FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23008

FusionGeneSummary for MYH9_EMID1

check button Fusion gene summary
Fusion gene informationFusion gene name: MYH9_EMID1
Fusion gene ID: 23008
HgeneTgene
Gene symbol

MYH9

EMID1

Gene ID

4627

129080

Gene namemyosin heavy chain 9EMI domain containing 1
SynonymsBDPLT6|DFNA17|EPSTS|FTNS|MHA|NMHC-II-A|NMMHC-IIA|NMMHCAEMI5|EMU1
Cytomap

22q12.3

22q12.2

Type of geneprotein-codingprotein-coding
Descriptionmyosin-9cellular myosin heavy chain, type Amyosin, heavy chain 9, non-musclenon-muscle myosin heavy chain 9non-muscle myosin heavy chain Anon-muscle myosin heavy chain IIanon-muscle myosin heavy polypeptide 9nonmuscle myosin heavy chain II-AEMI domain-containing protein 1emilin and multimerin domain-containing protein 1
Modification date2018052220180523
UniProtAcc

P35579

Q96A84

Ensembl transtripts involved in fusion geneENST00000216181, ENST00000475726, 
ENST00000401701, 
ENST00000334018, 
ENST00000404820, ENST00000404755, 
ENST00000484039, 
Fusion gene scores* DoF score36 X 33 X 15=178205 X 3 X 5=75
# samples 505
** MAII scorelog2(50/17820*10)=-5.1554254317472
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MYH9 [Title/Abstract] AND EMID1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMYH9

GO:0001525

angiogenesis

16403913

HgeneMYH9

GO:0006509

membrane protein ectodomain proteolysis

16186248

HgeneMYH9

GO:0030048

actin filament-based movement

12237319|15845534

HgeneMYH9

GO:0031032

actomyosin structure organization

24072716


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-25-2398-01AMYH9chr22

36744949

-EMID1chr22

29610915

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000216181ENST00000334018MYH9chr22

36744949

-EMID1chr22

29610915

+
In-frameENST00000216181ENST00000404820MYH9chr22

36744949

-EMID1chr22

29610915

+
In-frameENST00000216181ENST00000404755MYH9chr22

36744949

-EMID1chr22

29610915

+
5CDS-intronENST00000216181ENST00000484039MYH9chr22

36744949

-EMID1chr22

29610915

+
intron-3CDSENST00000475726ENST00000334018MYH9chr22

36744949

-EMID1chr22

29610915

+
intron-3CDSENST00000475726ENST00000404820MYH9chr22

36744949

-EMID1chr22

29610915

+
intron-3CDSENST00000475726ENST00000404755MYH9chr22

36744949

-EMID1chr22

29610915

+
intron-intronENST00000475726ENST00000484039MYH9chr22

36744949

-EMID1chr22

29610915

+
In-frameENST00000401701ENST00000334018MYH9chr22

36744949

-EMID1chr22

29610915

+
In-frameENST00000401701ENST00000404820MYH9chr22

36744949

-EMID1chr22

29610915

+
In-frameENST00000401701ENST00000404755MYH9chr22

36744949

-EMID1chr22

29610915

+
5CDS-intronENST00000401701ENST00000484039MYH9chr22

36744949

-EMID1chr22

29610915

+

Top

FusionProtFeatures for MYH9_EMID1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MYH9

P35579

EMID1

Q96A84

Cellular myosin that appears to play a role incytokinesis, cell shape, and specialized functions such assecretion and capping. During cell spreading, plays an importantrole in cytoskeleton reorganization, focal contacts formation (inthe margins but not the central part of spreading cells), andlamellipodial retraction; this function is mechanicallyantagonized by MYH10. {ECO:0000269|PubMed:20052411}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYH9chr22:36744949chr22:29610915ENST00000216181-24127_771111961DomainMyosin N-terminal SH3-like
TgeneEMID1chr22:36744949chr22:29610915ENST00000334018+015179_36833444DomainNote=Collagen-like
TgeneEMID1chr22:36744949chr22:29610915ENST00000334018+01533_10633444DomainEMI

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYH9chr22:36744949chr22:29610915ENST00000216181-241837_19261111961Coiled coilOntology_term=ECO:0000255
HgeneMYH9chr22:36744949chr22:29610915ENST00000216181-241779_8081111961DomainIQ
HgeneMYH9chr22:36744949chr22:29610915ENST00000216181-24181_7761111961DomainMyosin motor
HgeneMYH9chr22:36744949chr22:29610915ENST00000216181-241174_1811111961Nucleotide bindingATP
HgeneMYH9chr22:36744949chr22:29610915ENST00000216181-241654_6761111961RegionNote=Actin-binding


Top

FusionGeneSequence for MYH9_EMID1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MYH9_ENST00000216181_chr22_36744949_-_EMID1_ENST00000334018_chr22_29610915_+_521aa
MAQQAADKTLTVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELT
CLNEASVLHNLKERYYSGLIYELVLLCGDPHHLMPCAEWHLPSASAAELPLAHELSGEQLQNCGETHIQGDVQDSDRP_VEVLPWALRSE
LRGSCSFLCLLGAHVVGQYHAADGASAHSLLRLSQLQQSVRADRAAEGAGGQDDHADCHRAASTSNTSYP_GPCPALGSPSCPGQPRRWR
PPGPSRCLGASRAHRPQGRCRQSGPNGDERPTRSTGPPREPWPGWSCGHPWREGTSWATRASWPPWAPSPCWATPCPDLPAWRPIAVQHL
H_DQQPLAPGTHWASRPSRAHGSPWASWPHRCPWESWSHRTPRPHWTQRNLWPPRREGRERTAWGAWPPRLCWAAGGTWP_GRPW_EEPL

>In-frame_MYH9_ENST00000216181_chr22_36744949_-_EMID1_ENST00000404820_chr22_29610915_+_523aa
MAQQAADKTLTVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELT
CLNEASVLHNLKERYYSGLIYELVLLCGDPHHLMPCAEWHLPSASAAELPLAHELSGEQLQNCGETHIQGDVQDSDRP_VEVLPWALRSE
LRGSCSFLCLLGAHVVGQYHAADGASAHSLLRLSQLQQSVRADRAAEGAGGQDDHADCHRAASTSNTSYP_GPCPALGSPSCPGQPRRWR
PPGPSRCLGASRAHRPQGRCRQSGPNGDERPTRSTGPPREPWPGWSCGHPWREGTSWATRASWPPWAPSPCWATPCPDLPAWRPIAVQHL
H_DQQPLAPGTHWASRPSRAHGSPWASWPHRCPWESWSHRTPRPHWTQRNLWPPRREGRERTAWGAWPPRLCWAAGGTWP_GRPW_EEPL

>In-frame_MYH9_ENST00000216181_chr22_36744949_-_EMID1_ENST00000404755_chr22_29610915_+_500aa
MAQQAADKTLTVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELT
CLNEASVLHNLKERYYSGLIYELVLLCGDPHHLMPCAEWHLPSASAAELPLAHELSGEQLQNCGETHIQGDVQDSDRP_VEVLPWALRSE
LRGSCSFLCLLGAHVVGQYHAADGASAHSLLRLSQLQQSVRADRAAEGAGGQDDHADCHRAASTSNTSYP_GPCPALGSPSCPGQPRRWR
PPGPSRCLGASRAHRPQGRCRQSGPNGDERPTRSTGPPREPWPGWSCGHPWREGTSWATRASWPPWAPSPCWATPCPDLPAWRPIAVQHL
H_DQQPLAPGTHWASRPSRAHGSPWASWPHRCPWESWSHRTAWGAWPPRLCWAAGGTWP_GRPW_EEPLGGGVAPATRGFEDFS_EGFNL

>In-frame_MYH9_ENST00000401701_chr22_36744949_-_EMID1_ENST00000334018_chr22_29610915_+_521aa
MAQQAADKTLTVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELT
CLNEASVLHNLKERYYSGLIYELVLLCGDPHHLMPCAEWHLPSASAAELPLAHELSGEQLQNCGETHIQGDVQDSDRP_VEVLPWALRSE
LRGSCSFLCLLGAHVVGQYHAADGASAHSLLRLSQLQQSVRADRAAEGAGGQDDHADCHRAASTSNTSYP_GPCPALGSPSCPGQPRRWR
PPGPSRCLGASRAHRPQGRCRQSGPNGDERPTRSTGPPREPWPGWSCGHPWREGTSWATRASWPPWAPSPCWATPCPDLPAWRPIAVQHL
H_DQQPLAPGTHWASRPSRAHGSPWASWPHRCPWESWSHRTPRPHWTQRNLWPPRREGRERTAWGAWPPRLCWAAGGTWP_GRPW_EEPL

>In-frame_MYH9_ENST00000401701_chr22_36744949_-_EMID1_ENST00000404820_chr22_29610915_+_523aa
MAQQAADKTLTVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELT
CLNEASVLHNLKERYYSGLIYELVLLCGDPHHLMPCAEWHLPSASAAELPLAHELSGEQLQNCGETHIQGDVQDSDRP_VEVLPWALRSE
LRGSCSFLCLLGAHVVGQYHAADGASAHSLLRLSQLQQSVRADRAAEGAGGQDDHADCHRAASTSNTSYP_GPCPALGSPSCPGQPRRWR
PPGPSRCLGASRAHRPQGRCRQSGPNGDERPTRSTGPPREPWPGWSCGHPWREGTSWATRASWPPWAPSPCWATPCPDLPAWRPIAVQHL
H_DQQPLAPGTHWASRPSRAHGSPWASWPHRCPWESWSHRTPRPHWTQRNLWPPRREGRERTAWGAWPPRLCWAAGGTWP_GRPW_EEPL

>In-frame_MYH9_ENST00000401701_chr22_36744949_-_EMID1_ENST00000404755_chr22_29610915_+_500aa
MAQQAADKTLTVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELT
CLNEASVLHNLKERYYSGLIYELVLLCGDPHHLMPCAEWHLPSASAAELPLAHELSGEQLQNCGETHIQGDVQDSDRP_VEVLPWALRSE
LRGSCSFLCLLGAHVVGQYHAADGASAHSLLRLSQLQQSVRADRAAEGAGGQDDHADCHRAASTSNTSYP_GPCPALGSPSCPGQPRRWR
PPGPSRCLGASRAHRPQGRCRQSGPNGDERPTRSTGPPREPWPGWSCGHPWREGTSWATRASWPPWAPSPCWATPCPDLPAWRPIAVQHL
H_DQQPLAPGTHWASRPSRAHGSPWASWPHRCPWESWSHRTAWGAWPPRLCWAAGGTWP_GRPW_EEPLGGGVAPATRGFEDFS_EGFNL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MYH9_ENST00000216181_chr22_36744949_-_EMID1_ENST00000334018_chr22_29610915_+_1564nt
ATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAG
CTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAG
AATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACG
TGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCG
CACCATCTCATGCCATGTGCAGAATGGCACCTACCTTCAGCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTA
CAGAACTGTGGTGAGACCCACATACAAGGTGATGTACAAGATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAG
CTGCGAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCCCATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTT
CTCAGGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGACAGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGA
GCAGCCAGTACCTCCAACACCAGCTACCCCTGAGGACCCTGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGG
CCTCCAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCCCACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGG
CCCACCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCGGGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGG
GCCTCCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCCACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTT
CACTGAGACCAACAACCACTGGCCCCAGGGACCCACTGGGCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCAC
AGGTGTCCCTGGGAGTCCTGGTCACATAGGACCCCCAGGCCCCACTGGACCCAAAGGAATCTCTGGCCACCCAGGAGAGAAGGGCGAGAG
AGGACTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAAGGGAGACCCTGGTGAGAAGAGCCACTG
GGGGGAGGGGTTGCACCAGCTACGCGAGGCTTTGAAGATTTTAGCTGAGAGGGTTTTAATCTTGGAAACAATGATTGGGCTCTATGAACC
AGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAGGGGCGGACATGCAACCAACTACCGGAT

>In-frame_MYH9_ENST00000216181_chr22_36744949_-_EMID1_ENST00000404820_chr22_29610915_+_1570nt
ATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAG
CTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAG
AATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACG
TGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCG
CACCATCTCATGCCATGTGCAGAATGGCACCTACCTTCAGCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTA
CAGAACTGTGGTGAGACCCACATACAAGGTGATGTACAAGATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAG
CTGCGAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCCCATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTT
CTCAGGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGACAGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGA
GCAGCCAGTACCTCCAACACCAGCTACCCCTGAGGACCCTGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGG
CCTCCAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCCCACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGG
CCCACCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCGGGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGG
GCCTCCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCCACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTT
CACTGAGACCAACAACCACTGGCCCCAGGGACCCACTGGGCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCAC
AGGTGTCCCTGGGAGTCCTGGTCACATAGGACCCCCAGGCCCCACTGGACCCAAAGGAATCTCTGGCCACCCAGGAGAGAAGGGCGAGAG
AGGACTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAAGGGAGACCCTGGTGAGAAGAGCCACTG
GGCTCCTAGCTTACAGAGCTTCCTGCAGCAGCAGGCTCAGCTGGAGCTCCTGGCCAGACGGGTCACCCTCCTGGAAGCCATCATCTGGCC
AGAACCAGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAGGGGCGGACATGCAACCAACTA

>In-frame_MYH9_ENST00000216181_chr22_36744949_-_EMID1_ENST00000404755_chr22_29610915_+_1501nt
ATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAG
CTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAG
AATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACG
TGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCG
CACCATCTCATGCCATGTGCAGAATGGCACCTACCTTCAGCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTA
CAGAACTGTGGTGAGACCCACATACAAGGTGATGTACAAGATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAG
CTGCGAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCCCATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTT
CTCAGGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGACAGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGA
GCAGCCAGTACCTCCAACACCAGCTACCCCTGAGGACCCTGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGG
CCTCCAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCCCACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGG
CCCACCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCGGGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGG
GCCTCCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCCACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTT
CACTGAGACCAACAACCACTGGCCCCAGGGACCCACTGGGCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCAC
AGGTGTCCCTGGGAGTCCTGGTCACATAGGACTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAA
GGGAGACCCTGGTGAGAAGAGCCACTGGGGGGAGGGGTTGCACCAGCTACGCGAGGCTTTGAAGATTTTAGCTGAGAGGGTTTTAATCTT
GGAAACAATGATTGGGCTCTATGAACCAGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAG

>In-frame_MYH9_ENST00000401701_chr22_36744949_-_EMID1_ENST00000334018_chr22_29610915_+_1564nt
ATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAG
CTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAG
AATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACG
TGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCG
CACCATCTCATGCCATGTGCAGAATGGCACCTACCTTCAGCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTA
CAGAACTGTGGTGAGACCCACATACAAGGTGATGTACAAGATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAG
CTGCGAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCCCATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTT
CTCAGGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGACAGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGA
GCAGCCAGTACCTCCAACACCAGCTACCCCTGAGGACCCTGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGG
CCTCCAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCCCACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGG
CCCACCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCGGGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGG
GCCTCCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCCACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTT
CACTGAGACCAACAACCACTGGCCCCAGGGACCCACTGGGCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCAC
AGGTGTCCCTGGGAGTCCTGGTCACATAGGACCCCCAGGCCCCACTGGACCCAAAGGAATCTCTGGCCACCCAGGAGAGAAGGGCGAGAG
AGGACTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAAGGGAGACCCTGGTGAGAAGAGCCACTG
GGGGGAGGGGTTGCACCAGCTACGCGAGGCTTTGAAGATTTTAGCTGAGAGGGTTTTAATCTTGGAAACAATGATTGGGCTCTATGAACC
AGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAGGGGCGGACATGCAACCAACTACCGGAT

>In-frame_MYH9_ENST00000401701_chr22_36744949_-_EMID1_ENST00000404820_chr22_29610915_+_1570nt
ATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAG
CTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAG
AATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACG
TGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCG
CACCATCTCATGCCATGTGCAGAATGGCACCTACCTTCAGCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTA
CAGAACTGTGGTGAGACCCACATACAAGGTGATGTACAAGATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAG
CTGCGAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCCCATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTT
CTCAGGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGACAGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGA
GCAGCCAGTACCTCCAACACCAGCTACCCCTGAGGACCCTGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGG
CCTCCAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCCCACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGG
CCCACCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCGGGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGG
GCCTCCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCCACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTT
CACTGAGACCAACAACCACTGGCCCCAGGGACCCACTGGGCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCAC
AGGTGTCCCTGGGAGTCCTGGTCACATAGGACCCCCAGGCCCCACTGGACCCAAAGGAATCTCTGGCCACCCAGGAGAGAAGGGCGAGAG
AGGACTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAAGGGAGACCCTGGTGAGAAGAGCCACTG
GGCTCCTAGCTTACAGAGCTTCCTGCAGCAGCAGGCTCAGCTGGAGCTCCTGGCCAGACGGGTCACCCTCCTGGAAGCCATCATCTGGCC
AGAACCAGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAGGGGCGGACATGCAACCAACTA

>In-frame_MYH9_ENST00000401701_chr22_36744949_-_EMID1_ENST00000404755_chr22_29610915_+_1501nt
ATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAG
CTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAG
AATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACG
TGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCG
CACCATCTCATGCCATGTGCAGAATGGCACCTACCTTCAGCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTA
CAGAACTGTGGTGAGACCCACATACAAGGTGATGTACAAGATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAG
CTGCGAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCCCATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTT
CTCAGGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGACAGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGA
GCAGCCAGTACCTCCAACACCAGCTACCCCTGAGGACCCTGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGG
CCTCCAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCCCACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGG
CCCACCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCGGGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGG
GCCTCCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCCACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTT
CACTGAGACCAACAACCACTGGCCCCAGGGACCCACTGGGCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCAC
AGGTGTCCCTGGGAGTCCTGGTCACATAGGACTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAA
GGGAGACCCTGGTGAGAAGAGCCACTGGGGGGAGGGGTTGCACCAGCTACGCGAGGCTTTGAAGATTTTAGCTGAGAGGGTTTTAATCTT
GGAAACAATGATTGGGCTCTATGAACCAGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MYH9_ENST00000216181_chr22_36744949_-_EMID1_ENST00000334018_chr22_29610915_+_2448nt
GAGGGCGGGGCGGGAAGGCGGCGAGGAGCCGAGCTGGGTGCGGTGAGGCGCGCAGATCACCGCGGTTCCTGGGCAGGGCACGGAAGGCTA
AGCAAGGCTGACCTGCTGCAGCTCCCGCCTCGTGCGCTCGCCCCACCCGGCCGCCGCCCGAGCGCTCGAGAAAGTCCTCTCGGGAGAAGC
AGCGCCTGTTCCCGGGGCAGATCCAGGTTCAGGTCCTGGCTATAAGTCACCATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGAT
AAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAGCTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCA
GCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAGAATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAG
AAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACGTGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAG
CGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCGCACCATCTCATGCCATGTGCAGAATGGCACCTACCTTCA
GCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTACAGAACTGTGGTGAGACCCACATACAAGGTGATGTACAA
GATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAGCTGCGAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCC
CATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTTCTCAGGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGAC
AGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGAGCAGCCAGTACCTCCAACACCAGCTACCCCTGAGGACCC
TGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGGCCTCCAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCC
CACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGGCCCACCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCG
GGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGGGCCTCCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCC
ACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTTCACTGAGACCAACAACCACTGGCCCCAGGGACCCACTGG
GCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCACAGGTGTCCCTGGGAGTCCTGGTCACATAGGACCCCCAGG
CCCCACTGGACCCAAAGGAATCTCTGGCCACCCAGGAGAGAAGGGCGAGAGAGGACTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGG
GCAGCGGGGGGAACCTGGCCCTAAGGGAGACCCTGGTGAGAAGAGCCACTGGGGGGAGGGGTTGCACCAGCTACGCGAGGCTTTGAAGAT
TTTAGCTGAGAGGGTTTTAATCTTGGAAACAATGATTGGGCTCTATGAACCAGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCAC
CCCCAGCCTCCTTCGGGGCAAGAGGGGCGGACATGCAACCAACTACCGGATCGTGGCCCCCAGGAGCCGGGACGAGAGAGGCTGAGGGTG
GTGGCGGCCCCTGAGGCAGACCAGGCCAGGCTTCCCCTCCTACCTGGACTCGGCCAGCTGCCTCCAGGGACCGCCCGTCCATATTTATTA
ATGTCCTCAGGGTCCCTTCTGCCATCTAGGCCTTAGGGGTAAGCAGGTCTCAGTCCTGGCACCATGCACATGTCTGAGGCTGAGCAAGGG
CTGAGAGGAGAGGCTTGGGCCTCAGTTTCCCTCTGTGAAGTGGGGGGAGGCAGGCCTTCAAGGAGGGATAGAGGTACAAGGCTTCGTCTC
ATCTGCTGTCTGAGCATCCAGGCCCAAAGGCACTGAGGGAGTCAGGAGCTGGGGCTCGGCACATGCAGAGATGACAGGGCAGGGGGCAGT
CTTCCTCCCCCTCCCCGACCAAACCTCGGGGAGCCCTCCTGTGCCCCTCCCTCCTTGTTGTCCAGTGCTGGGCTCCCCACCCCGAGGTCA
GGCTGCCCAATCCTCTGACTGGATCACCGGGGGCTTCTTGCCTCAGTTCTTCCCTCTGAGCCCCCAGGCCCTCCCGCATCTCAGGTTGGG
GATGGGGACATGGAGAGGAAGGGGCCGCCTACTCCTGCAAATGCTTGTGACAGATGCCAGGAGGTAGATGTGTGCTGGCCAATAAAGGCC

>In-frame_MYH9_ENST00000216181_chr22_36744949_-_EMID1_ENST00000404820_chr22_29610915_+_2454nt
GAGGGCGGGGCGGGAAGGCGGCGAGGAGCCGAGCTGGGTGCGGTGAGGCGCGCAGATCACCGCGGTTCCTGGGCAGGGCACGGAAGGCTA
AGCAAGGCTGACCTGCTGCAGCTCCCGCCTCGTGCGCTCGCCCCACCCGGCCGCCGCCCGAGCGCTCGAGAAAGTCCTCTCGGGAGAAGC
AGCGCCTGTTCCCGGGGCAGATCCAGGTTCAGGTCCTGGCTATAAGTCACCATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGAT
AAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAGCTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCA
GCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAGAATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAG
AAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACGTGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAG
CGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCGCACCATCTCATGCCATGTGCAGAATGGCACCTACCTTCA
GCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTACAGAACTGTGGTGAGACCCACATACAAGGTGATGTACAA
GATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAGCTGCGAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCC
CATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTTCTCAGGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGAC
AGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGAGCAGCCAGTACCTCCAACACCAGCTACCCCTGAGGACCC
TGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGGCCTCCAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCC
CACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGGCCCACCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCG
GGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGGGCCTCCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCC
ACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTTCACTGAGACCAACAACCACTGGCCCCAGGGACCCACTGG
GCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCACAGGTGTCCCTGGGAGTCCTGGTCACATAGGACCCCCAGG
CCCCACTGGACCCAAAGGAATCTCTGGCCACCCAGGAGAGAAGGGCGAGAGAGGACTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGG
GCAGCGGGGGGAACCTGGCCCTAAGGGAGACCCTGGTGAGAAGAGCCACTGGGCTCCTAGCTTACAGAGCTTCCTGCAGCAGCAGGCTCA
GCTGGAGCTCCTGGCCAGACGGGTCACCCTCCTGGAAGCCATCATCTGGCCAGAACCAGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCAC
AGGCACCCCCAGCCTCCTTCGGGGCAAGAGGGGCGGACATGCAACCAACTACCGGATCGTGGCCCCCAGGAGCCGGGACGAGAGAGGCTG
AGGGTGGTGGCGGCCCCTGAGGCAGACCAGGCCAGGCTTCCCCTCCTACCTGGACTCGGCCAGCTGCCTCCAGGGACCGCCCGTCCATAT
TTATTAATGTCCTCAGGGTCCCTTCTGCCATCTAGGCCTTAGGGGTAAGCAGGTCTCAGTCCTGGCACCATGCACATGTCTGAGGCTGAG
CAAGGGCTGAGAGGAGAGGCTTGGGCCTCAGTTTCCCTCTGTGAAGTGGGGGGAGGCAGGCCTTCAAGGAGGGATAGAGGTACAAGGCTT
CGTCTCATCTGCTGTCTGAGCATCCAGGCCCAAAGGCACTGAGGGAGTCAGGAGCTGGGGCTCGGCACATGCAGAGATGACAGGGCAGGG
GGCAGTCTTCCTCCCCCTCCCCGACCAAACCTCGGGGAGCCCTCCTGTGCCCCTCCCTCCTTGTTGTCCAGTGCTGGGCTCCCCACCCCG
AGGTCAGGCTGCCCAATCCTCTGACTGGATCACCGGGGGCTTCTTGCCTCAGTTCTTCCCTCTGAGCCCCCAGGCCCTCCCGCATCTCAG
GTTGGGGATGGGGACATGGAGAGGAAGGGGCCGCCTACTCCTGCAAATGCTTGTGACAGATGCCAGGAGGTAGATGTGTGCTGGCCAATA

>In-frame_MYH9_ENST00000216181_chr22_36744949_-_EMID1_ENST00000404755_chr22_29610915_+_2385nt
GAGGGCGGGGCGGGAAGGCGGCGAGGAGCCGAGCTGGGTGCGGTGAGGCGCGCAGATCACCGCGGTTCCTGGGCAGGGCACGGAAGGCTA
AGCAAGGCTGACCTGCTGCAGCTCCCGCCTCGTGCGCTCGCCCCACCCGGCCGCCGCCCGAGCGCTCGAGAAAGTCCTCTCGGGAGAAGC
AGCGCCTGTTCCCGGGGCAGATCCAGGTTCAGGTCCTGGCTATAAGTCACCATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGAT
AAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAGCTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCA
GCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAGAATGGGAAGAAGGTGAAGGTGAACAAGGATGACATCCAG
AAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACGTGCCTCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAG
CGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCGCACCATCTCATGCCATGTGCAGAATGGCACCTACCTTCA
GCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTACAGAACTGTGGTGAGACCCACATACAAGGTGATGTACAA
GATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAGCTGCGAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCC
CATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTTCTCAGGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGAC
AGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGAGCAGCCAGTACCTCCAACACCAGCTACCCCTGAGGACCC
TGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGGCCTCCAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCC
CACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGGCCCACCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCG
GGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGGGCCTCCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCC
ACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTTCACTGAGACCAACAACCACTGGCCCCAGGGACCCACTGG
GCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCACAGGTGTCCCTGGGAGTCCTGGTCACATAGGACTGCGTGG
GGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAAGGGAGACCCTGGTGAGAAGAGCCACTGGGGGGAGGGGTT
GCACCAGCTACGCGAGGCTTTGAAGATTTTAGCTGAGAGGGTTTTAATCTTGGAAACAATGATTGGGCTCTATGAACCAGAGCTGGGGTC
TGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAGGGGCGGACATGCAACCAACTACCGGATCGTGGCCCCCAG
GAGCCGGGACGAGAGAGGCTGAGGGTGGTGGCGGCCCCTGAGGCAGACCAGGCCAGGCTTCCCCTCCTACCTGGACTCGGCCAGCTGCCT
CCAGGGACCGCCCGTCCATATTTATTAATGTCCTCAGGGTCCCTTCTGCCATCTAGGCCTTAGGGGTAAGCAGGTCTCAGTCCTGGCACC
ATGCACATGTCTGAGGCTGAGCAAGGGCTGAGAGGAGAGGCTTGGGCCTCAGTTTCCCTCTGTGAAGTGGGGGGAGGCAGGCCTTCAAGG
AGGGATAGAGGTACAAGGCTTCGTCTCATCTGCTGTCTGAGCATCCAGGCCCAAAGGCACTGAGGGAGTCAGGAGCTGGGGCTCGGCACA
TGCAGAGATGACAGGGCAGGGGGCAGTCTTCCTCCCCCTCCCCGACCAAACCTCGGGGAGCCCTCCTGTGCCCCTCCCTCCTTGTTGTCC
AGTGCTGGGCTCCCCACCCCGAGGTCAGGCTGCCCAATCCTCTGACTGGATCACCGGGGGCTTCTTGCCTCAGTTCTTCCCTCTGAGCCC
CCAGGCCCTCCCGCATCTCAGGTTGGGGATGGGGACATGGAGAGGAAGGGGCCGCCTACTCCTGCAAATGCTTGTGACAGATGCCAGGAG

>In-frame_MYH9_ENST00000401701_chr22_36744949_-_EMID1_ENST00000334018_chr22_29610915_+_2303nt
AGGGGCTGGTGTTCGGGGCTGCCCCGAGCCCAGCTCTGGGAGCTTATTTTGTCATCACAGTGGCACTGTCCTGGCTATAAGTCACCATGG
CACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAGCTGG
TATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAGAATG
GGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACGTGCC
TCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCGCACC
ATCTCATGCCATGTGCAGAATGGCACCTACCTTCAGCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTACAGA
ACTGTGGTGAGACCCACATACAAGGTGATGTACAAGATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAGCTGC
GAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCCCATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTTCTCA
GGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGACAGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGAGCAG
CCAGTACCTCCAACACCAGCTACCCCTGAGGACCCTGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGGCCTC
CAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCCCACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGGCCCA
CCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCGGGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGGGCCT
CCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCCACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTTCACT
GAGACCAACAACCACTGGCCCCAGGGACCCACTGGGCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCACAGGT
GTCCCTGGGAGTCCTGGTCACATAGGACCCCCAGGCCCCACTGGACCCAAAGGAATCTCTGGCCACCCAGGAGAGAAGGGCGAGAGAGGA
CTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAAGGGAGACCCTGGTGAGAAGAGCCACTGGGGG
GAGGGGTTGCACCAGCTACGCGAGGCTTTGAAGATTTTAGCTGAGAGGGTTTTAATCTTGGAAACAATGATTGGGCTCTATGAACCAGAG
CTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAGGGGCGGACATGCAACCAACTACCGGATCGTG
GCCCCCAGGAGCCGGGACGAGAGAGGCTGAGGGTGGTGGCGGCCCCTGAGGCAGACCAGGCCAGGCTTCCCCTCCTACCTGGACTCGGCC
AGCTGCCTCCAGGGACCGCCCGTCCATATTTATTAATGTCCTCAGGGTCCCTTCTGCCATCTAGGCCTTAGGGGTAAGCAGGTCTCAGTC
CTGGCACCATGCACATGTCTGAGGCTGAGCAAGGGCTGAGAGGAGAGGCTTGGGCCTCAGTTTCCCTCTGTGAAGTGGGGGGAGGCAGGC
CTTCAAGGAGGGATAGAGGTACAAGGCTTCGTCTCATCTGCTGTCTGAGCATCCAGGCCCAAAGGCACTGAGGGAGTCAGGAGCTGGGGC
TCGGCACATGCAGAGATGACAGGGCAGGGGGCAGTCTTCCTCCCCCTCCCCGACCAAACCTCGGGGAGCCCTCCTGTGCCCCTCCCTCCT
TGTTGTCCAGTGCTGGGCTCCCCACCCCGAGGTCAGGCTGCCCAATCCTCTGACTGGATCACCGGGGGCTTCTTGCCTCAGTTCTTCCCT
CTGAGCCCCCAGGCCCTCCCGCATCTCAGGTTGGGGATGGGGACATGGAGAGGAAGGGGCCGCCTACTCCTGCAAATGCTTGTGACAGAT

>In-frame_MYH9_ENST00000401701_chr22_36744949_-_EMID1_ENST00000404820_chr22_29610915_+_2309nt
AGGGGCTGGTGTTCGGGGCTGCCCCGAGCCCAGCTCTGGGAGCTTATTTTGTCATCACAGTGGCACTGTCCTGGCTATAAGTCACCATGG
CACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAGCTGG
TATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAGAATG
GGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACGTGCC
TCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCGCACC
ATCTCATGCCATGTGCAGAATGGCACCTACCTTCAGCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTACAGA
ACTGTGGTGAGACCCACATACAAGGTGATGTACAAGATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAGCTGC
GAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCCCATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTTCTCA
GGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGACAGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGAGCAG
CCAGTACCTCCAACACCAGCTACCCCTGAGGACCCTGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGGCCTC
CAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCCCACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGGCCCA
CCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCGGGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGGGCCT
CCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCCACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTTCACT
GAGACCAACAACCACTGGCCCCAGGGACCCACTGGGCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCACAGGT
GTCCCTGGGAGTCCTGGTCACATAGGACCCCCAGGCCCCACTGGACCCAAAGGAATCTCTGGCCACCCAGGAGAGAAGGGCGAGAGAGGA
CTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAAGGGAGACCCTGGTGAGAAGAGCCACTGGGCT
CCTAGCTTACAGAGCTTCCTGCAGCAGCAGGCTCAGCTGGAGCTCCTGGCCAGACGGGTCACCCTCCTGGAAGCCATCATCTGGCCAGAA
CCAGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAGGGGCGGACATGCAACCAACTACCGG
ATCGTGGCCCCCAGGAGCCGGGACGAGAGAGGCTGAGGGTGGTGGCGGCCCCTGAGGCAGACCAGGCCAGGCTTCCCCTCCTACCTGGAC
TCGGCCAGCTGCCTCCAGGGACCGCCCGTCCATATTTATTAATGTCCTCAGGGTCCCTTCTGCCATCTAGGCCTTAGGGGTAAGCAGGTC
TCAGTCCTGGCACCATGCACATGTCTGAGGCTGAGCAAGGGCTGAGAGGAGAGGCTTGGGCCTCAGTTTCCCTCTGTGAAGTGGGGGGAG
GCAGGCCTTCAAGGAGGGATAGAGGTACAAGGCTTCGTCTCATCTGCTGTCTGAGCATCCAGGCCCAAAGGCACTGAGGGAGTCAGGAGC
TGGGGCTCGGCACATGCAGAGATGACAGGGCAGGGGGCAGTCTTCCTCCCCCTCCCCGACCAAACCTCGGGGAGCCCTCCTGTGCCCCTC
CCTCCTTGTTGTCCAGTGCTGGGCTCCCCACCCCGAGGTCAGGCTGCCCAATCCTCTGACTGGATCACCGGGGGCTTCTTGCCTCAGTTC
TTCCCTCTGAGCCCCCAGGCCCTCCCGCATCTCAGGTTGGGGATGGGGACATGGAGAGGAAGGGGCCGCCTACTCCTGCAAATGCTTGTG

>In-frame_MYH9_ENST00000401701_chr22_36744949_-_EMID1_ENST00000404755_chr22_29610915_+_2240nt
AGGGGCTGGTGTTCGGGGCTGCCCCGAGCCCAGCTCTGGGAGCTTATTTTGTCATCACAGTGGCACTGTCCTGGCTATAAGTCACCATGG
CACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGGCCGACTGGGCTGCCAAGAAGCTGG
TATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAAGGAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAGAATG
GGAAGAAGGTGAAGGTGAACAAGGATGACATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACGTGCC
TCAACGAAGCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACGAACTGGTGCTCCTATGTGGTGACCCGCACC
ATCTCATGCCATGTGCAGAATGGCACCTACCTTCAGCGAGTGCTGCAGAACTGCCCCTGGCCCATGAGCTGTCCGGGGAGCAGCTACAGA
ACTGTGGTGAGACCCACATACAAGGTGATGTACAAGATAGTGACCGCCCGTGAGTGGAGGTGCTGCCCTGGGCACTCAGGAGTGAGCTGC
GAGGAAGTTGCAGCTTCCTCTGCCTCCTTGGAGCCCATGTGGTCGGGCAGTACCATGCGGCGGATGGCGCTTCGGCCCACAGCCTTCTCA
GGTTGTCTCAACTGCAGCAAAGTGTCAGAGCTGACAGAGCGGCTGAAGGTGCTGGAGGCCAAGATGACCATGCTGACTGTCATAGAGCAG
CCAGTACCTCCAACACCAGCTACCCCTGAGGACCCTGCCCCGCTCTGGGGTCCCCCTCCTGCCCAGGGCAGCCCCGGAGATGGAGGCCTC
CAGGACCAAGTCGGTGCTTGGGGGCTTCCCGGGCCCACCGGCCCCAAGGGAGATGCCGGCAGTCGGGGCCCAATGGGGATGAGAGGCCCA
CCAGGTCCACAGGGCCCCCCAGGGAGCCCTGGCCGGGCTGGAGCTGTGGGCACCCCTGGAGAGAGGGGACCTCCTGGGCCACCAGGGCCT
CCTGGCCCCCCTGGGCCCCCAGCCCCTGTTGGGCCACCCCATGCCCGGATCTCCCAGCATGGAGACCCATTGCTGTCCAACACCTTCACT
GAGACCAACAACCACTGGCCCCAGGGACCCACTGGGCCTCCAGGCCCTCCAGGGCCCATGGGTCCCCCTGGGCCTCCTGGCCCCACAGGT
GTCCCTGGGAGTCCTGGTCACATAGGACTGCGTGGGGAGCCTGGCCCCCAAGGCTCTGCTGGGCAGCGGGGGGAACCTGGCCCTAAGGGA
GACCCTGGTGAGAAGAGCCACTGGGGGGAGGGGTTGCACCAGCTACGCGAGGCTTTGAAGATTTTAGCTGAGAGGGTTTTAATCTTGGAA
ACAATGATTGGGCTCTATGAACCAGAGCTGGGGTCTGGGGCGGGCCCTGCCGGCACAGGCACCCCCAGCCTCCTTCGGGGCAAGAGGGGC
GGACATGCAACCAACTACCGGATCGTGGCCCCCAGGAGCCGGGACGAGAGAGGCTGAGGGTGGTGGCGGCCCCTGAGGCAGACCAGGCCA
GGCTTCCCCTCCTACCTGGACTCGGCCAGCTGCCTCCAGGGACCGCCCGTCCATATTTATTAATGTCCTCAGGGTCCCTTCTGCCATCTA
GGCCTTAGGGGTAAGCAGGTCTCAGTCCTGGCACCATGCACATGTCTGAGGCTGAGCAAGGGCTGAGAGGAGAGGCTTGGGCCTCAGTTT
CCCTCTGTGAAGTGGGGGGAGGCAGGCCTTCAAGGAGGGATAGAGGTACAAGGCTTCGTCTCATCTGCTGTCTGAGCATCCAGGCCCAAA
GGCACTGAGGGAGTCAGGAGCTGGGGCTCGGCACATGCAGAGATGACAGGGCAGGGGGCAGTCTTCCTCCCCCTCCCCGACCAAACCTCG
GGGAGCCCTCCTGTGCCCCTCCCTCCTTGTTGTCCAGTGCTGGGCTCCCCACCCCGAGGTCAGGCTGCCCAATCCTCTGACTGGATCACC
GGGGGCTTCTTGCCTCAGTTCTTCCCTCTGAGCCCCCAGGCCCTCCCGCATCTCAGGTTGGGGATGGGGACATGGAGAGGAAGGGGCCGC


Top

FusionGenePPI for MYH9_EMID1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MYH9EPB41, MARK4, ASCC2, MYL9, PRKCE, USP1, USP45, GRB2, RAC1, YWHAZ, EMD, TERF1, TERF2, CBL, PPP2R4, AGO3, YWHAQ, MME, HDAC5, NCOA3, CREBBP, UBE3A, ARRB1, ARRB2, SIRT7, TRAF4, SP1, ISG15, FBXO25, CDK2, CUL1, TRIM72, GRK5, UBASH3B, PIK3R2, SHC1, MYL6, SPTAN1, HSP90AB1, ACTA2, MYH10, HNRNPU, FLNA, ACTR1A, RAB11A, EIF4B, SEL1L, ATP5A1, SEPT7, RALA, HSPA5, TUBA4A, EIF3A, EIF3C, TPM4, MRPS18B, PSME3, HSPA1A, ESR1, TSGA10, EIF4A3, MAGOH, TRAF3IP1, MEN1, HSP90AA1, VCAM1, FN1, IQCB1, ITGA4, PAN2, ACE, ACTB, CSNK2A1, PIK3C3, PPP2CA, CASP4, TARDBP, AKAP10, CDC73, MYH14, OTUD6B, MYL12A, RPA1, RPA2, RPA3, LGR4, IVNS1ABP, TP53, HUWE1, ALK, UBE2I, EED, AMFR, OS9, SYVN1, ATG9A, USP7, HNRNPA1, ATP5L, MYO1E, SRSF5, SSB, NTRK1, ACTA1, ACTG1, ACTN4, ACTN1, AP2A1, AP2B1, ANXA2, APOB, DST, CALD1, CALM1, CALML3, CAPZA1, CAPZA2, CAPZB, CD44, CFL1, CFL2, AP2M1, CLTA, CLTB, CLTC, CPM, DAB2, DAPK3, DBN1, DSG2, CTTN, STOM, EPS15, FLII, FLNB, FYN, GNAI1, GNAI2, GNAS, GNB2, GSN, HIP1, ITPR2, ITPR3, JUP, LGALS1, ABLIM1, LMO7, LSS, LYN, MYO1B, MSN, PDLIM7, ANLN, MYO19, MYO18A, MYLK, MYO1C, MYO5A, MYO5B, MYO6, PPP1R12A, PPP1R12B, NAP1L1, PAWR, PIK3C2A, PLEC, PLS1, PPIA, PPP1CA, PPP1CB, PPP1CC, PSMB10, TWF1, PEX5, RPL22, SIPA1, SORD, SPTBN1, SPTBN2, SSFA2, ST5, SVIL, TCEA2, TMOD1, TNFAIP1, TPM1, TPM2, TPM3, CORO2A, YES1, LUZP1, PICALM, PIP5K1A, SORBS2, IQGAP1, HIP1R, GPRC5A, LRRFIP2, CLINT1, ARHGAP11A, ARHGEF17, SEC16A, WDR1, ARPC4, ARPC3, ARPC1B, ACTR3, ACTR2, ARPC2, BCAP31, FLOT1, BASP1, IMMT, RBPMS, DSTN, TRIOBP, CEP250, AKAP2, TWF2, SYNPO, CEP162, LIMCH1, PALLD, SIPA1L3, MPRIP, COBL, KIF13B, SPECC1L, ATP13A2, MACF1, CORO1C, STX12, GCA, PLEKHG3, RAI14, ZBTB20, AHDC1, PACSIN3, TMOD3, PNMA3, FCF1, CEP83, LIMA1, GTSE1, KDM3B, UACA, CDCA8, BMP2K, UNC45A, MYO5C, GNG12, MUC13, CORO1B, MICAL3, ARHGAP21, SHROOM3, AFAP1, INF2, NARFL, METTL17, AHNAK, EFHD2, CYBRD1, WDR76, DSN1, RNF170, TRIM56, ARPC5L, ANTXR1, LZTS2, PPP1R9B, CEP89, STON2, DOCK7, DIXDC1, SSH2, NEXN, ELMSAN1, SPECC1, CCDC102A, FCHO2, MISP, JMY, CD109, ACTRT1, MYL6B, CCDC50, OARD1, GAS2L3, TTLL6, TPRN, ACTBL2, MCM2, MCM5, SNW1, CDC5L, BOP1, PES1, EGFR, CDH1, C9orf156, MYL3, H2AFY, CYLD, TRIM25, BRCA1, HDAC6EMID1CDC5L, KLHL25, UBR4, COLGALT2, YTHDF1, KRAS, CRTAP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MYH9_EMID1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneMYH9P35579DB11638ArtenimolMyosin-9small moleculeapproved|investigational

Top

RelatedDiseases for MYH9_EMID1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMYH9C0403445Fechtner syndrome (disorder)9UNIPROT
HgeneMYH9C0398641Epstein syndrome (disorder)7UNIPROT
HgeneMYH9C0340978May-Hegglin anomaly6UNIPROT
HgeneMYH9C0022661Kidney Failure, Chronic2CTD_human
HgeneMYH9C1854520SEBASTIAN SYNDROME2CTD_human;ORPHANET;UNIPROT
HgeneMYH9C0017668Focal glomerulosclerosis1CTD_human
HgeneMYH9C0020544Renal hypertension1CTD_human
HgeneMYH9C0027706Hereditary nephritis1CTD_human
HgeneMYH9C0036341Schizophrenia1PSYGENET
HgeneMYH9C1863659DEAFNESS, AUTOSOMAL DOMINANT 171UNIPROT
HgeneMYH9C2673482Increased susceptibility to schizophrenia1PSYGENET