGA
GAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAA
GAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTC
AGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACAT
GAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAA
CAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCG
GAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGC
CAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGT
ACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGA
AGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTA
CGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTT
CTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTG
TGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGA
CTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCT
GGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAA
TGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACAT
GTGGAGCATCGGGGTCATCTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAA
CATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCAT
TGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAA
ACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACAT
CCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGG
CGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAA
GGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTA
CGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATC
ATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGT
GGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCT
GGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAA
GGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGG
CCCGTGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAGCCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCG
CCCGCCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTCACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGG
GCAGAGGGAGCCATTTGGTGGCGCTGCTTGTCTTCTTTGGTTCTGGGAGGGGTGAGGGATGGGGGTCCTGTACACAACCACCCACTAGTT

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000369850_chrX_153578575_-_6583nt
GGCTCCCCGCGCCGCCCGGTCGGCAGCAGGGCGCTGAGCGAGCTCGGAGCCCGCGCTGTGCGCCTGCGGCCGGGGCGCCCCGCCGAGCGC
CGGTGCCCCGGCTCCCGGGCCGCCTTCGCCGCGCGGGAAGGATTCTTCAAAATTAACAGAAACCAATTCGGGCCAGCTGAAGAGAAAAAA
TAAAGCATTTCTTCCTTCTGATGGGGCAAGACTCTCTCTGGAATGGGGCTCTTATGACCTACAGTCAAACAAGGTGGCTCCCGGCTGCCT
CTGCTGCAGTTCAGAGCAACTTCAGGAGCTTCCCAGCCGAGAGCTTCAGGACGCCTTTCCTGTCCCACTGGCCCAGTTGCCACAACAAAC
AACAGAGAAGACGGTGACCATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGT
TGACTCCATGCCCCTGACAGAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGG
GCGGGTCCGGGGTTACCCAGAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGG
CATCCGGGGGACTTTCAGCCTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGC
TCGCCAGGTGACAGTGGAGTTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATT
TTCAGCTCCAGCAGTGGAGACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGA
AGGACAGATGGGACGATTCTCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAG
TGCCCGTGTGTCTGTGTCTGAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCT
GGTGGTGAACGGGTCGGGGAAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAAC
AAAAGCCACCAATTCAGATGTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAG
CAAGAACTGCTCCAGCCCCCAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTC
ATGCAAGGACTCGCCCAGAACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCC
GGAACCAAGAGCACCAGGCCTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCAC
CAGGCAGCCTGGCCTGGGGAGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCC
CAAATTTGAGAGCAAGCCCCAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGA
AGTGGCCTGGTTCCTGGAAGGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCT
GCTGAAAGCCCGGACCAGGGACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGT
GGAAAGGCTTGCCGTGATGGAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCA
GTGCTCCGTACGGGGGACCCCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGG
CGTGGCTGAGCTCCACATCCAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTG
CAGCGCCTGGGTCACCGTCCATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCAT
CTTCCTGCAGGGCCTCTCTGATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGT
CATCTGGCTGCACAATGGGAATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGA
AGTGTTCCCGGAGGACACGGGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGA
GCCTCACGATGGCACCCAGCCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCAT
AGCTGGTGACCCCTTTCCTACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGA
GGACGTGTTCACCCTGGTTCTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAG
TTGCCAGGTGTCACTGATGCTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGG
AGGAGTTGGTGCTGATGGTGGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGA
AGACGGCGAGGACGTGCGAGGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCA
GCTGGACTTCCGAGACCTCCTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGA
TTTCCGTGCCAACCTGCAGCGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCG
CTCTGTCCTGGCCAAGAAGGGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGT
GCTGGGTGGCAAGAAGAAATTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCT
GAGCAATGCACAGCCTTCAGGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGC
CGAGACCCTGAAGCCCATGGGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGA
TGTGAACTGCAAGAGAGGCCATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCT
GCAAGATGTTCATGTGGCAGAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAA
CGGAAAGACCCTCAAGACCACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGA
CAGAGGCTTATACAAGTGTGTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGA
GAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAA
GAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTC
AGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACAT
GAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAA
CAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCG
GAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGC
CAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGT
ACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGA
AGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTA
CGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTT
CTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTG
TGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGA
CTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCT
GGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAA
TGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACAT
GTGGAGCATCGGGGTCATCTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAA
CATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCAT
TGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAA
ACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACAT
CCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGG
CGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAA
GGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTA
CGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATC
ATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGT
GGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCT
GGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAA
GGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGG
CCCGTGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAGCCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCG
CCCGCCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTCACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGG

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000369856_chrX_153578575_-_6575nt
GGCTCCCCGCGCCGCCCGGTCGGCAGCAGGGCGCTGAGCGAGCTCGGAGCCCGCGCTGTGCGCCTGCGGCCGGGGCGCCCCGCCGAGCGC
CGGTGCCCCGGCTCCCGGGCCGCCTTCGCCGCGCGGGAAGGATTCTTCAAAATTAACAGAAACCAATTCGGGCCAGCTGAAGAGAAAAAA
TAAAGCATTTCTTCCTTCTGATGGGGCAAGACTCTCTCTGGAATGGGGCTCTTATGACCTACAGTCAAACAAGGTGGCTCCCGGCTGCCT
CTGCTGCAGTTCAGAGCAACTTCAGGAGCTTCCCAGCCGAGAGCTTCAGGACGCCTTTCCTGTCCCACTGGCCCAGTTGCCACAACAAAC
AACAGAGAAGACGGTGACCATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGT
TGACTCCATGCCCCTGACAGAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGG
GCGGGTCCGGGGTTACCCAGAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGG
CATCCGGGGGACTTTCAGCCTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGC
TCGCCAGGTGACAGTGGAGTTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATT
TTCAGCTCCAGCAGTGGAGACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGA
AGGACAGATGGGACGATTCTCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAG
TGCCCGTGTGTCTGTGTCTGAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCT
GGTGGTGAACGGGTCGGGGAAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAAC
AAAAGCCACCAATTCAGATGTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAG
CAAGAACTGCTCCAGCCCCCAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTC
ATGCAAGGACTCGCCCAGAACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCC
GGAACCAAGAGCACCAGGCCTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCAC
CAGGCAGCCTGGCCTGGGGAGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCC
CAAATTTGAGAGCAAGCCCCAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGA
AGTGGCCTGGTTCCTGGAAGGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCT
GCTGAAAGCCCGGACCAGGGACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGT
GGAAAGGCTTGCCGTGATGGAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCA
GTGCTCCGTACGGGGGACCCCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGG
CGTGGCTGAGCTCCACATCCAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTG
CAGCGCCTGGGTCACCGTCCATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCAT
CTTCCTGCAGGGCCTCTCTGATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGT
CATCTGGCTGCACAATGGGAATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGA
AGTGTTCCCGGAGGACACGGGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGA
GCCTCACGATGGCACCCAGCCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCAT
AGCTGGTGACCCCTTTCCTACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGA
GGACGTGTTCACCCTGGTTCTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAG
TTGCCAGGTGTCACTGATGCTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGG
AGGAGTTGGTGCTGATGGTGGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGA
AGACGGCGAGGACGTGCGAGGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCA
GCTGGACTTCCGAGACCTCCTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGA
TTTCCGTGCCAACCTGCAGCGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCG
CTCTGTCCTGGCCAAGAAGGGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGT
GCTGGGTGGCAAGAAGAAATTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCT
GAGCAATGCACAGCCTTCAGGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGC
CGAGACCCTGAAGCCCATGGGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGA
TGTGAACTGCAAGAGAGGCCATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCT
GCAAGATGTTCATGTGGCAGAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAA
CGGAAAGACCCTCAAGACCACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGA
CAGAGGCTTATACAAGTGTGTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGA
GAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAA
GAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTC
AGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACAT
GAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAA
CAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCG
GAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGC
CAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGT
ACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGA
AGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTA
CGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTT
CTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTG
TGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGA
CTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCT
GGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAA
TGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACAT
GTGGAGCATCGGGGTCATCTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAA
CATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCAT
TGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAA
ACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACAT
CCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGG
CGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAA
GGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTA
CGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATC
ATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGT
GGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCT
GGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAA
GGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGG
CCCGTGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAGCCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCG
CCCGCCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTCACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGG

>In-frame_MYLK_ENST00000360772_chr3_123339054_-_FLNA_ENST00000344736_chrX_153578575_-_6447nt
GGCTCCCCGCGCCGCCCGGTCGGCAGCAGGGCGCTGAGCGAGCTCGGAGCCCGCGCTGTGCGCCTGCGGCCGGGGCGCCCCGCCGAGCGC
CGGTGCCCCGGCTCCCGGGCCGCCTTCGCCGCGCGGGAAGGATTCTTCAAAATTAACAGAAACCAATTCGGGCCAGCTGAAGAGAAAAAA
TAAAGCATTTCTTCCTTCTGATGGGGCAAGACTCTCTCTGGAATGGGGCTCTTATGACCTACAGTCAAACAAGGTGGCTCCCGGCTGCCT
CTGCTGCAGTTCAGAGCAACTTCAGGAGCTTCCCAGCCGAGAGCTTCAGGACGCCTTTCCTGTCCCACTGGCCCAGTTGCCACAACAAAC
AACAGAGAAGACGGTGACCATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGT
TGACTCCATGCCCCTGACAGAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGG
GCGGGTCCGGGGTTACCCAGAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGG
CATCCGGGGGACTTTCAGCCTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGC
TCGCCAGGTGACAGTGGAGTTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATT
TTCAGCTCCAGCAGTGGAGACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGA
AGGACAGATGGGACGATTCTCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAG
TGCCCGTGTGTCTGTGTCTGAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCT
GGTGGTGAACGGGTCGGGGAAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAAC
AAAAGCCACCAATTCAGATGTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAG
CAAGAACTGCTCCAGCCCCCAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTC
ATGCAAGGACTCGCCCAGAACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCC
GGAACCAAGAGCACCAGGCCTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCAC
CAGGCAGCCTGGCCTGGGGAGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCC
CAAATTTGAGAGCAAGCCCCAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGA
AGTGGCCTGGTTCCTGGAAGGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCT
GCTGAAAGCCCGGACCAGGGACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGT
GGAAAGGCTTGCCGTGATGGAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCA
GTGCTCCGTACGGGGGACCCCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGG
CGTGGCTGAGCTCCACATCCAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTG
CAGCGCCTGGGTCACCGTCCATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCAT
CTTCCTGCAGGGCCTCTCTGATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGT
CATCTGGCTGCACAATGGGAATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGA
AGTGTTCCCGGAGGACACGGGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGA
GCCTCACGATGGCACCCAGCCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCAT
AGCTGGTGACCCCTTTCCTACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGA
GGACGTGTTCACCCTGGTTCTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAG
TTGCCAGGTGTCACTGATGCTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGG
AGGAGTTGGTGCTGATGGTGGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGA
AGACGGCGAGGACGTGCGAGGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCA
GCTGGACTTCCGAGACCTCCTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGA
TTTCCGTGCCAACCTGCAGCGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCG
CTCTGTCCTGGCCAAGAAGGGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGT
GCTGGGTGGCAAGAAGAAATTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCT
GAGCAATGCACAGCCTTCAGGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGC
CGAGACCCTGAAGCCCATGGGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGA
TGTGAACTGCAAGAGAGGCCATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCT
GCAAGATGTTCATGTGGCAGAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAA
CGGAAAGACCCTCAAGACCACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGA
CAGAGGCTTATACAAGTGTGTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGA
GAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAA
GAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTC
AGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACAT
GAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAA
CAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCG
GAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGC
CAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGT
ACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGA
AGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTA
CGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTT
CTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTG
TGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGA
CTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCT
GGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAA
TGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACAT
GTGGAGCATCGGGGTCATCTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAA
CATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCAT
TGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAA
ACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACAT
CCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGG
CGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAA
GGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTA
CGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATC
ATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGT
GGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCT
GGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAA
GGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGG

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000360319_chrX_153578575_-_3011nt
AACAAACAAGTGTCCGAGCTGGCAGGACGACCCAGCAGGGTCAGCCGTGAGGAGGAGGGAGCAGAGCGAGGTCCGTGTGGGAGACTTCCT
AGAGGAGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACT
GAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGAC
CAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAG
CAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGC
TGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGC
ACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTAC
AGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCT
GACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAG
AAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACT
GAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACT
CGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTC
CACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTG
TTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATC
CACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTT
GGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAG
CCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGAT
AACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTCGACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATC
AGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATG
GAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGA
AGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTA
GAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCT
GGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGT
GTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTG
AAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGC
GGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCA
GTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCC
AAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTG
GGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGAC
AAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCG
TGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAGCCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCGCCCG
CCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTCACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGGGCAG
AGGGAGCCATTTGGTGGCGCTGCTTGTCTTCTTTGGTTCTGGGAGGGGTGAGGGATGGGGGTCCTGTACACAACCACCCACTAGTTCTCT

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000422373_chrX_153578575_-_3005nt
AACAAACAAGTGTCCGAGCTGGCAGGACGACCCAGCAGGGTCAGCCGTGAGGAGGAGGGAGCAGAGCGAGGTCCGTGTGGGAGACTTCCT
AGAGGAGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACT
GAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGAC
CAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAG
CAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGC
TGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGC
ACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTAC
AGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCT
GACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAG
AAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACT
GAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACT
CGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTC
CACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTG
TTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATC
CACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTT
GGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAG
CCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGAT
AACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTCGACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATC
AGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATG
GAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGA
AGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTA
GAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCT
GGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGT
GTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTG
AAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGC
GGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCA
GTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCC
AAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTG
GGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGAC
AAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCG
TGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAGCCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCGCCCG
CCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTCACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGGGCAG
AGGGAGCCATTTGGTGGCGCTGCTTGTCTTCTTTGGTTCTGGGAGGGGTGAGGGATGGGGGTCCTGTACACAACCACCCACTAGTTCTCT

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000369850_chrX_153578575_-_2889nt
AACAAACAAGTGTCCGAGCTGGCAGGACGACCCAGCAGGGTCAGCCGTGAGGAGGAGGGAGCAGAGCGAGGTCCGTGTGGGAGACTTCCT
AGAGGAGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACT
GAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGAC
CAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAG
CAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGC
TGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGC
ACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTAC
AGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCT
GACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAG
AAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACT
GAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACT
CGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTC
CACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTG
TTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATC
CACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTT
GGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAG
CCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGAT
AACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTCGACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATC
AGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATG
GAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGA
AGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTA
GAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCT
GGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGT
GTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTG
AAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGC
GGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCA
GTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCC
AAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTG
GGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGAC
AAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCG
TGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAGCCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCGCCCG
CCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTCACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGGGCAG

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000369856_chrX_153578575_-_2881nt
AACAAACAAGTGTCCGAGCTGGCAGGACGACCCAGCAGGGTCAGCCGTGAGGAGGAGGGAGCAGAGCGAGGTCCGTGTGGGAGACTTCCT
AGAGGAGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACT
GAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGAC
CAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAG
CAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGC
TGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGC
ACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTAC
AGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCT
GACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAG
AAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACT
GAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACT
CGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTC
CACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTG
TTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATC
CACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTT
GGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAG
CCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGAT
AACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTCGACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATC
AGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATG
GAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGA
AGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTA
GAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCT
GGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGT
GTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTG
AAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGC
GGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCA
GTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCC
AAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTG
GGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGAC
AAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCG
TGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAGCCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCGCCCG
CCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTCACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGGGCAG

>In-frame_MYLK_ENST00000354792_chr3_123339054_-_FLNA_ENST00000344736_chrX_153578575_-_2753nt
AACAAACAAGTGTCCGAGCTGGCAGGACGACCCAGCAGGGTCAGCCGTGAGGAGGAGGGAGCAGAGCGAGGTCCGTGTGGGAGACTTCCT
AGAGGAGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAGATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACT
GAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACACCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGAC
CAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAAGTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAG
CAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGC
TGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGC
ACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTAC
AGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCT
GACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAG
AAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACT
GAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACT
CGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTC
CACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTG
TTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATC
CACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTT
GGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAG
CCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGAT
AACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTCGACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATC
AGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATG
GAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGA
AGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTA
GAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAGAATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCT
GGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGAGGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGT
GTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAATGCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTG
AAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACCTATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGC
GGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTCACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCA
GTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAGCATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCC
AAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGCAGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTG
GGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTGAAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGAC
AAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCACATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCG

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000360319_chrX_153578575_-_6479nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC
ATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCGTGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAG
CCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCGCCCGCCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTC
ACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGGGCAGAGGGAGCCATTTGGTGGCGCTGCTTGTCTTCTTTGGTTCTGG

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000422373_chrX_153578575_-_6473nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC
ATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCGTGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAG
CCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCGCCCGCCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTC
ACCTGCCTCCCCAGCCAGCCGCTGACCTCTCGGCTTTCACTTGGGCAGAGGGAGCCATTTGGTGGCGCTGCTTGTCTTCTTTGGTTCTGG

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000369850_chrX_153578575_-_6357nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC
ATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCGTGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAG
CCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCGCCCGCCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTC

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000369856_chrX_153578575_-_6349nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC
ATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCGTGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAG
CCCCGCCCTCTTCCCCTCAACCCCGGCCCAGGCCGCCCTGGCCGCCCGCCTGTCACTGCAGCCGCCCCTGCCCTGTGCCGTGCTGCGCTC

>In-frame_MYLK_ENST00000475616_chr3_123339054_-_FLNA_ENST00000344736_chrX_153578575_-_6221nt
ATGGGGGATGTGAAGCTGGTTGCCTCGTCACACATTTCCAAAACCTCCCTCAGTGTGGATCCCTCAAGAGTTGACTCCATGCCCCTGACA
GAGGCCCCTGCTTTCATTTTGCCCCCTCGGAACCTCTGCATCAAAGAAGGAGCCACCGCCAAGTTCGAAGGGCGGGTCCGGGGTTACCCA
GAGCCCCAGGTGACATGGCACAGAAACGGGCAACCCATCACCAGCGGGGGCCGCTTCCTGCTGGATTGCGGCATCCGGGGGACTTTCAGC
CTTGTGATTCATGCTGTCCATGAGGAGGACAGGGGAAAGTATACCTGTGAAGCCACCAATGGCAGTGGTGCTCGCCAGGTGACAGTGGAG
TTGACAGTAGAAGGAAGTTTTGCGAAGCAGCTTGGTCAGCCTGTTGTTTCCAAAACCTTAGGGGATAGATTTTCAGCTCCAGCAGTGGAG
ACCCGTCCTAGCATCTGGGGGGAGTGCCCACCAAAGTTTGCTACCAAGCTGGGCCGAGTTGTGGTCAAAGAAGGACAGATGGGACGATTC
TCCTGCAAGATCACTGGCCGGCCCCAACCGCAGGTCACCTGGCTCAAGGGAAATGTTCCACTGCAGCCGAGTGCCCGTGTGTCTGTGTCT
GAGAAGAACGGCATGCAGGTTCTGGAAATCCATGGAGTCAACCAAGATGACGTGGGAGTGTACACGTGCCTGGTGGTGAACGGGTCGGGG
AAGGCCTCGATGTCAGCTGAACTTTCCATCCAAGGTTTGGACAGTGCCAATAGGTCATTTGTGAGAGAAACAAAAGCCACCAATTCAGAT
GTCAGGAAAGAGGTGACCAATGTAATCTCAAAGGAGTCGAAGCTGGACAGTCTGGAGGCTGCAGCCAAAAGCAAGAACTGCTCCAGCCCC
CAGAGAGGTGGCTCCCCACCCTGGGCTGCAAACAGCCAGCCTCAGCCCCCAAGGGAGTCCAAGCTGGAGTCATGCAAGGACTCGCCCAGA
ACGGCCCCGCAGACCCCGGTCCTTCAGAAGACTTCCAGCTCCATCACCCTGCAGGCCGCAAGAGTTCAGCCGGAACCAAGAGCACCAGGC
CTGGGGGTCCTATCACCTTCTGGAGAAGAGAGGAAGAGGCCAGCTCCTCCCCGTCCAGCCACCTTCCCCACCAGGCAGCCTGGCCTGGGG
AGCCAAGATGTTGTGAGCAAGGCTGCTAACAGGAGAATCCCCATGGAGGGCCAGAGGGATTCAGCATTCCCCAAATTTGAGAGCAAGCCC
CAAAGCCAGGAGGTCAAGGAAAATCAAACTGTCAAGTTCAGATGTGAAGTTTCCGGGATTCCAAAGCCTGAAGTGGCCTGGTTCCTGGAA
GGCACCCCCGTGAGGAGACAGGAAGGCAGCATTGAGGTTTATGAAGATGCTGGCTCCCATTACCTCTGCCTGCTGAAAGCCCGGACCAGG
GACAGTGGGACATACAGCTGCACTGCTTCCAACGCCCAAGGCCAGCTGTCCTGTAGCTGGACCCTCCAAGTGGAAAGGCTTGCCGTGATG
GAGGTGGCCCCCTCCTTCTCCAGTGTCCTGAAGGACTGCGCTGTTATTGAGGGCCAGGATTTTGTGCTGCAGTGCTCCGTACGGGGGACC
CCAGTGCCCCGGATCACTTGGCTGCTGAATGGGCAGCCCATCCAGTACGCTCGCTCCACCTGCGAGGCCGGCGTGGCTGAGCTCCACATC
CAGGATGCCCTGCCGGAGGACCATGGCACCTACACCTGCCTAGCTGAGAATGCCTTGGGGCAGGTGTCCTGCAGCGCCTGGGTCACCGTC
CATGAAAAGAAGAGTAGCAGGAAGAGTGAGTACCTTCTGCCTGTGGCTCCCAGCAAGCCCACTGCACCCATCTTCCTGCAGGGCCTCTCT
GATCTCAAAGTCATGGATGGAAGCCAGGTCACTATGACTGTCCAAGTGTCAGGGAATCCACCCCCTGAAGTCATCTGGCTGCACAATGGG
AATGAGATCCAAGAGTCAGAGGACTTCCACTTTGAACAGAGAGGAACTCAGCACAGCCTTTGTATCCAGGAAGTGTTCCCGGAGGACACG
GGCACGTACACCTGCGAGGCCTGGAACAGCGCTGGAGAGGTCCGCACCCAGGCCGTGCTCACGGTACAAGAGCCTCACGATGGCACCCAG
CCCTGGTTCATCAGTAAGCCTCGCTCAGTGACAGCCTCCCTGGGCCAGAGTGTCCTCATCTCCTGCGCCATAGCTGGTGACCCCTTTCCT
ACCGTGCACTGGCTCAGAGATGGCAAAGCCCTCTGCAAAGACACTGGCCACTTCGAGGTGCTTCAGAATGAGGACGTGTTCACCCTGGTT
CTAAAGAAGGTGCAGCCCTGGCATGCCGGCCAGTATGAGATCCTGCTCAAGAACCGGGTTGGCGAATGCAGTTGCCAGGTGTCACTGATG
CTACAGAACAGCTCTGCCAGAGCCCTTCCACGGGGGAGGGAGCCTGCCAGCTGCGAGGACCTCTGTGGTGGAGGAGTTGGTGCTGATGGT
GGTGGTAGTGACCGCTATGGGTCCCTGAGGCCTGGCTGGCCAGCAAGAGGGCAGGGTTGGCTAGAGGAGGAAGACGGCGAGGACGTGCGA
GGGGTGCTGAAGAGGCGCGTGGAGACGAGGCAGCACACTGAGGAGGCGATCCGCCAGCAGGAGGTGGAGCAGCTGGACTTCCGAGACCTC
CTGGGGAAGAAGGTGAGTACAAAGACCCTATCGGAAGACGACCTGAAGGAGATCCCAGCCGAGCAGATGGATTTCCGTGCCAACCTGCAG
CGGCAAGTGAAGCCAAAGACTGTGTCTGAGGAAGAGAGGAAGGTGCACAGCCCCCAGCAGGTCGATTTTCGCTCTGTCCTGGCCAAGAAG
GGGACTTCCAAGACCCCCGTGCCTGAGAAGGTGCCACCGCCAAAACCTGCCACCCCGGATTTTCGCTCAGTGCTGGGTGGCAAGAAGAAA
TTACCAGCAGAGAATGGCAGCAGCAGTGCCGAGACCCTGAATGCCAAGGCAGTGGAGAGTTCCAAGCCCCTGAGCAATGCACAGCCTTCA
GGGCCCTTGAAACCCGTGGGCAACGCCAAGCCTGCTGAGACCCTGAAGCCAATGGGCAACGCCAAGCCTGCCGAGACCCTGAAGCCCATG
GGCAATGCCAAGCCTGATGAGAACCTGAAATCCGCTAGCAAAGAAGAACTCAAGAAAGACGTTAAGAATGATGTGAACTGCAAGAGAGGC
CATGCAGGGACCACAGATAATGAAAAGAGATCAGAGAGCCAGGGGACAGCCCCAGCCTTCAAGCAGAAGCTGCAAGATGTTCATGTGGCA
GAGGGCAAGAAGCTGCTGCTCCAGTGCCAGGTGTCTTCTGACCCCCCAGCCACCATCATCTGGACGCTGAACGGAAAGACCCTCAAGACC
ACCAAGTTCATCATCCTCTCCCAGGAAGGCTCACTCTGCTCCGTCTCCATCGAGAAGGCACTGCCTGAGGACAGAGGCTTATACAAGTGT
GTAGCCAAGAATGACGCTGGCCAGGCGGAGTGCTCCTGCCAAGTCACCGTGGATGATGCTCCAGCCAGTGAGAACACCAAGGCCCCAGAG
ATGAAATCCCGGAGGCCCAAGAGCTCTCTTCCTCCCGTGCTAGGAACTGAGAGTGATGCGACTGTGAAAAAGAAACCTGCCCCCAAGACA
CCTCCGAAGGCAGCAATGCCCCCTCAGATCATCCAGTTCCCTGAGGACCAGAAGGTACGCGCAGGAGAGTCAGTGGAGCTGTTTGGCAAA
GTGACAGGCACTCAGCCCATCACCTGTACCTGGATGAAGTTCCGAAAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAG
AATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAG
GCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTG
TCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAA
CTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTAT
GGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGAT
GATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTA
GGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCA
AAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAA
AAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGT
GAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAAC
ATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTC
CTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATC
TGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTC
GACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGC
ACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATG
GCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGG
AAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGATAAGTATGCTGTGCGCTTCATCCCTCGGGAG
AATGGCGTTTACCTGATTGACGTCAAGTTCAACGGCACCCACATCCCTGGAAGCCCCTTCAAGATCCGAGTTGGGGAGCCTGGGCATGGA
GGGGACCCAGGCTTGGTGTCTGCTTACGGAGCAGGTCTGGAAGGCGGTGTCACAGGGAACCCAGCTGAGTTCGTCGTGAACACGAGCAAT
GCGGGAGCTGGTGCCCTGTCGGTGACCATTGACGGCCCCTCCAAGGTGAAGATGGATTGCCAGGAGTGCCCTGAGGGCTACCGCGTCACC
TATACCCCCATGGCACCTGGCAGCTACCTCATCTCCATCAAGTACGGCGGCCCCTACCACATTGGGGGCAGCCCCTTCAAGGCCAAAGTC
ACAGGCCCCCGTCTCGTCAGCAACCACAGCCTCCACGAGACATCATCAGTGTTTGTAGACTCTCTGACCAAGGCCACCTGTGCCCCCCAG
CATGGGGCCCCGGGTCCTGGGCCTGCTGACGCCAGCAAGGTGGTGGCCAAGGGCCTGGGGCTGAGCAAGGCCTACGTAGGCCAGAAGAGC
AGCTTCACAGTAGACTGCAGCAAAGCAGGCAACAACATGCTGCTGGTGGGGGTTCATGGCCCAAGGACCCCCTGCGAGGAGATCCTGGTG
AAGCACGTGGGCAGCCGGCTCTACAGCGTGTCCTACCTGCTCAAGGACAAGGGGGAGTACACACTGGTGGTCAAATGGGGGGACGAGCAC
ATCCCAGGCAGCCCCTACCGCGTTGTGGTGCCCTGAGTCTGGGGCCCGTGCCAGCCGGCAGCCCCCAAGCCTGCCCCGCTACCCAAGCAG


Top

FusionGenePPI for MYLK_FLNA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MYLKPRKG2, CALM1, CTTN, PAK1, MLC1, SRC, ALK, MYC, TP53, GOPC, HSPB1, MYH9, PPP1CB, ANLN, MYO19FLNADRD3, ITGB1, VHL, CMIP, AR, TRIO, CASR, BRCA2, FBLIM1, NPHP1, FLNB, ITGB3, ITGB6, DCN, DRD2, F3, ITGB7, TRAF2, RALA, GP1BA, SH2B3, FILIP1, OTUD1, OTUD5, USP45, G3BP1, DMWD, CAMKK2, MAPK14, SRC, APC, BANF1, AGO3, TJP1, HDAC5, SVIL, ARRB1, ARRB2, SIRT7, ISG15, ASB2, CUL3, CDK2, LMNA, SHBG, KCND2, KCNE4, MYH9, LGALS1, ILF2, DBN1, CPLX1, GNN, RANBP2, SRRM2, SRSF11, RBM39, IKBIP, TRA2B, ESR1, BRCA1, ECT2, LIG4, MDC1, TP53BP1, TSGA10, IKBKAP, SMURF1, HSP90AA1, HSP90AB1, BTK, MYC, FN1, VCAM1, IQCB1, GRB2, MTNR1A, SYNPO2, SMAD3, ITGA4, MYBL2, USP19, PAN2, IGSF8, CD81, ICAM1, BSG, NPM1, ADRB2, HNRNPD, AKAP12, DYNC1H1, DYNC1LI1, DYNC1LI2, RPS23, RPA1, RPA2, RPA3, ZBTB1, STAU1, TRIM55, TP53, FABP1, REL, TCF4, HSPB7, ADAMTSL4, LGALS14, KLHL12, FAM101A, CUL7, OBSL1, CCDC8, TXNDC16, FOXRED2, SIRT6, ABCE1, FBXW11, CARD8, FAM90A1, HNRNPA1, ACAD10, DNAAF5, NMD3, PDIA3, PFDN2, PFDN4, PFDN5, VBP1, TDRD15, NTRK1, SELE, HIST1H3E, PPME1, ACTB, ACTG1, ACTN4, AP2A1, AP2B1, ANXA2, CALM1, CAPZA1, CAPZA2, CAPZB, CD44, CD59, CFL1, CFL2, AP2M1, CLTA, CLTB, CLTC, CPM, DAB2, DAPK3, DSG2, CTTN, EPS15, FLII, MYH11, MYO1C, PPP1CB, IQGAP1, PDLIM7, SYNPO, MAPRE1, LIMA1, ANLN, MYO5C, MYO19, MYO18A, FLOT2, GNAI1, GNAS, GNB2, GSN, HMGB2, ITPR3, JUP, ABLIM1, MYO1B, MYO1E, MYO5A, MYO6, PPP1R12A, PALM, PIK3C2A, PLEC, PPP1CA, PPP1CC, TWF1, S100A10, SEC13, FSCN1, UAP1, SPTAN1, SPTBN1, SPTBN2, SSFA2, TMOD1, TPM1, TPM2, TPM4, CORO2A, LUZP1, SORBS2, CLINT1, ARHGAP11A, WDR1, ARPC4, ARPC3, ARPC1B, ACTR3, ACTR2, FLOT1, BASP1, AKAP2, CEP162, PALLD, MPRIP, COBL, CORO1C, PLEKHG3, RAI14, TES, ZBTB20, TMOD3, BMP2K, GNG12, CORO1B, KIAA1211, ARHGAP21, AFAP1, INF2, CYBRD1, ARPC5L, KCTD10, ANTXR1, PPP1R9B, STON2, DIXDC1, SSH2, PHLDB2, NEXN, SPECC1, MISP, CHMP4B, PPP1R18, TPRN, CAMK2G, CRK, MAP3K3, CRY1, CRY2, ALKBH3, MCM2, MCM5, NLGN3, ARFGEF2, CDC73, CDH1, CAPN6, APOH, RAB8B, MTNR1B, CYLD, MCPH1, HEY1, TXNIP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneFLNAchr3:123339054chrX:153578575ENST00000360319-41461490_160723772640furin
TgeneFLNAchr3:123339054chrX:153578575ENST00000369850-43481490_160723852648furin
TgeneFLNAchr3:123339054chrX:153578575ENST00000422373-42471490_160723772640furin


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MYLK_FLNA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneFLNAP21333DB11638ArtenimolFilamin-Asmall moleculeapproved|investigational

Top

RelatedDiseases for MYLK_FLNA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMYLKC0027626Neoplasm Invasiveness2CTD_human
HgeneMYLKC0027627Neoplasm Metastasis2CTD_human
HgeneMYLKC0017178Gastrointestinal Diseases1CTD_human
HgeneMYLKC0017601Glaucoma1CTD_human
HgeneMYLKC0017638Glioma1CTD_human
HgeneMYLKC0020443Hypercholesterolemia1CTD_human
HgeneMYLKC0020517Hypersensitivity1CTD_human
HgeneMYLKC0032285Pneumonia1CTD_human
HgeneMYLKC0042373Vascular Diseases1CTD_human
HgeneMYLKC0242488Acute Lung Injury1CTD_human
HgeneMYLKC1527311Brain Edema1CTD_human
HgeneMYLKC3151077AORTIC ANEURYSM, FAMILIAL THORACIC 71UNIPROT
TgeneFLNAC1848213Periventricular Heterotopia, X-Linked6UNIPROT
TgeneFLNAC0265251Oto-Palato-digital syndrome type 14CTD_human;ORPHANET;UNIPROT
TgeneFLNAC0265293Frontometaphyseal dysplasia4CTD_human;ORPHANET;UNIPROT
TgeneFLNAC1844696OTOPALATODIGITAL SYNDROME, TYPE II4CTD_human;ORPHANET;UNIPROT
TgeneFLNAC0025237Melnick-Needles Syndrome3ORPHANET;UNIPROT
TgeneFLNAC1868720Periventricular Nodular Heterotopia2CTD_human;ORPHANET
TgeneFLNAC0010701Phyllodes Tumor1CTD_human
TgeneFLNAC0014544Epilepsy1CTD_human;HPO
TgeneFLNAC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneFLNAC0029422Osteochondrodysplasias1CTD_human;HPO
TgeneFLNAC0220769FG syndrome1CTD_human
TgeneFLNAC0262436Cardiac valvular dysplasia, X-linked1CTD_human;UNIPROT
TgeneFLNAC1458155Mammary Neoplasms1CTD_human
TgeneFLNAC1845235Heterotopia, Periventricular, Ehlers-Danlos Variant1CTD_human
TgeneFLNAC1845902FG SYNDROME 21UNIPROT