FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23028

FusionGeneSummary for MYH9_SORCS1

check button Fusion gene summary
Fusion gene informationFusion gene name: MYH9_SORCS1
Fusion gene ID: 23028
HgeneTgene
Gene symbol

MYH9

SORCS1

Gene ID

4627

114815

Gene namemyosin heavy chain 9sortilin related VPS10 domain containing receptor 1
SynonymsBDPLT6|DFNA17|EPSTS|FTNS|MHA|NMHC-II-A|NMMHC-IIA|NMMHCAhSorCS
Cytomap

22q12.3

10q25.1

Type of geneprotein-codingprotein-coding
Descriptionmyosin-9cellular myosin heavy chain, type Amyosin, heavy chain 9, non-musclenon-muscle myosin heavy chain 9non-muscle myosin heavy chain Anon-muscle myosin heavy chain IIanon-muscle myosin heavy polypeptide 9nonmuscle myosin heavy chain II-AVPS10 domain-containing receptor SorCS1VPS10 domain receptor protein SORCS 1
Modification date2018052220180519
UniProtAcc

P35579

Q8WY21

Ensembl transtripts involved in fusion geneENST00000216181, ENST00000475726, 
ENST00000401701, 
ENST00000263054, 
ENST00000369698, ENST00000344440, 
ENST00000478809, 
Fusion gene scores* DoF score36 X 33 X 15=178203 X 2 X 3=18
# samples 503
** MAII scorelog2(50/17820*10)=-5.1554254317472
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MYH9 [Title/Abstract] AND SORCS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMYH9

GO:0001525

angiogenesis

16403913

HgeneMYH9

GO:0006509

membrane protein ectodomain proteolysis

16186248

HgeneMYH9

GO:0030048

actin filament-based movement

12237319|15845534

HgeneMYH9

GO:0031032

actomyosin structure organization

24072716


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDREADTCGA-EI-7004-01AMYH9chr22

36701079

-SORCS1chr10

108489872

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000216181ENST00000263054MYH9chr22

36701079

-SORCS1chr10

108489872

-
5CDS-intronENST00000216181ENST00000369698MYH9chr22

36701079

-SORCS1chr10

108489872

-
5CDS-intronENST00000216181ENST00000344440MYH9chr22

36701079

-SORCS1chr10

108489872

-
5CDS-intronENST00000216181ENST00000478809MYH9chr22

36701079

-SORCS1chr10

108489872

-
intron-3CDSENST00000475726ENST00000263054MYH9chr22

36701079

-SORCS1chr10

108489872

-
intron-intronENST00000475726ENST00000369698MYH9chr22

36701079

-SORCS1chr10

108489872

-
intron-intronENST00000475726ENST00000344440MYH9chr22

36701079

-SORCS1chr10

108489872

-
intron-intronENST00000475726ENST00000478809MYH9chr22

36701079

-SORCS1chr10

108489872

-
intron-3CDSENST00000401701ENST00000263054MYH9chr22

36701079

-SORCS1chr10

108489872

-
intron-intronENST00000401701ENST00000369698MYH9chr22

36701079

-SORCS1chr10

108489872

-
intron-intronENST00000401701ENST00000344440MYH9chr22

36701079

-SORCS1chr10

108489872

-
intron-intronENST00000401701ENST00000478809MYH9chr22

36701079

-SORCS1chr10

108489872

-

Top

FusionProtFeatures for MYH9_SORCS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MYH9

P35579

SORCS1

Q8WY21

Cellular myosin that appears to play a role incytokinesis, cell shape, and specialized functions such assecretion and capping. During cell spreading, plays an importantrole in cytoskeleton reorganization, focal contacts formation (inthe margins but not the central part of spreading cells), andlamellipodial retraction; this function is mechanicallyantagonized by MYH10. {ECO:0000269|PubMed:20052411}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYH9chr22:36701079chr10:108489872ENST00000216181-184127_777431961DomainMyosin N-terminal SH3-like
HgeneMYH9chr22:36701079chr10:108489872ENST00000216181-1841174_1817431961Nucleotide bindingATP
HgeneMYH9chr22:36701079chr10:108489872ENST00000216181-1841654_6767431961RegionNote=Actin-binding
TgeneSORCS1chr22:36701079chr10:108489872ENST00000263054-426803_8943191169DomainPKD
TgeneSORCS1chr22:36701079chr10:108489872ENST00000344440-427803_8943191199DomainPKD
TgeneSORCS1chr22:36701079chr10:108489872ENST00000263054-426492_5033191169RepeatNote=BNR 3
TgeneSORCS1chr22:36701079chr10:108489872ENST00000263054-426569_5803191169RepeatNote=BNR 4
TgeneSORCS1chr22:36701079chr10:108489872ENST00000263054-426611_6223191169RepeatNote=BNR 5
TgeneSORCS1chr22:36701079chr10:108489872ENST00000344440-427492_5033191199RepeatNote=BNR 3
TgeneSORCS1chr22:36701079chr10:108489872ENST00000344440-427569_5803191199RepeatNote=BNR 4
TgeneSORCS1chr22:36701079chr10:108489872ENST00000344440-427611_6223191199RepeatNote=BNR 5
TgeneSORCS1chr22:36701079chr10:108489872ENST00000263054-4261121_11683191169Topological domainCytoplasmic
TgeneSORCS1chr22:36701079chr10:108489872ENST00000344440-4271121_11683191199Topological domainCytoplasmic
TgeneSORCS1chr22:36701079chr10:108489872ENST00000263054-4261100_11203191169TransmembraneHelical
TgeneSORCS1chr22:36701079chr10:108489872ENST00000344440-4271100_11203191199TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYH9chr22:36701079chr10:108489872ENST00000216181-1841837_19267431961Coiled coilOntology_term=ECO:0000255
HgeneMYH9chr22:36701079chr10:108489872ENST00000216181-1841779_8087431961DomainIQ
HgeneMYH9chr22:36701079chr10:108489872ENST00000216181-184181_7767431961DomainMyosin motor
TgeneSORCS1chr22:36701079chr10:108489872ENST00000263054-426208_2193191169RepeatNote=BNR 1
TgeneSORCS1chr22:36701079chr10:108489872ENST00000263054-426256_2673191169RepeatNote=BNR 2
TgeneSORCS1chr22:36701079chr10:108489872ENST00000344440-427208_2193191199RepeatNote=BNR 1
TgeneSORCS1chr22:36701079chr10:108489872ENST00000344440-427256_2673191199RepeatNote=BNR 2
TgeneSORCS1chr22:36701079chr10:108489872ENST00000263054-42634_10993191169Topological domainLumenal
TgeneSORCS1chr22:36701079chr10:108489872ENST00000344440-42734_10993191199Topological domainLumenal


Top

FusionGeneSequence for MYH9_SORCS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MYH9_ENST00000216181_chr22_36701079_-_SORCS1_ENST00000263054_chr10_108489872_-_1592aa
MAQQAADKTLTVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELT
CLNEASVLHNLKERYYSGLIYTTSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHITAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQTLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETTLLEKSRAIRQAKE
ERTFHIFTTLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATTERMFRWLVLRINKALDKTKRQGASFIGI
LDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHTAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSET
ALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
TEILTPNSIPKGFMDGKQACVLMVCDGVK_RTRPCAS_GQNCGWSFTLSNLPNAELYRGQQESAFSRLH_PRLFDCSGSLCVCSADIRRA
ATLLRVLPKECICPNEASEICFAQGHACTQHR_ESGVRSGPRMEPE_HVQPLHLRHTWCLLHPGLGECPEQQRP_GQHHDRPL_GSRDKG
NVLG_QED_QPSEDFHHI_QRQRLAFAAGAGHGSKGGPRALLAALLLTTPSPEGL_ESLHIRDHCQQRHSSKHHSGIR_TRF_IVRH_HQ
HVCLFRCREHLETDL_RRAQCFVPGSRWSPGCTETHISPNSTSLVEF__REILEQIQFHITSTFCGWGSG_AWRRDSHHDSVWTLQPPL_
MAAGQSRLQVHF__TVCRRGLQTLAAAQPGGSMTHGSKKDI_EAKIRAEVTARKICRSTGI_TLCLH_G_F_LRLWL_ATQQWPVPAGIL
VQSILSVKGLQLGTELPQ_YWVQEGGFQ_LH_WRKGTVHCQTAEVPRESPAGAADSHG_WKADSGTRTQRHSHGAIRRG_CSADTHPSGL
WRWTRGVLRQSQLHGRWDQTRLSERGHFPCDRAGGQQSGF_QRRPVLTCNLSLGARAPVSSLCHHKEQRGQCDGSAVAQPSGHPHLRVVV
RKQHGAFDHLGGKHILQIYFRRNEYHHSAGLSWECHPTRHKDHRSI_GIPVSSLVLFSKPG_LQPGHP_VEEGHRSSHQKIPGGSHRGSR
PAHPGGGAPWLTHHC_TLCPTLSGSSWRKQKVN__PGADIRIADPHAQPKLSTLRAEARSPSPCPCCSLNSGPPGGPHSNPQWICHADAA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MYH9_ENST00000216181_chr22_36701079_-_SORCS1_ENST00000263054_chr10_108489872_-_4777nt
ATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAG
CTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAG
AATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACG
TGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACACCTATTCAGGCCTGTTCTGTGTGGTC
ATCAATCCTTACAAGAACCTGCCCATCTACTCTGAAGAGATTGTGGAAATGTACAAGGGCAAGAAGAGGCACGAGATGCCCCCTCACATC
TATGCCATCACAGACACCGCCTACAGGAGTATGATGCAAGACCGAGAAGATCAATCCATCTTGTGCACTGGTGAATCTGGAGCTGGCAAG
ACGGAGAACACCAAGAAGGTCATCCAGTATCTGGCGTACGTGGCGTCCTCGCACAAGAGCAAGAAGGACCAGGGCGAGCTGGAGCGGCAG
CTGCTGCAGGCCAACCCCATCCTGGAGGCCTTCGGGAACGCCAAGACCGTGAAGAATGACAACTCCTCCCGCTTCGGCAAATTCATTCGC
ATCAACTTTGATGTCAATGGCTACATTGTTGGAGCCAACATTGAGACTTATCTTTTGGAGAAATCTCGTGCTATCCGCCAAGCCAAGGAA
GAACGGACCTTCCACATCTTCTATTATCTCCTGTCTGGGGCTGGAGAGCACCTGAAGACCGATCTCCTGTTGGAGCCGTACAACAAATAC
CGCTTCCTGTCCAATGGACACGTCACCATCCCCGGGCAGCAGGACAAGGACATGTTCCAGGAGACCATGGAGGCCATGAGGATTATGGGC
ATCCCAGAAGAGGAGCAAATGGGCCTGCTGCGGGTCATCTCAGGGGTTCTTCAGCTCGGCAACATCGTCTTCAAGAAGGAGCGGAACACT
GACCAGGCGTCCATGCCCGACAACACAGCTGCCCAAAAGGTGTCCCATCTCTTGGGTATCAATGTGACCGATTTCACCAGAGGAATCCTC
ACCCCGCGCATCAAGGTGGGACGGGATTACGTCCAGAAGGCGCAGACTAAAGAGCAGGCTGACTTTGCCATCGAGGCCTTGGCCAAGGCG
ACCTATGAGCGGATGTTCCGCTGGCTGGTGCTGCGCATCAACAAGGCTCTGGACAAGACCAAGAGGCAGGGCGCCTCCTTCATCGGGATC
CTGGACATTGCCGGCTTCGAGATCTTTGATCTGAACTCGTTTGAGCAGCTGTGCATCAATTACACCAATGAGAAGCTGCAGCAGCTCTTC
AACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGCCTCGACCTGCAGCCC
TGCATCGACCTCATTGAGAAGCCAGCAGGCCCCCCGGGCATTCTGGCCCTGCTGGACGAGGAGTGCTGGTTCCCCAAAGCCACCGACAAG
AGCTTCGTGGAGAAGGTGATGCAGGAGCAGGGCACCCACCCCAAGTTCCAGAAGCCCAAGCAGCTGAAGGACAAAGCTGATTTCTGCATT
ATCCACTATGCCGGCAAGGTGGATTACAAAGCTGACGAGTGGCTGATGAAGAACATGGATCCCCTGAATGACAACATCGCCACACTGCTC
CACCAGTCCTCTGACAAGTTTGTCTCGGAGCTGTGGAAGGATGTGGACCGCATCATCGGCCTGGACCAGGTGGCCGGCATGTCGGAGACC
GCACTGCCCGGGGCCTTCAAGACGCGGAAGGGCATGTTCCGCACTGTGGGGCAGCTTTACAAGGAGCAGCTGGCCAAGCTGATGGCTACG
CTGAGGAACACGAACCCCAACTTTGTCCGCTGCATCATCCCCAACCACGAGAAGAAGGCCGGCAAGCTGGACCCGCATCTCGTGCTGGAC
CAGCTGCGCTGCAACGGTGTTCTCGAGGGCATCCGTATCTGCCGCCAGGGCTTCCCCAACAGGGTGGTCTTCCAGGAGTTTCGGCAGAGA
TATGAGATCCTGACTCCAAACTCCATTCCCAAGGGTTTCATGGACGGGAAGCAGGCGTGCGTGCTCATGGTCTGTGATGGGGTCAAATAA
AGAACCAGACCTTGTGCATCTTGAGGCCAGAACTGTGGATGGTCATTCACATTATCTAACTTGCCGAATGCAGAACTGTACAGAGGCCAA
CAGGAATCAGCCTTTTCCAGGCTACATTGACCCAGACTCTTTGATTGTTCAGGATCATTATGTGTTTGTTCAGCTGACATCAGGAGGGCG
GCCACATTACTACGTGTCCTACCGAAGGAATGCATTTGCCCAAATGAAGCTTCCGAAATATGCTTTGCCCAAGGACATGCATGTTATCAG
CACCGATGAGAATCAGGTGTTCGCAGCGGTCCAAGAATGGAACCAGAATGACACGTACAACCTCTACATCTCAGACACACGTGGTGTCTA
CTTCACCCTGGCCTTGGAGAATGTCCAGAGCAGCAGAGGCCCTGAGGGCAACATCATGATCGACCTCTATGAGGTAGCAGGGATAAAGGG
AATGTTCTTGGCTAACAAGAAGATTGACAACCAAGTGAAGACTTTCATCACATATAACAAAGGCAGAGACTGGCGTTTGCTGCAGGCGCC
GGACACGGATCTAAGGGGGGACCCCGTGCACTGCTTGCTGCCCTATTGCTCACTACACCTTCACCTGAAGGTCTCTGAGAATCCCTACAC
ATCAGGGATCATTGCCAGCAAAGACACAGCTCCAAGCATCATAGTGGCATCAGGTAATATAGGTTCTGAATTGTCAGACACTGACATCAG
CATGTTTGTCTCTTCAGATGCAGGGAACACCTGGAGACAGATCTTTGAAGAAGAGCACAGTGTTTTGTACCTGGATCAAGGTGGAGTCCT
GGTTGCTATGAAACACACATCTCTCCCAATTCGACATCTTTGGTTGAGTTTTGATGAAGGGAGATCTTGGAGCAAATACAGTTTCACATC
TATTCCACTTTTTGTGGATGGGGTTCTGGGTGAGCCTGGAGAAGAGACTCTCATCATGACAGTGTTTGGACACTTCAGCCACCGCTCTGA
ATGGCAGCTGGTCAAAGTAGATTACAAGTCCATTTTTGATAGACGGTGTGCCGAAGAGGACTACAGACCTTGGCAGCTGCACAGCCAGGG
GGAAGCATGTATCATGGGAGCAAAAAGGATATATAAGAAGCGAAAATCAGAGCGGAAGTGTATGCAAGGAAAATATGCAGGAGCTATGGA
ATCTGAACCCTGTGTCTGCACTGAGGCTGATTTTGATTGCGACTATGGTTATGAGCGACACAGCAATGGCCAGTGCCTGCCGGCATTTTG
GTTCAATCCATCCTCTCTGTCAAAGGATTGCAGCTTGGGACAGAGTTACCTCAATAGTACTGGGTACAGGAAGGTGGTTTCCAATAATTG
CACTGATGGCGTAAGGGAACAGTACACTGCCAAACCGCAGAAGTGCCCAGGGAAAGCCCCGCGGGGGCTGCGGATAGTCACGGCTGATGG
AAAGCTGACAGCGGAACAAGGACACAACGTCACTCTCATGGTGCAATTAGAAGAGGGTGATGTTCAGCGGACACTCATCCAAGTGGACTT
TGGCGATGGTATCGCGGTGTCTTACGTCAATCTCAGCTCCATGGAAGATGGGATCAAACACGTCTATCAGAACGTGGGCATTTTCCGTGT
GACCGTGCAGGTGGACAACAGTCTGGGTTCTGACAGCGCCGTCCTGTACTTACATGTAACTTGTCCCTTGGAGCACGTGCACCTGTCTCT
TCCCTTTGTCACCACAAAGAACAAAGAGGTCAATGCGACGGCAGTGCTGTGGCCCAGCCAAGTGGGCACCCTCACTTACGTGTGGTGGTA
CGGAAACAACACGGAGCCTTTGATCACCTTGGAGGGAAGCATATCCTTCAGATTTACTTCAGAAGGAATGAATACCATCACAGTGCAGGT
CTCAGCTGGGAATGCCATCCTACAAGACACAAAGACCATCGCAGTATATGAGGAATTCCGGTCTCTTCGCTTGTCCTTTTCTCCAAACCT
GGATGACTACAACCCGGACATCCCTGAGTGGAGGAGGGACATCGGTCGAGTCATCAAAAAATCCCTGGTGGAAGCCACAGGGGTTCCAGG
CCAGCACATCCTGGTGGCGGTGCTCCCTGGCTTACCCACCACTGCTGAACTCTTTGTCCTACCCTATCAGGATCCAGCTGGAGAAAACAA
AAGGTCAACTGATGACCTGGAGCAGATATCAGAATTGCTGATCCACACGCTCAACCAAAACTCAGTACACTTCGAGCTGAAGCCAGGAGT
CCGAGTCCTTGTCCATGCTGCTCACTTAACAGCGGCCCCCCTGGTGGACCTCACTCCAACCCACAGTGGATCTGCCATGCTGATGCTGCT
CTCAGTGGTGTTTGTGGGGCTGGCAGTGTTCGTCATCTACAAGTTTAAAAGGAGAGTAGCTTTACCCTCCCCTCCCTCCCCTTCTACTCA
ACCTGGTGACTCATCTCTCCGATTGCAAAGAGCAAGACACGCCACTCCGCCTTCAACGCCAAAGCGGGGATCTGCTGGGGCACAGTATGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MYH9_ENST00000216181_chr22_36701079_-_SORCS1_ENST00000263054_chr10_108489872_-_8765nt
GAGGGCGGGGCGGGAAGGCGGCGAGGAGCCGAGCTGGGTGCGGTGAGGCGCGCAGATCACCGCGGTTCCTGGGCAGGGCACGGAAGGCTA
AGCAAGGCTGACCTGCTGCAGCTCCCGCCTCGTGCGCTCGCCCCACCCGGCCGCCGCCCGAGCGCTCGAGAAAGTCCTCTCGGGAGAAGC
AGCGCCTGTTCCCGGGGCAGATCCAGGTTCAGGTCCTGGCTATAAGTCACCATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGAT
AAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAGCTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCA
GCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAGAATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAG
AAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACGTGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAG
CGTTACTACTCAGGGCTCATCTACACCTATTCAGGCCTGTTCTGTGTGGTCATCAATCCTTACAAGAACCTGCCCATCTACTCTGAAGAG
ATTGTGGAAATGTACAAGGGCAAGAAGAGGCACGAGATGCCCCCTCACATCTATGCCATCACAGACACCGCCTACAGGAGTATGATGCAA
GACCGAGAAGATCAATCCATCTTGTGCACTGGTGAATCTGGAGCTGGCAAGACGGAGAACACCAAGAAGGTCATCCAGTATCTGGCGTAC
GTGGCGTCCTCGCACAAGAGCAAGAAGGACCAGGGCGAGCTGGAGCGGCAGCTGCTGCAGGCCAACCCCATCCTGGAGGCCTTCGGGAAC
GCCAAGACCGTGAAGAATGACAACTCCTCCCGCTTCGGCAAATTCATTCGCATCAACTTTGATGTCAATGGCTACATTGTTGGAGCCAAC
ATTGAGACTTATCTTTTGGAGAAATCTCGTGCTATCCGCCAAGCCAAGGAAGAACGGACCTTCCACATCTTCTATTATCTCCTGTCTGGG
GCTGGAGAGCACCTGAAGACCGATCTCCTGTTGGAGCCGTACAACAAATACCGCTTCCTGTCCAATGGACACGTCACCATCCCCGGGCAG
CAGGACAAGGACATGTTCCAGGAGACCATGGAGGCCATGAGGATTATGGGCATCCCAGAAGAGGAGCAAATGGGCCTGCTGCGGGTCATC
TCAGGGGTTCTTCAGCTCGGCAACATCGTCTTCAAGAAGGAGCGGAACACTGACCAGGCGTCCATGCCCGACAACACAGCTGCCCAAAAG
GTGTCCCATCTCTTGGGTATCAATGTGACCGATTTCACCAGAGGAATCCTCACCCCGCGCATCAAGGTGGGACGGGATTACGTCCAGAAG
GCGCAGACTAAAGAGCAGGCTGACTTTGCCATCGAGGCCTTGGCCAAGGCGACCTATGAGCGGATGTTCCGCTGGCTGGTGCTGCGCATC
AACAAGGCTCTGGACAAGACCAAGAGGCAGGGCGCCTCCTTCATCGGGATCCTGGACATTGCCGGCTTCGAGATCTTTGATCTGAACTCG
TTTGAGCAGCTGTGCATCAATTACACCAATGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAG
CGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGCCTCGACCTGCAGCCCTGCATCGACCTCATTGAGAAGCCAGCAGGCCCCCCGGGC
ATTCTGGCCCTGCTGGACGAGGAGTGCTGGTTCCCCAAAGCCACCGACAAGAGCTTCGTGGAGAAGGTGATGCAGGAGCAGGGCACCCAC
CCCAAGTTCCAGAAGCCCAAGCAGCTGAAGGACAAAGCTGATTTCTGCATTATCCACTATGCCGGCAAGGTGGATTACAAAGCTGACGAG
TGGCTGATGAAGAACATGGATCCCCTGAATGACAACATCGCCACACTGCTCCACCAGTCCTCTGACAAGTTTGTCTCGGAGCTGTGGAAG
GATGTGGACCGCATCATCGGCCTGGACCAGGTGGCCGGCATGTCGGAGACCGCACTGCCCGGGGCCTTCAAGACGCGGAAGGGCATGTTC
CGCACTGTGGGGCAGCTTTACAAGGAGCAGCTGGCCAAGCTGATGGCTACGCTGAGGAACACGAACCCCAACTTTGTCCGCTGCATCATC
CCCAACCACGAGAAGAAGGCCGGCAAGCTGGACCCGCATCTCGTGCTGGACCAGCTGCGCTGCAACGGTGTTCTCGAGGGCATCCGTATC
TGCCGCCAGGGCTTCCCCAACAGGGTGGTCTTCCAGGAGTTTCGGCAGAGATATGAGATCCTGACTCCAAACTCCATTCCCAAGGGTTTC
ATGGACGGGAAGCAGGCGTGCGTGCTCATGGTCTGTGATGGGGTCAAATAAAGAACCAGACCTTGTGCATCTTGAGGCCAGAACTGTGGA
TGGTCATTCACATTATCTAACTTGCCGAATGCAGAACTGTACAGAGGCCAACAGGAATCAGCCTTTTCCAGGCTACATTGACCCAGACTC
TTTGATTGTTCAGGATCATTATGTGTTTGTTCAGCTGACATCAGGAGGGCGGCCACATTACTACGTGTCCTACCGAAGGAATGCATTTGC
CCAAATGAAGCTTCCGAAATATGCTTTGCCCAAGGACATGCATGTTATCAGCACCGATGAGAATCAGGTGTTCGCAGCGGTCCAAGAATG
GAACCAGAATGACACGTACAACCTCTACATCTCAGACACACGTGGTGTCTACTTCACCCTGGCCTTGGAGAATGTCCAGAGCAGCAGAGG
CCCTGAGGGCAACATCATGATCGACCTCTATGAGGTAGCAGGGATAAAGGGAATGTTCTTGGCTAACAAGAAGATTGACAACCAAGTGAA
GACTTTCATCACATATAACAAAGGCAGAGACTGGCGTTTGCTGCAGGCGCCGGACACGGATCTAAGGGGGGACCCCGTGCACTGCTTGCT
GCCCTATTGCTCACTACACCTTCACCTGAAGGTCTCTGAGAATCCCTACACATCAGGGATCATTGCCAGCAAAGACACAGCTCCAAGCAT
CATAGTGGCATCAGGTAATATAGGTTCTGAATTGTCAGACACTGACATCAGCATGTTTGTCTCTTCAGATGCAGGGAACACCTGGAGACA
GATCTTTGAAGAAGAGCACAGTGTTTTGTACCTGGATCAAGGTGGAGTCCTGGTTGCTATGAAACACACATCTCTCCCAATTCGACATCT
TTGGTTGAGTTTTGATGAAGGGAGATCTTGGAGCAAATACAGTTTCACATCTATTCCACTTTTTGTGGATGGGGTTCTGGGTGAGCCTGG
AGAAGAGACTCTCATCATGACAGTGTTTGGACACTTCAGCCACCGCTCTGAATGGCAGCTGGTCAAAGTAGATTACAAGTCCATTTTTGA
TAGACGGTGTGCCGAAGAGGACTACAGACCTTGGCAGCTGCACAGCCAGGGGGAAGCATGTATCATGGGAGCAAAAAGGATATATAAGAA
GCGAAAATCAGAGCGGAAGTGTATGCAAGGAAAATATGCAGGAGCTATGGAATCTGAACCCTGTGTCTGCACTGAGGCTGATTTTGATTG
CGACTATGGTTATGAGCGACACAGCAATGGCCAGTGCCTGCCGGCATTTTGGTTCAATCCATCCTCTCTGTCAAAGGATTGCAGCTTGGG
ACAGAGTTACCTCAATAGTACTGGGTACAGGAAGGTGGTTTCCAATAATTGCACTGATGGCGTAAGGGAACAGTACACTGCCAAACCGCA
GAAGTGCCCAGGGAAAGCCCCGCGGGGGCTGCGGATAGTCACGGCTGATGGAAAGCTGACAGCGGAACAAGGACACAACGTCACTCTCAT
GGTGCAATTAGAAGAGGGTGATGTTCAGCGGACACTCATCCAAGTGGACTTTGGCGATGGTATCGCGGTGTCTTACGTCAATCTCAGCTC
CATGGAAGATGGGATCAAACACGTCTATCAGAACGTGGGCATTTTCCGTGTGACCGTGCAGGTGGACAACAGTCTGGGTTCTGACAGCGC
CGTCCTGTACTTACATGTAACTTGTCCCTTGGAGCACGTGCACCTGTCTCTTCCCTTTGTCACCACAAAGAACAAAGAGGTCAATGCGAC
GGCAGTGCTGTGGCCCAGCCAAGTGGGCACCCTCACTTACGTGTGGTGGTACGGAAACAACACGGAGCCTTTGATCACCTTGGAGGGAAG
CATATCCTTCAGATTTACTTCAGAAGGAATGAATACCATCACAGTGCAGGTCTCAGCTGGGAATGCCATCCTACAAGACACAAAGACCAT
CGCAGTATATGAGGAATTCCGGTCTCTTCGCTTGTCCTTTTCTCCAAACCTGGATGACTACAACCCGGACATCCCTGAGTGGAGGAGGGA
CATCGGTCGAGTCATCAAAAAATCCCTGGTGGAAGCCACAGGGGTTCCAGGCCAGCACATCCTGGTGGCGGTGCTCCCTGGCTTACCCAC
CACTGCTGAACTCTTTGTCCTACCCTATCAGGATCCAGCTGGAGAAAACAAAAGGTCAACTGATGACCTGGAGCAGATATCAGAATTGCT
GATCCACACGCTCAACCAAAACTCAGTACACTTCGAGCTGAAGCCAGGAGTCCGAGTCCTTGTCCATGCTGCTCACTTAACAGCGGCCCC
CCTGGTGGACCTCACTCCAACCCACAGTGGATCTGCCATGCTGATGCTGCTCTCAGTGGTGTTTGTGGGGCTGGCAGTGTTCGTCATCTA
CAAGTTTAAAAGGAGAGTAGCTTTACCCTCCCCTCCCTCCCCTTCTACTCAACCTGGTGACTCATCTCTCCGATTGCAAAGAGCAAGACA
CGCCACTCCGCCTTCAACGCCAAAGCGGGGATCTGCTGGGGCACAGTATGCAATTTAAGGAAAACCCCCAAAGGCTACAGGCGACCTGCT
GATCAGGAAAGAATTTCGCTCTTGTCAAGTACATCATCCTTCATGACCACTAACTTTGTGTTTTTTTTCTTTCCTTTGTTGTTCTGTTTC
CTATTTTGCCAGGAAGTATTTCCATAGTTGCTGAGAATCAAAGCACAAAAGAAATCCCTACCTATGTAAATGTTTGAATGGAGGACGCCA
GTAAAAAAACAAAAACAAAAACAAAACAAAACATAAAATATAAACAATCAAAATCCAAACAAACAAACAAACACTCACTGCATCGGGACT
TTTTAATTCTTCAGACACAGACAACAAGGGTTTTTAGCTTTAAGCCTGTGCATGTGGACAATACTCTGAGAACATGTCTGGAGGGGCAGT
GTACAGGTGCTCTATTTTAATGGAAAACACTCCCCTCTCCCTCTTTCTTCTTCTCTCTCTTTTTTCTGATCGGTCGTGTTTGTAGAAAAT
TCATAACATATATAGGCCAAGGAAATCTGCATGTATTTTTGGAAATATTCTTGGCTCTAGATTTATCAGCTATTTTAGCATTAAAGGCTG
ATGGGTGGATTAGCTACCCCAGCTCCTTTCATAAGACACAAAGACGTGCACAGGAGTTTGAAACCCTGAGCTGTTTCTCTGTTCCACTTT
CCATACTGTCATTTCCCTTCTAAGTTAGCTTTGGTAGCTCTGTTGGTCAGCAGTGGCCACAAGGCTGCTTTCTGCACTCTCTGTGGCCAC
AGGAACAAAGATGCGAGTTGAAGATCCCTTTGTGCCGGTAGAATAAGGAAGGAAGGGAGGCAGGGAGGCAAAGCATGTCAGAAACGGACC
TTGGTTTCCTGTTCACCTCTTTCCACCATGATTGCCTCCCCTTGCAGCTTTCCCTACTCCTGCCCCAACTGCAGTAGGAAATGGAATCCC
ATTAGTTACCCATTGTCCTGTCTTCACATTTGTTTGTCATCCATGTGTGACCATGATCTGTTGATATCTTTGAATCTCTTCCCTCCAAAC
CCCAAGTAAGTTGTCCTTCAACTGTTCTCAGTTTTTCTTCCCAAACATATTGCTAGATTCTGGACATTAACCCTGACGTTTCCTAAATAC
TGGCCTGGCCTGTGCCGCCCCTGCCCCCACTACTCACAAGTTTCTGAGCCCTTTGTCAGTTTTGTACATTCCCAAGCATGCCAGCTTCTG
TGCCCATGGACCTTGCTGCATCCTGCACAGCAGGGTTCAGTTTCATGTATCTTTGTCTTTTCCTCTAGAACCTGCCTTTTTCAAATATCC
CTGCCTTTTCCCACCTGGAAACATATACTGTATGCGAAAGAGTTGATATATGCAAAGTAATTCAAACCTGGCCATGTACTTTGGAAAAGA
AAGCATAGAGATGAATTGTGGTGTTCTCACACCTTAACGAAAATCTCGTGCGATCTGATTCCAGAAGATTCTTGTGAGAAATGTTTTGAA
TGTGTGACAATTTCGCAGGGCAATTTCCTCCTGTGACGGTTGCTGTTACCTGGTATTTCCACTCTCACAGTAGAATAGAAATGTTTGTGA
AATAAAACTGATTTTAACTGGAAGGAGAAACAGGTTAATGGACTTTGTGTTTAAGAGTGTCAAACAGTCTGAGAGAATAAATGGGGGTCT
TGTCTTACATTAGGGTGAGAGTTTGATTATTTAGGATGATCCCAGTGATTTCATGTGTGCTCTCTGACCTCTGAGTATCATAGTATCATT
AAAGTAAAGATTTAAGTCTGTATAAAGGAGGAGAGTTACTGATTGGCAAAAAAGATTGGCACAAAGCATGAAGAAACCCCATTTTTCCCA
GGGTAATCATGAAAGAAGGCTCAGAGAAAGAGGGAAACAAAAGCCTGTTCAGCAGAGGCCCCTTTAGTATTATGGACTGGGCAAAGCCCA
CTATAAACTATAGGAGAAAGAAGTTCTGATAAACCTCTTAGTATGCTCAGCCTCCTTCTTTGCTATGTCCCTAAGCCAACAGGGTATAAC
ACAGGCCCTGGTGATAATGAGGGTGTCCTAAAGATCCTGATGTCCATGACTTCATGTAGTTCAGGCACAGAAAGAATAGCAAAGCTGCTG
TCAGAAGTTTGTCAGGCAGAGATGTTTATGGTTGAGGATACCCCATATGAATCTGGGAAATGGGCTAGGCCTGAGGCAGTCACCTATTTG
TAGAACTCAATTGATCCCCAACCTGCCAGGCTTCCTATCTCATAGGAAACATCCTCATTGATCCTCTTCAGTTGGAGTCTCCCAAATTTA
ATGTGGAAGACAAAGTGTTGGAAAATCAAAAGAGGCTCACTCAAACCAGCACAGGGAGTCCTCAGAGTTGCAGTTCAATTCATTTTAATT
AGAAAAGTATGAAAGAGGTATAACACTCTTATTCTAGCACAGTGCCTTGCCTAGAGTAGTAGTATGAAAACTATTTGTTGAAGAAATAAA
TGAATGGAAAGACATAGGGAAGAATGGGCTGTAAATCCTAATTAAAAATAGAGGTCGACATGAGATACCTGGCATTTTGGGAAGTGACCA
AAGATGGCCAGCTAGAGATTCAGCATCTCCAGGATCCTCATGTGCCTCTCCTCAAAGCTCCCTCCCATCTGTAGGAGATTAGTGAGGCAA
GGTGCTGCTCAGAGAGGAGGACCTCATTGTTCTTAGGACCTTGGCCAGTTGTTCTCAAAGTGTGGTACCTGGATCAGCAGTATCACTATC
ACTTGGGCTAGTTAGAGATCCAGATTCTGGATCCATACCCCATACCTACTGAATTAGAAACTCTAGGGGATGAATAGTGGTGTTCTCTGT
TGCTAAGTGACAGTGGGCCCAGCCACCTATTTTAACAAGCCCTCCCAGTGATTGTGATACATACTAAAGTTTGAGAACCATTGTACTAGG
CCATTCCAGCTGAATCTCAAACAGAAGGCAGTAATGAGAGCCTACAAATGGGAGGGACCTAAGTGCCTACCTACTCGCTAATCGCAGGTG
CAAACACACAAGGAGTTTGGTGGGCTTAAGGTCAGAGGAGTGTGTAGGGAGGGATGTATGTGGAAGGTAAGATTCAGGGCAAGCTAAAAA
TCCGATACTGCAACGTTTTCCAAAATCCCAGAAGGCAAACTGTGCATGTTCTACCCTGAACCACCCAAGCAACACTTTCTACCTTGCCTT
ATTTTTAATTGGATTCACTGTCCAAAATGCAGAGGTTTGCTTTGCTTTTTTTTCAGAAGTTCCAAACAGCAACTTTGAGAGCAGTGGGGT
GCTTGGCAGCTGTTCTGTGTTTTCCAGGAATCCAACTGAGCATTGAAATCTCTCATTTGCCGACTTATTTTTATAGGAAGCCAATTAAAA
AAAAAAAAAGTTTTCTTATAGTATTGGAACTACTTCTAATTTTAAAATGACTTTTTTGATGTATTTTTTGTTAAATACTATGTAGTGTAA
TGTATAATTGCTCTTGTTTATTGCTTTTACAATCATATTTATTAAACAGATAATGTCTCTAAAGTCTTTGCCTCAGGTATTTTTTTTTTT
AATCCTAAACCCTTGGTGTTCATTCTAAATATAGAAGTGTTGCATGTATAGGATTTCATAAAGGCTAATTGCATAAGAAAGAGTAAACAC
CACAGGCTTGAGGTTTTTGGCTGTTTTTTACTAACAAGGCAGAATGTATGTACTACCTGAATTCTACCTGCATTTCAATTAACTATACAA


Top

FusionGenePPI for MYH9_SORCS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MYH9EPB41, MARK4, ASCC2, MYL9, PRKCE, USP1, USP45, GRB2, RAC1, YWHAZ, EMD, TERF1, TERF2, CBL, PPP2R4, AGO3, YWHAQ, MME, HDAC5, NCOA3, CREBBP, UBE3A, ARRB1, ARRB2, SIRT7, TRAF4, SP1, ISG15, FBXO25, CDK2, CUL1, TRIM72, GRK5, UBASH3B, PIK3R2, SHC1, MYL6, SPTAN1, HSP90AB1, ACTA2, MYH10, HNRNPU, FLNA, ACTR1A, RAB11A, EIF4B, SEL1L, ATP5A1, SEPT7, RALA, HSPA5, TUBA4A, EIF3A, EIF3C, TPM4, MRPS18B, PSME3, HSPA1A, ESR1, TSGA10, EIF4A3, MAGOH, TRAF3IP1, MEN1, HSP90AA1, VCAM1, FN1, IQCB1, ITGA4, PAN2, ACE, ACTB, CSNK2A1, PIK3C3, PPP2CA, CASP4, TARDBP, AKAP10, CDC73, MYH14, OTUD6B, MYL12A, RPA1, RPA2, RPA3, LGR4, IVNS1ABP, TP53, HUWE1, ALK, UBE2I, EED, AMFR, OS9, SYVN1, ATG9A, USP7, HNRNPA1, ATP5L, MYO1E, SRSF5, SSB, NTRK1, ACTA1, ACTG1, ACTN4, ACTN1, AP2A1, AP2B1, ANXA2, APOB, DST, CALD1, CALM1, CALML3, CAPZA1, CAPZA2, CAPZB, CD44, CFL1, CFL2, AP2M1, CLTA, CLTB, CLTC, CPM, DAB2, DAPK3, DBN1, DSG2, CTTN, STOM, EPS15, FLII, FLNB, FYN, GNAI1, GNAI2, GNAS, GNB2, GSN, HIP1, ITPR2, ITPR3, JUP, LGALS1, ABLIM1, LMO7, LSS, LYN, MYO1B, MSN, PDLIM7, ANLN, MYO19, MYO18A, MYLK, MYO1C, MYO5A, MYO5B, MYO6, PPP1R12A, PPP1R12B, NAP1L1, PAWR, PIK3C2A, PLEC, PLS1, PPIA, PPP1CA, PPP1CB, PPP1CC, PSMB10, TWF1, PEX5, RPL22, SIPA1, SORD, SPTBN1, SPTBN2, SSFA2, ST5, SVIL, TCEA2, TMOD1, TNFAIP1, TPM1, TPM2, TPM3, CORO2A, YES1, LUZP1, PICALM, PIP5K1A, SORBS2, IQGAP1, HIP1R, GPRC5A, LRRFIP2, CLINT1, ARHGAP11A, ARHGEF17, SEC16A, WDR1, ARPC4, ARPC3, ARPC1B, ACTR3, ACTR2, ARPC2, BCAP31, FLOT1, BASP1, IMMT, RBPMS, DSTN, TRIOBP, CEP250, AKAP2, TWF2, SYNPO, CEP162, LIMCH1, PALLD, SIPA1L3, MPRIP, COBL, KIF13B, SPECC1L, ATP13A2, MACF1, CORO1C, STX12, GCA, PLEKHG3, RAI14, ZBTB20, AHDC1, PACSIN3, TMOD3, PNMA3, FCF1, CEP83, LIMA1, GTSE1, KDM3B, UACA, CDCA8, BMP2K, UNC45A, MYO5C, GNG12, MUC13, CORO1B, MICAL3, ARHGAP21, SHROOM3, AFAP1, INF2, NARFL, METTL17, AHNAK, EFHD2, CYBRD1, WDR76, DSN1, RNF170, TRIM56, ARPC5L, ANTXR1, LZTS2, PPP1R9B, CEP89, STON2, DOCK7, DIXDC1, SSH2, NEXN, ELMSAN1, SPECC1, CCDC102A, FCHO2, MISP, JMY, CD109, ACTRT1, MYL6B, CCDC50, OARD1, GAS2L3, TTLL6, TPRN, ACTBL2, MCM2, MCM5, SNW1, CDC5L, BOP1, PES1, EGFR, CDH1, C9orf156, MYL3, H2AFY, CYLD, TRIM25, BRCA1, HDAC6SORCS1SORT1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MYH9_SORCS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneMYH9P35579DB11638ArtenimolMyosin-9small moleculeapproved|investigational

Top

RelatedDiseases for MYH9_SORCS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMYH9C0403445Fechtner syndrome (disorder)9UNIPROT
HgeneMYH9C0398641Epstein syndrome (disorder)7UNIPROT
HgeneMYH9C0340978May-Hegglin anomaly6UNIPROT
HgeneMYH9C0022661Kidney Failure, Chronic2CTD_human
HgeneMYH9C1854520SEBASTIAN SYNDROME2CTD_human;ORPHANET;UNIPROT
HgeneMYH9C0017668Focal glomerulosclerosis1CTD_human
HgeneMYH9C0020544Renal hypertension1CTD_human
HgeneMYH9C0027706Hereditary nephritis1CTD_human
HgeneMYH9C0036341Schizophrenia1PSYGENET
HgeneMYH9C1863659DEAFNESS, AUTOSOMAL DOMINANT 171UNIPROT
HgeneMYH9C2673482Increased susceptibility to schizophrenia1PSYGENET