FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22952

FusionGeneSummary for MYB_NFIB

check button Fusion gene summary
Fusion gene informationFusion gene name: MYB_NFIB
Fusion gene ID: 22952
HgeneTgene
Gene symbol

MYB

NFIB

Gene ID

4602

4781

Gene nameMYB proto-oncogene, transcription factornuclear factor I B
SynonymsCmyb|c-myb|c-myb_CDS|efgCTF|HMGIC/NFIB|NF-I/B|NF1-B|NFI-B|NFI-RED|NFIB2|NFIB3
Cytomap

6q23.3

9p23-p22.3

Type of geneprotein-codingprotein-coding
Descriptiontranscriptional activator Myboncogene AMVproto-oncogene c-Mybv-myb avian myeloblastosis viral oncogene homolognuclear factor 1 B-typeCCAAT-box-binding transcription factorTGGCA-binding proteinnuclear factor 1/B
Modification date2018052720180523
UniProtAcc

P10242

O00712

Ensembl transtripts involved in fusion geneENST00000341911, ENST00000316528, 
ENST00000442647, ENST00000367814, 
ENST00000525369, ENST00000534121, 
ENST00000533624, ENST00000534044, 
ENST00000528774, ENST00000531845, 
ENST00000527615, ENST00000420123, 
ENST00000380934, ENST00000380959, 
ENST00000380953, ENST00000397575, 
ENST00000397581, ENST00000397579, 
ENST00000543693, ENST00000380924, 
ENST00000380921, 
Fusion gene scores* DoF score1 X 2 X 2=43 X 7 X 2=42
# samples 47
** MAII scorelog2(4/4*10)=3.32192809488736log2(7/42*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MYB [Title/Abstract] AND NFIB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMYB

GO:0045944

positive regulation of transcription by RNA polymerase II

10233885|20484083

TgeneNFIB

GO:0045944

positive regulation of transcription by RNA polymerase II

9099724|19540848


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A1-A0SB-01AMYBchr6

135521553

+NFIBchr9

14307519

-
ChiTaRS3.1FJ969915MYBchr6

135524462

+NFIBchr9

14102512

-
ChiTaRS3.1FJ969917MYBchr6

135524462

+NFIBchr9

14116347

-
ChiTaRS3.1FJ969916MYBchr6

135524462

+NFIBchr9

14088328

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000341911ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000341911ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000341911ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000341911ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000341911ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000341911ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000341911ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000341911ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000341911ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000316528ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000316528ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000316528ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000316528ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000316528ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000316528ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000316528ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000316528ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000316528ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000442647ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000442647ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000442647ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000442647ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000442647ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000442647ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000442647ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000442647ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000442647ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000367814ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000367814ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000367814ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000367814ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000367814ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000367814ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000367814ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000367814ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000367814ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000525369ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000525369ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000525369ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000525369ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000525369ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000525369ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000525369ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000525369ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000525369ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534121ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534121ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534121ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534121ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534121ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534121ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000534121ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000534121ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000534121ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000533624ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000533624ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000533624ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000533624ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000533624ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000533624ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000533624ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000533624ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000533624ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534044ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534044ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534044ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534044ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534044ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000534044ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000534044ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000534044ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000534044ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000528774ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000528774ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000528774ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000528774ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000528774ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000528774ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000528774ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000528774ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000528774ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
3UTR-3CDSENST00000531845ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
3UTR-3CDSENST00000531845ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
3UTR-3CDSENST00000531845ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
3UTR-3CDSENST00000531845ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
3UTR-3CDSENST00000531845ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
3UTR-3CDSENST00000531845ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
3UTR-intronENST00000531845ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
3UTR-intronENST00000531845ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
3UTR-intronENST00000531845ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000527615ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000527615ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000527615ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000527615ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000527615ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
In-frameENST00000527615ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000527615ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000527615ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000527615ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
intron-3CDSENST00000420123ENST00000380934MYBchr6

135521553

+NFIBchr9

14307519

-
intron-3CDSENST00000420123ENST00000380959MYBchr6

135521553

+NFIBchr9

14307519

-
intron-3CDSENST00000420123ENST00000380953MYBchr6

135521553

+NFIBchr9

14307519

-
intron-3CDSENST00000420123ENST00000397575MYBchr6

135521553

+NFIBchr9

14307519

-
intron-3CDSENST00000420123ENST00000397581MYBchr6

135521553

+NFIBchr9

14307519

-
intron-3CDSENST00000420123ENST00000397579MYBchr6

135521553

+NFIBchr9

14307519

-
intron-intronENST00000420123ENST00000543693MYBchr6

135521553

+NFIBchr9

14307519

-
intron-intronENST00000420123ENST00000380924MYBchr6

135521553

+NFIBchr9

14307519

-
intron-intronENST00000420123ENST00000380921MYBchr6

135521553

+NFIBchr9

14307519

-
5CDS-intronENST00000341911ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000341911ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000341911ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000341911ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000341911ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000341911ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000341911ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000341911ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000341911ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000316528ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000316528ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000316528ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000316528ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000316528ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000316528ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000316528ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000316528ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000316528ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000442647ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000442647ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000442647ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000442647ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000442647ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000442647ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000442647ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000442647ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000442647ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000367814ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000367814ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000367814ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000367814ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000367814ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000367814ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000367814ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000367814ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000367814ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000525369ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000525369ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000525369ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000525369ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000525369ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000525369ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000525369ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000525369ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000525369ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534121ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534121ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534121ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534121ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534121ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534121ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534121ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534121ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534121ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000533624ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000533624ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000533624ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000533624ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000533624ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000533624ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000533624ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000533624ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000533624ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534044ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534044ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534044ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534044ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534044ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534044ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534044ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534044ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000534044ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000528774ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000528774ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000528774ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000528774ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000528774ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000528774ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000528774ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000528774ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000528774ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
3UTR-intronENST00000531845ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
3UTR-intronENST00000531845ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
3UTR-intronENST00000531845ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
3UTR-intronENST00000531845ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
3UTR-intronENST00000531845ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
3UTR-intronENST00000531845ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
3UTR-intronENST00000531845ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
3UTR-intronENST00000531845ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
3UTR-intronENST00000531845ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000527615ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000527615ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000527615ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000527615ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000527615ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000527615ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000527615ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000527615ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000527615ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
intron-intronENST00000420123ENST00000380934MYBchr6

135524462

+NFIBchr9

14102512

-
intron-intronENST00000420123ENST00000380959MYBchr6

135524462

+NFIBchr9

14102512

-
intron-intronENST00000420123ENST00000380953MYBchr6

135524462

+NFIBchr9

14102512

-
intron-intronENST00000420123ENST00000397575MYBchr6

135524462

+NFIBchr9

14102512

-
intron-intronENST00000420123ENST00000397581MYBchr6

135524462

+NFIBchr9

14102512

-
intron-intronENST00000420123ENST00000397579MYBchr6

135524462

+NFIBchr9

14102512

-
intron-intronENST00000420123ENST00000543693MYBchr6

135524462

+NFIBchr9

14102512

-
intron-intronENST00000420123ENST00000380924MYBchr6

135524462

+NFIBchr9

14102512

-
intron-intronENST00000420123ENST00000380921MYBchr6

135524462

+NFIBchr9

14102512

-
5CDS-intronENST00000341911ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000341911ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000341911ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000341911ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000341911ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000341911ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000341911ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000341911ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000341911ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000316528ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000316528ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000316528ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000316528ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000316528ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000316528ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000316528ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000316528ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000316528ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000442647ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000442647ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000442647ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000442647ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000442647ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000442647ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000442647ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000442647ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000442647ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000367814ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000367814ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000367814ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000367814ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000367814ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000367814ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000367814ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000367814ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000367814ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000525369ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000525369ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000525369ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000525369ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000525369ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000525369ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000525369ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000525369ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000525369ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534121ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534121ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534121ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534121ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534121ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534121ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534121ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534121ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534121ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000533624ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000533624ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000533624ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000533624ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000533624ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000533624ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000533624ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000533624ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000533624ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534044ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534044ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534044ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534044ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534044ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534044ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534044ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534044ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000534044ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000528774ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000528774ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000528774ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000528774ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000528774ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000528774ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000528774ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000528774ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000528774ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
3UTR-intronENST00000531845ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
3UTR-intronENST00000531845ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
3UTR-intronENST00000531845ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
3UTR-intronENST00000531845ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
3UTR-intronENST00000531845ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
3UTR-intronENST00000531845ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
3UTR-intronENST00000531845ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
3UTR-intronENST00000531845ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
3UTR-intronENST00000531845ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000527615ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000527615ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000527615ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000527615ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000527615ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000527615ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000527615ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000527615ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
5CDS-intronENST00000527615ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
intron-intronENST00000420123ENST00000380934MYBchr6

135524462

+NFIBchr9

14116347

-
intron-intronENST00000420123ENST00000380959MYBchr6

135524462

+NFIBchr9

14116347

-
intron-intronENST00000420123ENST00000380953MYBchr6

135524462

+NFIBchr9

14116347

-
intron-intronENST00000420123ENST00000397575MYBchr6

135524462

+NFIBchr9

14116347

-
intron-intronENST00000420123ENST00000397581MYBchr6

135524462

+NFIBchr9

14116347

-
intron-intronENST00000420123ENST00000397579MYBchr6

135524462

+NFIBchr9

14116347

-
intron-intronENST00000420123ENST00000543693MYBchr6

135524462

+NFIBchr9

14116347

-
intron-intronENST00000420123ENST00000380924MYBchr6

135524462

+NFIBchr9

14116347

-
intron-intronENST00000420123ENST00000380921MYBchr6

135524462

+NFIBchr9

14116347

-
Frame-shiftENST00000341911ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000341911ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000341911ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000341911ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000341911ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000341911ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000341911ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000341911ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000341911ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000316528ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000316528ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000316528ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000316528ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000316528ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000316528ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000316528ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000316528ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000316528ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000442647ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000442647ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000442647ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000442647ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000442647ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000442647ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000442647ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000442647ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000442647ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000367814ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000367814ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000367814ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000367814ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000367814ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000367814ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000367814ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000367814ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000367814ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000525369ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000525369ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000525369ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000525369ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000525369ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000525369ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000525369ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000525369ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000525369ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000534121ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000534121ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000534121ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000534121ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000534121ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000534121ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000534121ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000534121ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000534121ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000533624ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000533624ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000533624ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000533624ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000533624ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000533624ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000533624ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000533624ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000533624ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000534044ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000534044ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000534044ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000534044ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000534044ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000534044ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000534044ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000534044ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000534044ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000528774ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000528774ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000528774ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000528774ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000528774ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000528774ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000528774ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000528774ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000528774ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
3UTR-3CDSENST00000531845ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
3UTR-3CDSENST00000531845ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
3UTR-3CDSENST00000531845ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
3UTR-3CDSENST00000531845ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
3UTR-3CDSENST00000531845ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
3UTR-3CDSENST00000531845ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
3UTR-3CDSENST00000531845ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
3UTR-3CDSENST00000531845ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
3UTR-intronENST00000531845ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000527615ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000527615ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
In-frameENST00000527615ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000527615ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000527615ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000527615ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000527615ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
Frame-shiftENST00000527615ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
5CDS-intronENST00000527615ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-
intron-3CDSENST00000420123ENST00000380934MYBchr6

135524462

+NFIBchr9

14088328

-
intron-3CDSENST00000420123ENST00000380959MYBchr6

135524462

+NFIBchr9

14088328

-
intron-3CDSENST00000420123ENST00000380953MYBchr6

135524462

+NFIBchr9

14088328

-
intron-3CDSENST00000420123ENST00000397575MYBchr6

135524462

+NFIBchr9

14088328

-
intron-3CDSENST00000420123ENST00000397581MYBchr6

135524462

+NFIBchr9

14088328

-
intron-3CDSENST00000420123ENST00000397579MYBchr6

135524462

+NFIBchr9

14088328

-
intron-3CDSENST00000420123ENST00000543693MYBchr6

135524462

+NFIBchr9

14088328

-
intron-3CDSENST00000420123ENST00000380924MYBchr6

135524462

+NFIBchr9

14088328

-
intron-intronENST00000420123ENST00000380921MYBchr6

135524462

+NFIBchr9

14088328

-

Top

FusionProtFeatures for MYB_NFIB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MYB

P10242

NFIB

O00712


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYBchr6:135521553chr9:14307519ENST00000341911+1316115_138650762DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000341911+1316166_189650762DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000341911+131663_86650762DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000367814+1215115_138529641DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000367814+1215166_189529641DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000367814+121563_86529641DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000442647+1215115_138526638DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000442647+1215166_189526638DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000442647+121563_86526638DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000525369+1114115_138444556DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000525369+1114166_189444556DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000525369+111463_86444556DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000528774+1316115_138647759DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000528774+1316166_189647759DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000528774+131663_86647759DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000533624+1114115_138494606DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000533624+1114166_189494606DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000533624+111463_86494606DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000534044+1214115_138529604DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000534044+1214166_189529604DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000534044+121463_86529604DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000534121+1316115_138634746DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000534121+1316166_189634746DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000534121+131663_86634746DNA bindingH-T-H motif
HgeneMYBchr6:135521553chr9:14307519ENST00000341911+1316143_193650762DomainHTH myb-type 3
HgeneMYBchr6:135521553chr9:14307519ENST00000341911+131635_86650762DomainHTH myb-type 1
HgeneMYBchr6:135521553chr9:14307519ENST00000341911+131687_142650762DomainHTH myb-type 2
HgeneMYBchr6:135521553chr9:14307519ENST00000367814+1215143_193529641DomainHTH myb-type 3
HgeneMYBchr6:135521553chr9:14307519ENST00000367814+121535_86529641DomainHTH myb-type 1
HgeneMYBchr6:135521553chr9:14307519ENST00000367814+121587_142529641DomainHTH myb-type 2
HgeneMYBchr6:135521553chr9:14307519ENST00000442647+1215143_193526638DomainHTH myb-type 3
HgeneMYBchr6:135521553chr9:14307519ENST00000442647+121535_86526638DomainHTH myb-type 1
HgeneMYBchr6:135521553chr9:14307519ENST00000442647+121587_142526638DomainHTH myb-type 2
HgeneMYBchr6:135521553chr9:14307519ENST00000525369+1114143_193444556DomainHTH myb-type 3
HgeneMYBchr6:135521553chr9:14307519ENST00000525369+111435_86444556DomainHTH myb-type 1
HgeneMYBchr6:135521553chr9:14307519ENST00000525369+111487_142444556DomainHTH myb-type 2
HgeneMYBchr6:135521553chr9:14307519ENST00000528774+1316143_193647759DomainHTH myb-type 3
HgeneMYBchr6:135521553chr9:14307519ENST00000528774+131635_86647759DomainHTH myb-type 1
HgeneMYBchr6:135521553chr9:14307519ENST00000528774+131687_142647759DomainHTH myb-type 2
HgeneMYBchr6:135521553chr9:14307519ENST00000533624+1114143_193494606DomainHTH myb-type 3
HgeneMYBchr6:135521553chr9:14307519ENST00000533624+111435_86494606DomainHTH myb-type 1
HgeneMYBchr6:135521553chr9:14307519ENST00000533624+111487_142494606DomainHTH myb-type 2
HgeneMYBchr6:135521553chr9:14307519ENST00000534044+1214143_193529604DomainHTH myb-type 3
HgeneMYBchr6:135521553chr9:14307519ENST00000534044+121435_86529604DomainHTH myb-type 1
HgeneMYBchr6:135521553chr9:14307519ENST00000534044+121487_142529604DomainHTH myb-type 2
HgeneMYBchr6:135521553chr9:14307519ENST00000534121+1316143_193634746DomainHTH myb-type 3
HgeneMYBchr6:135521553chr9:14307519ENST00000534121+131635_86634746DomainHTH myb-type 1
HgeneMYBchr6:135521553chr9:14307519ENST00000534121+131687_142634746DomainHTH myb-type 2
HgeneMYBchr6:135521553chr9:14307519ENST00000341911+1316275_327650762RegionTranscription activation domain (PubMed:2189102)
HgeneMYBchr6:135521553chr9:14307519ENST00000341911+1316328_465650762RegionNegative regulatory domain
HgeneMYBchr6:135521553chr9:14307519ENST00000341911+1316376_397650762RegionNote=Leucine-zipper
HgeneMYBchr6:135521553chr9:14307519ENST00000367814+1215275_327529641RegionTranscription activation domain (PubMed:2189102)
HgeneMYBchr6:135521553chr9:14307519ENST00000367814+1215328_465529641RegionNegative regulatory domain
HgeneMYBchr6:135521553chr9:14307519ENST00000367814+1215376_397529641RegionNote=Leucine-zipper
HgeneMYBchr6:135521553chr9:14307519ENST00000442647+1215275_327526638RegionTranscription activation domain (PubMed:2189102)
HgeneMYBchr6:135521553chr9:14307519ENST00000442647+1215328_465526638RegionNegative regulatory domain
HgeneMYBchr6:135521553chr9:14307519ENST00000442647+1215376_397526638RegionNote=Leucine-zipper
HgeneMYBchr6:135521553chr9:14307519ENST00000525369+1114275_327444556RegionTranscription activation domain (PubMed:2189102)
HgeneMYBchr6:135521553chr9:14307519ENST00000525369+1114376_397444556RegionNote=Leucine-zipper
HgeneMYBchr6:135521553chr9:14307519ENST00000528774+1316275_327647759RegionTranscription activation domain (PubMed:2189102)
HgeneMYBchr6:135521553chr9:14307519ENST00000528774+1316328_465647759RegionNegative regulatory domain
HgeneMYBchr6:135521553chr9:14307519ENST00000528774+1316376_397647759RegionNote=Leucine-zipper
HgeneMYBchr6:135521553chr9:14307519ENST00000533624+1114275_327494606RegionTranscription activation domain (PubMed:2189102)
HgeneMYBchr6:135521553chr9:14307519ENST00000533624+1114328_465494606RegionNegative regulatory domain
HgeneMYBchr6:135521553chr9:14307519ENST00000533624+1114376_397494606RegionNote=Leucine-zipper
HgeneMYBchr6:135521553chr9:14307519ENST00000534044+1214275_327529604RegionTranscription activation domain (PubMed:2189102)
HgeneMYBchr6:135521553chr9:14307519ENST00000534044+1214328_465529604RegionNegative regulatory domain
HgeneMYBchr6:135521553chr9:14307519ENST00000534044+1214376_397529604RegionNote=Leucine-zipper
HgeneMYBchr6:135521553chr9:14307519ENST00000534121+1316275_327634746RegionTranscription activation domain (PubMed:2189102)
HgeneMYBchr6:135521553chr9:14307519ENST00000534121+1316328_465634746RegionNegative regulatory domain
HgeneMYBchr6:135521553chr9:14307519ENST00000534121+1316376_397634746RegionNote=Leucine-zipper

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMYBchr6:135521553chr9:14307519ENST00000525369+1114328_465444556RegionNegative regulatory domain
TgeneNFIBchr6:135521553chr9:14307519ENST00000380953-0111_19510495DNA bindingCTF/NF-I
TgeneNFIBchr6:135521553chr9:14307519ENST00000380959-091_19510421DNA bindingCTF/NF-I


Top

FusionGeneSequence for MYB_NFIB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_1061aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPR
VNKRMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSL
TSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDES
GIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKL
RKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHIT
VSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQ
RSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_1061aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPR
VNKRMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSL
TSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDES
GIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKL
RKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHIT
VSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQ
RSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_1135aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPR
VNKRMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSL
TSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDES
GIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKL
RKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHIT
VSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQ
RSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV
AHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHP

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_1202aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPR
VNKRMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSL
TSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDES
GIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKL
RKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHIT
VSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQ
RSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV
AHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHP
SAVRPVTLSMTDTKPITTSTEAYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQ

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1211aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPR
VNKRMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSL
TSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDES
GIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKL
RKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHIT
VSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQ
RSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV
AHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHP
SAVRPVTLSMTDTKPITTSTEGEAASPTATTYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPG

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_1128aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPR
VNKRMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSL
TSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDES
GIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKL
RKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHIT
VSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQ
RSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV
AHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLG

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_940aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_940aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_1014aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQA

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_1081aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQA
NRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGEPFLQAETSN

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1090aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEGEAASPTATT
YTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGE

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_1007aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNY

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_937aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTP
AIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHV
RAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGK
IRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNP
PGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPS
SPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSH

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_937aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTP
AIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHV
RAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGK
IRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNP
PGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPS
SPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSH

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_1011aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTP
AIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHV
RAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGK
IRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNP
PGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPS
SPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSH
PTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQANRY

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_1078aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTP
AIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHV
RAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGK
IRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNP
PGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPS
SPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSH
PTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQANRY

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1087aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTP
AIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHV
RAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGK
IRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNP
PGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPS
SPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSH
PTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEGEAASPTATTYTA
SGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGEPFL

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_1004aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTP
AIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHV
RAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGK
IRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNP
PGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPS
SPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSH
PTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLN

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_940aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_940aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_1014aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQA

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_1081aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQA
NRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGEPFLQAETSN

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1090aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEGEAASPTATT
YTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGE

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_1007aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNY

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_855aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQK
ENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPF
IEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVL
SNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPS
HNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPT
GDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPP

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_855aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQK
ENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPF
IEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVL
SNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPS
HNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPT
GDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPP

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_929aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQK
ENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPF
IEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVL
SNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPS
HNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPT
GDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPP
APSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTAS

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_996aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQK
ENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPF
IEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVL
SNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPS
HNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPT
GDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPP
APSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTAS
GTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGEPFLQ

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1005aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQK
ENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPF
IEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVL
SNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPS
HNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPT
GDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPP
APSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEGEAAS
PTATTYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGL

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_922aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQK
ENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPF
IEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVL
SNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPS
HNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPT
GDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPP
APSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPA

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_1045aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKV
LPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPF
HRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKK
IKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTV
TGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQE
QDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTIS
IDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPL

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_1045aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKV
LPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPF
HRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKK
IKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTV
TGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQE
QDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTIS
IDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPL

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_1119aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKV
LPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPF
HRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKK
IKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTV
TGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQE
QDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTIS
IDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPL
PFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPI

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_1186aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKV
LPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPF
HRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKK
IKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTV
TGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQE
QDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTIS
IDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPL
PFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPI
TTSTEAYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYG

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1195aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKV
LPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPF
HRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKK
IKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTV
TGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQE
QDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTIS
IDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPL
PFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPI
TTSTEGEAASPTATTYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPI

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_1112aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKV
LPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPF
HRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKK
IKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTV
TGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQE
QDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTIS
IDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPL
PFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQ

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_905aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAET
LQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLK
MLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERA
VKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLEST
DGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTG
VNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSS
ASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQS

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_905aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAET
LQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLK
MLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERA
VKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLEST
DGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTG
VNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSS
ASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQS

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_979aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAET
LQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLK
MLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERA
VKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLEST
DGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTG
VNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSS
ASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQP

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_1046aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAET
LQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLK
MLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERA
VKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLEST
DGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTG
VNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSS
ASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQP
NGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYP

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1055aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAET
LQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLK
MLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERA
VKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLEST
DGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTG
VNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSS
ASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQP
NGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEGEAASPTATTYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTM

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_972aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAET
LQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLK
MLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERA
VKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLEST
DGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTG
VNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSS
ASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQL

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_940aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_940aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_1014aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQA

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_1081aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQA
NRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGEPFLQAETSN

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1090aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEGEAASPTATT
YTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGE

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_1007aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNY

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_1058aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNK
RMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTST
PLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIV
AEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKD
IRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSV
KELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSL
SSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHS

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_1058aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNK
RMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTST
PLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIV
AEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKD
IRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSV
KELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSL
SSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHS

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_1132aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNK
RMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTST
PLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIV
AEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKD
IRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSV
KELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSL
SSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHS
VISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAV

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_1199aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNK
RMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTST
PLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIV
AEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKD
IRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSV
KELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSL
SSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHS
VISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAV
RPVTLSMTDTKPITTSTEAYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSN

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1208aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNK
RMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTST
PLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIV
AEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKD
IRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSV
KELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSL
SSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHS
VISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAV
RPVTLSMTDTKPITTSTEGEAASPTATTYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWA

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_1125aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNK
RMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTST
PLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIV
AEFQENGPPLLKKIKQEDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKD
IRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSV
KELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSL
SSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHS
VISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLGITW

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_940aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_940aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_1014aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQA

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_1081aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEAYTASGTSQA
NRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGEPFLQAETSN

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_1090aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEGEAASPTATT
YTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGE

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_1007aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEDEFHPFIEALL
PHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQ
KGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPA
KNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYP
SPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSY
FSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNY

>In-frame_MYB_ENST00000341911_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_729aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPR
VNKRMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSL
TSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDES
GIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLAS

>In-frame_MYB_ENST00000316528_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_694aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNF
FCSHHWEGDSLNTQLFTQTSPVADAPTGVQWHDFGSLQPLPPGFKRFSCLSLPRSWDYRHPPPRPANFEFLVETGFLHVGQAGLELLTSG

>In-frame_MYB_ENST00000442647_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_605aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTP
AIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCS

>In-frame_MYB_ENST00000367814_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_608aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNF

>In-frame_MYB_ENST00000525369_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_523aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQK
ENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTD

>In-frame_MYB_ENST00000534121_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_713aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKV
LPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPF
HRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKK

>In-frame_MYB_ENST00000533624_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_573aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAET
LQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLK
MLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLM

>In-frame_MYB_ENST00000534044_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_571aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQENILTSSVLMAP

>In-frame_MYB_ENST00000528774_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_726aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEL
IKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIV
NVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGS
LPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNK
RMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSLTST
PLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIV
AEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASPLQ

>In-frame_MYB_ENST00000527615_chr6_135524462_+_NFIB_ENST00000380959_chr9_14088328_-_6aa

>In-frame_MYB_ENST00000527615_chr6_135524462_+_NFIB_ENST00000380953_chr9_14088328_-_6aa


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_3183nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTT
TCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGG
GTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTT
CGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGT
TCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTA
ACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTT
TTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATT
AAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCT
GGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTT
CTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCA
AAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTG
CGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGAC
CAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGC
ATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACA
GTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCT
GCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCC
ATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAG
AGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTAC
CCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAA
AAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTT
GCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGC
TACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGT

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_3183nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTT
TCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGG
GTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTT
CGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGT
TCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTA
ACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTT
TTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATT
AAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCT
GGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTT
CTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCA
AAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTG
CGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGAC
CAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGC
ATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACA
GTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCT
GCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCC
ATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAG
AGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTAC
CCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAA
AAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTT
GCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGC
TACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGT

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3405nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTT
TCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGG
GTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTT
CGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGT
TCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTA
ACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTT
TTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATT
AAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCT
GGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTT
CTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCA
AAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTG
CGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGAC
CAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGC
ATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACA
GTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCT
GCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCC
ATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAG
AGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTAC
CCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAA
AAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTT
GCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGC
TACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGT
CCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCC
AGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAA

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3606nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTT
TCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGG
GTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTT
CGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGT
TCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTA
ACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTT
TTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATT
AAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCT
GGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTT
CTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCA
AAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTG
CGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGAC
CAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGC
ATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACA
GTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCT
GCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCC
ATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAG
AGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTAC
CCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAA
AAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTT
GCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGC
TACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGT
CCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCC
AGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAA
GCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAAC
GGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAA
GTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGC

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3633nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTT
TCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGG
GTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTT
CGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGT
TCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTA
ACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTT
TTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATT
AAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCT
GGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTT
CTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCA
AAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTG
CGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGAC
CAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGC
ATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACA
GTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCT
GCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCC
ATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAG
AGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTAC
CCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAA
AAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTT
GCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGC
TACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGT
CCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCC
AGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACC
ACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGG
ATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGT
ACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGA

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3384nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTT
TCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGG
GTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTT
CGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGT
TCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTA
ACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTT
TTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATT
AAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCT
GGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTT
CTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCA
AAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTG
CGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGAC
CAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGC
ATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACA
GTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCT
GCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCC
ATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAG
AGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTAC
CCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAA
AAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTT
GCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGC
TACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGT
CCACAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGA
ATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAAT

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_2820nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_2820nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3042nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCC

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3243nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCC
AATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGC
AGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTG
TCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAAC

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3270nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACC
TACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATT
TGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACC
TGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAA

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3021nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATT
ACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTAC

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_2811nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCC
CTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCA
GCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCC
CTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCT
GAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTC
CGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAA
AGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATT
CGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAG
ATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAA
AGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAG
GAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCT
CCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGA
ACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCT
TCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGT
TCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTC
AGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTC
ATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCAT
CCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGC

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_2811nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCC
CTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCA
GCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCC
CTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCT
GAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTC
CGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAA
AGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATT
CGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAG
ATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAA
AGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAG
GAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCT
CCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGA
ACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCT
TCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGT
TCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTC
AGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTC
ATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCAT
CCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGC

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3033nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCC
CTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCA
GCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCC
CTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCT
GAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTC
CGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAA
AGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATT
CGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAG
ATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAA
AGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAG
GAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCT
CCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGA
ACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCT
TCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGT
TCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTC
AGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTC
ATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCAT
CCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGC
CAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGA
CCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATAT

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3234nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCC
CTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCA
GCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCC
CTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCT
GAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTC
CGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAA
AGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATT
CGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAG
ATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAA
AGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAG
GAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCT
CCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGA
ACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCT
TCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGT
TCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTC
AGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTC
ATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCAT
CCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGC
CAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGA
CCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATAT
GTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTA
TACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGG

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3261nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCC
CTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCA
GCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCC
CTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCT
GAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTC
CGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAA
AGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATT
CGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAG
ATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAA
AGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAG
GAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCT
CCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGA
ACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCT
TCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGT
TCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTC
AGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTC
ATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCAT
CCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGC
CAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGA
CCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACCTACACAGCC
TCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGG
ACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGC
TTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTT

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3012nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCC
CTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCA
GCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCC
CTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCT
GAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTC
CGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAA
AGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATT
CGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAG
ATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAA
AGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAG
GAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCT
CCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGA
ACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCT
TCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGT
TCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTC
AGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTC
ATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCAT
CCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGC
CAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAA
AGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAAC

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_2820nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_2820nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3042nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCC

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3243nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCC
AATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGC
AGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTG
TCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAAC

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3270nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACC
TACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATT
TGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACC
TGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAA

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3021nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATT
ACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTAC

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_2565nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAA
ATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAG
GAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCA
GCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAA
TCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTC
ATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAG
AAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTC
CTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTA
TCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATC
CTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCA
CATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGC
CACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTA
TCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGG
GTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACA
GGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATG
AAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGA
ATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCA
GCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTAT

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_2565nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAA
ATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAG
GAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCA
GCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAA
TCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTC
ATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAG
AAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTC
CTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTA
TCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATC
CTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCA
CATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGC
CACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTA
TCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGG
GTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACA
GGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATG
AAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGA
ATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCA
GCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTAT

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_2787nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAA
ATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAG
GAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCA
GCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAA
TCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTC
ATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAG
AAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTC
CTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTA
TCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATC
CTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCA
CATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGC
CACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTA
TCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGG
GTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACA
GGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATG
AAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGA
ATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCA
GCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTAT
GACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCC
TCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCA

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_2988nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAA
ATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAG
GAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCA
GCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAA
TCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTC
ATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAG
AAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTC
CTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTA
TCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATC
CTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCA
CATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGC
CACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTA
TCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGG
GTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACA
GGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATG
AAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGA
ATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCA
GCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTAT
GACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCC
TCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCA
GGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACC
ATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTG
GTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAA

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3015nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAA
ATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAG
GAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCA
GCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAA
TCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTC
ATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAG
AAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTC
CTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTA
TCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATC
CTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCA
CATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGC
CACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTA
TCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGG
GTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACA
GGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATG
AAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGA
ATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCA
GCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTAT
GACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCC
TCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCA
CCTACAGCAACCACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAG
CAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGG
CAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTG

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_2766nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAA
ATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAG
GAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCA
GCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAA
TCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTC
ATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAG
AAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTC
CTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTA
TCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATC
CTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCA
CATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGC
CACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTA
TCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGG
GTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACA
GGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATG
AAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGA
ATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCA
GCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTAT
GACCCATCCAGTCCACAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAG
GATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCC

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_3135nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_3135nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3357nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTG
CCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATC
ACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACAT

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3558nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTG
CCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATC
ACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACAT
CAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACT
TGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGT

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3585nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTG
CCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATC
ACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTA
AGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGT
ACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATC

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3336nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAAC
GGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAA
GTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGC

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_2715nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCC

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_2715nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCC

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_2937nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCT
AACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTG
ACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGA

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3138nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCT
AACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTG
ACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGA
CTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCC
AGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCC

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3165nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCT
AACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTG
ACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACCTACACAGCCTCAGGC
ACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATG
AATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTT
CCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCA

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_2916nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCTG
AGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCT
GGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATT

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_2820nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_2820nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3042nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCC

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3243nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCC
AATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGC
AGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTG
TCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAAC

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3270nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACC
TACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATT
TGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACC
TGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAA

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3021nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATT
ACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTAC

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_3174nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGC
CAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAA
CGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAA
CGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTC
AAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACC
CCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACC
CCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGT
CCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTT
GCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACAT
GTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAA
GAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGAT
ATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGT
AAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTG
GAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTT
AAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAAT
CCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAG
GGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTG
TCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCA
AGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTG
TTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGT
GTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCT
CATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACC

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_3174nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGC
CAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAA
CGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAA
CGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTC
AAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACC
CCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACC
CCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGT
CCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTT
GCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACAT
GTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAA
GAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGAT
ATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGT
AAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTG
GAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTT
AAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAAT
CCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAG
GGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTG
TCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCA
AGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTG
TTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGT
GTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCT
CATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACC

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3396nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGC
CAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAA
CGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAA
CGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTC
AAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACC
CCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACC
CCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGT
CCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTT
GCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACAT
GTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAA
GAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGAT
ATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGT
AAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTG
GAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTT
AAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAAT
CCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAG
GGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTG
TCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCA
AGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTG
TTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGT
GTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCT
CATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACC
AGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTG
CGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGA

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3597nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGC
CAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAA
CGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAA
CGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTC
AAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACC
CCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACC
CCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGT
CCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTT
GCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACAT
GTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAA
GAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGAT
ATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGT
AAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTG
GAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTT
AAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAAT
CCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAG
GGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTG
TCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCA
AGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTG
TTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGT
GTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCT
CATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACC
AGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTG
CGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGA
TATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCAT
TTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAAT

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3624nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGC
CAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAA
CGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAA
CGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTC
AAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACC
CCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACC
CCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGT
CCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTT
GCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACAT
GTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAA
GAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGAT
ATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGT
AAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTG
GAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTT
AAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAAT
CCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAG
GGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTG
TCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCA
AGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTG
TTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGT
GTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCT
CATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACC
AGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTG
CGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACCTACACA
GCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGAC
TGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCT
AGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTC

>In-frame_MYB_ENST00000528774_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3375nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGC
CAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAA
CGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAA
CGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTC
AAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACC
CCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACC
CCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGT
CCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTT
GCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACAT
GTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAA
GAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGAT
ATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGT
AAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTG
GAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTT
AAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAAT
CCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAG
GGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTG
TCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCA
AGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTG
TTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGT
GTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCT
CATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACC
AGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGG
CAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTG

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_2820nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_2820nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3042nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCC

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3243nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCC
AATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGC
AGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTG
TCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAAC

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3270nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGT
GCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACC
TACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATT
TGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACC
TGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAA

>In-frame_MYB_ENST00000527615_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3021nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATT
ACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTAC

>In-frame_MYB_ENST00000341911_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_2187nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTT
TCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGG
GTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTT
CGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGT
TCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTA
ACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTT
TTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATT
AAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCT
GGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGTGGAATCTCCAACTGATAAATCAGGAAAC
TTCTTCTGCTCACACCACTGGGAAGGGGACAGTCTGAATACCCAACTGTTCACGCAGACCTCGCCTGTGGCAGATGCACCGAATATTCTT
ACAAGCTCCGTTTTAATGGCACCAGCATCAGAAGATGAAGACAATGTTCTCAAAGCATTTACAGTACCTAAAAACAGGTCCCTGGCGAGC

>In-frame_MYB_ENST00000316528_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_2082nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGTGGAATCTCCAACTGATAAATCAGGAAACTTC
TTCTGCTCACACCACTGGGAAGGGGACAGTCTGAATACCCAACTGTTCACGCAGACCTCGCCTGTGGCAGATGCACCGACTGGAGTGCAA
TGGCACGATTTCGGCTCACTGCAACCTCTGCCTCCCGGGTTCAAGCGATTCTCCTGCCTCAGTCTCCCGAGAAGCTGGGATTACAGGCAC
CCGCCACCACGCCCAGCTAATTTTGAATTTTTAGTAGAGACGGGGTTTCTCCATGTTGGTCAGGCTGGTCTTGAACTCCTGACCTCAGGT
GATCTACCCGCCTCGGCCTCCCAAAGTGCTAGGATTACAGGCGTGAGCCACCGCGCCCGGCCAGATAATATTCTTACAAGCTCCGTTTTA
ATGGCACCAGCATCAGAAGATGAAGACAATGTTCTCAAAGCATTTACAGTACCTAAAAACAGGTCCCTGGCGAGCCCCTTGCAGTCCTGG

>In-frame_MYB_ENST00000442647_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_1815nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCC
CTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCA
GCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCC
CTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCT
GAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGTGGAATCTCCAACTGATAAATCAGGAAACTTCTTCTGCTCA
CACCACTGGGAAGGGGACAGTCTGAATACCCAACTGTTCACGCAGACCTCGCCTGTGGCAGATGCACCGAATATTCTTACAAGCTCCGTT
TTAATGGCACCAGCATCAGAAGATGAAGACAATGTTCTCAAAGCATTTACAGTACCTAAAAACAGGTCCCTGGCGAGCCCCTTGCAGTCC

>In-frame_MYB_ENST00000367814_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_1824nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGTGGAATCTCCAACTGATAAATCAGGAAACTTC
TTCTGCTCACACCACTGGGAAGGGGACAGTCTGAATACCCAACTGTTCACGCAGACCTCGCCTGTGGCAGATGCACCGAATATTCTTACA
AGCTCCGTTTTAATGGCACCAGCATCAGAAGATGAAGACAATGTTCTCAAAGCATTTACAGTACCTAAAAACAGGTCCCTGGCGAGCCCC

>In-frame_MYB_ENST00000525369_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_1569nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAA
ATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAG
GAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCA
GCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAA
TCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGTGGAATCTCCAACTGAT
AAATCAGGAAACTTCTTCTGCTCACACCACTGGGAAGGGGACAGTCTGAATACCCAACTGTTCACGCAGACCTCGCCTGTGGCAGATGCA
CCGAATATTCTTACAAGCTCCGTTTTAATGGCACCAGCATCAGAAGATGAAGACAATGTTCTCAAAGCATTTACAGTACCTAAAAACAGG

>In-frame_MYB_ENST00000534121_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_2139nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGTGGAATCTCCAACTGATAAATCAGGAAACTTCTTCTGCTCACACCACTGGGAAGGGGACAGTCTGAATACCCAACTG
TTCACGCAGACCTCGCCTGTGGCAGATGCACCGAATATTCTTACAAGCTCCGTTTTAATGGCACCAGCATCAGAAGATGAAGACAATGTT

>In-frame_MYB_ENST00000533624_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_1719nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGTGGAATCTCCAACTGATAAATCAGGAAACTTCTTCTGCTCACACCAC
TGGGAAGGGGACAGTCTGAATACCCAACTGTTCACGCAGACCTCGCCTGTGGCAGATGCACCGAATATTCTTACAAGCTCCGTTTTAATG
GCACCAGCATCAGAAGATGAAGACAATGTTCTCAAAGCATTTACAGTACCTAAAAACAGGTCCCTGGCGAGCCCCTTGCAGTCCTGGTAC

>In-frame_MYB_ENST00000534044_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_1713nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGAATATTCTTACAAGCTCCGTTTTAATGGCACCA
GCATCAGAAGATGAAGACAATGTTCTCAAAGCATTTACAGTACCTAAAAACAGGTCCCTGGCGAGCCCCTTGCAGTCCTGGTACCTGGGC

>In-frame_MYB_ENST00000528774_chr6_135524462_+_NFIB_ENST00000380924_chr9_14088328_-_2178nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCC
GACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCC
CTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCA
GAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGC
CAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAA
CGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAA
CGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTC
AAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACC
CCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACC
CCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGT
CCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTT
GCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGTGGAATCTCCAACTGATAAATCAGGAAACTTCTTCTGC
TCACACCACTGGGAAGGGGACAGTCTGAATACCCAACTGTTCACGCAGACCTCGCCTGTGGCAGATGCACCGAATATTCTTACAAGCTCC
GTTTTAATGGCACCAGCATCAGAAGATGAAGACAATGTTCTCAAAGCATTTACAGTACCTAAAAACAGGTCCCTGGCGAGCCCCTTGCAG

>In-frame_MYB_ENST00000527615_chr6_135524462_+_NFIB_ENST00000380959_chr9_14088328_-_18nt

>In-frame_MYB_ENST00000527615_chr6_135524462_+_NFIB_ENST00000380953_chr9_14088328_-_18nt


* Fusion transcript sequences (Full-length transcript).
>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_9848nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATT
CTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGC
AGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCAC
AATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAG
CAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGA
CTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAAC
TCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGC
ACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAA
ACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCA
CCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAA
GCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATC
CAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTG
TGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCAT
GGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGT
CCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAG
TCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGT
AAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAA
CTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAG
TCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGAC
TACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCA
TCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCT
TCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACC
TTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCT
TACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACA
ACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAAC
TGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGA
TGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGAC
AATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAA
TCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGC
ACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCC
AGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTT
TGAACACAAAGGCTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCC
CACAAAAGAAACACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACT
CTAAATTGAGGGGATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAAT
CAAGACAAATCATGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTT
ATTTATTTAAAATTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCA
AATCCATGTCACAAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGT
AATCAGGGTGCTGAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGG
CAGACACATTTTGCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACA
TTACGTGCCTTGCCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTG
CTGCATTTATTATCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTT
TTTAGACAGTTATACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATAT
TTTCAGTATTTTGGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACG
AATTATGCAATACCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATA
ATGTATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGA
GAGATGGACAGGGGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAA
GCAGTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACT
TCCCACCTGGGTTGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGC
AGACTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTT
GGCAAAAATATTTGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGA
AAACACATTAGACCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGAT
TTACCTGTGACTTACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTG
AATGTATTTGGACTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAA
ACTGAGAACCAGAGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTT
TTTTAAGGAATGGTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCC
CTCACCGCCCAGTCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCC
CTGGCCCCCTTCCCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAA
TGCTTATGGGCTGGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAG
TTCAAAAGTAAGTCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATT
AGGTGAACAAATGAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAA
GTTACACACTGTGGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTC
TTTCCTTTTTGAGATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAG
TATATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCC
AAGGGCATGAGTAGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAG
TGCCTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACAT
AAAGACATGGCAAAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCT
GTGAAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTT
AAGAATTTTTTTTAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAG
TAAACAAGAATATTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATG
TTAGGAGTTATTTCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATG
AAGGTTATTTTGTTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATA
CGGCCTTTAGCAAAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAAC
AGTGCTATGTCTCACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCA
CAGGGACATCTTCAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAA
AGTTATCCCATATTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAAT
ATAGTTTACATGTTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAAC
TTTTTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGC
TGAAAGCTGCCTTCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTG
CAGTTGGGGGGTAACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCT
TTGTACTGTGTCCGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTT
GCAATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTG
TTGCAATTCAAATGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTG
CATGATACAGTACCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTAT
TTTTGACAGAATGGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTT
TTTTTTTTTTAAGAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAA
AGAAACAAACAAAAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTG
AGTTCAGTTGTAAATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAG
GCATAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAA
GAGCTGCCCCCACCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGA
CGAGTAGTCAGTTATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAG
AACCTTGTATTTTAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACG
ACAGTTACTTAATTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGA
GGATAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATG
TGATTGTTACTGTTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAA

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_9843nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATT
CTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGC
AGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCAC
AATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAG
CAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGA
CTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAAC
TCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGC
ACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAA
ACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCA
CCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAA
GCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATC
CAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTG
TGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCAT
GGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGT
CCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAG
TCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGT
AAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAA
CTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAG
TCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGAC
TACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCA
TCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCT
TCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACC
TTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCT
TACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACA
ACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAAC
TGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGA
TGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGAC
AATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAA
TCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGC
ACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCC
AGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTT
TGAACACAAAGGCTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCC
CACAAAAGAAACACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACT
CTAAATTGAGGGGATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAAT
CAAGACAAATCATGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTT
ATTTATTTAAAATTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCA
AATCCATGTCACAAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGT
AATCAGGGTGCTGAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGG
CAGACACATTTTGCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACA
TTACGTGCCTTGCCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTG
CTGCATTTATTATCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTT
TTTAGACAGTTATACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATAT
TTTCAGTATTTTGGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACG
AATTATGCAATACCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATA
ATGTATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGA
GAGATGGACAGGGGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAA
GCAGTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACT
TCCCACCTGGGTTGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGC
AGACTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTT
GGCAAAAATATTTGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGA
AAACACATTAGACCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGAT
TTACCTGTGACTTACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTG
AATGTATTTGGACTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAA
ACTGAGAACCAGAGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTT
TTTTAAGGAATGGTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCC
CTCACCGCCCAGTCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCC
CTGGCCCCCTTCCCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAA
TGCTTATGGGCTGGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAG
TTCAAAAGTAAGTCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATT
AGGTGAACAAATGAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAA
GTTACACACTGTGGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTC
TTTCCTTTTTGAGATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAG
TATATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCC
AAGGGCATGAGTAGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAG
TGCCTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACAT
AAAGACATGGCAAAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCT
GTGAAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTT
AAGAATTTTTTTTAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAG
TAAACAAGAATATTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATG
TTAGGAGTTATTTCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATG
AAGGTTATTTTGTTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATA
CGGCCTTTAGCAAAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAAC
AGTGCTATGTCTCACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCA
CAGGGACATCTTCAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAA
AGTTATCCCATATTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAAT
ATAGTTTACATGTTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAAC
TTTTTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGC
TGAAAGCTGCCTTCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTG
CAGTTGGGGGGTAACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCT
TTGTACTGTGTCCGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTT
GCAATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTG
TTGCAATTCAAATGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTG
CATGATACAGTACCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTAT
TTTTGACAGAATGGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTT
TTTTTTTTTTAAGAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAA
AGAAACAAACAAAAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTG
AGTTCAGTTGTAAATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAG
GCATAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAA
GAGCTGCCCCCACCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGA
CGAGTAGTCAGTTATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAG
AACCTTGTATTTTAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACG
ACAGTTACTTAATTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGA
GGATAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATG
TGATTGTTACTGTTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAA

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_4344nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATT
CTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGC
AGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCAC
AATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAG
CAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGA
CTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAAC
TCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGC
ACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAA
ACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCA
CCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAA
GCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATC
CAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTG
TGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCAT
GGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGT
CCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAG
TCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGT
AAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAA
CTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAG
TCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGAC
TACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCA
TCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCT
TCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACC
TTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTT
GGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACAC
AGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGTCCTGGTACCTGGG
CTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTT
TCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAG
GAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTA
ATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGT
TACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAG
CTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAG
AGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCT
TTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAA

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_4430nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATT
CTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGC
AGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCAC
AATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAG
CAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGA
CTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAAC
TCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGC
ACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAA
ACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCA
CCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAA
GCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATC
CAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTG
TGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCAT
GGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGT
CCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAG
TCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGT
AAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAA
CTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAG
TCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGAC
TACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCA
TCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCT
TCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACC
TTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTT
GGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACAC
AGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGA
CTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGC
TAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTT
CCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGG
AAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAA
TTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTT
ACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGC
TAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGA
GGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTT
TAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAA

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_4429nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATT
CTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGC
AGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCAC
AATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAG
CAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGA
CTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAAC
TCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGC
ACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAA
ACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCA
CCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAA
GCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATC
CAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTG
TGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCAT
GGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGT
CCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAG
TCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGT
AAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAA
CTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAG
TCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGAC
TACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCA
TCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCT
TCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACC
TTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTT
GGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGC
AGCTTCACCTACAGCAACCACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCT
ACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAAT
TACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTA
CGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTT
TTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACC
AGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGAT
CGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCT
AGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCAC
CAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAA
AAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCC

>In-frame_MYB_ENST00000341911_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_4177nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTGATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATT
CTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACTAAACCTGC
AGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCAC
AATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCTGACGTCAG
CAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACTTCCAGTAACCATGAAAACTCAGA
CTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAAC
TCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGC
ACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAA
ACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCA
CCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAA
GCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATC
CAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTG
TGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCAT
GGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGT
CCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAG
TCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGT
AAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAA
CTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAG
TCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGAC
TACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCA
TCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCT
TCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACC
TTCTTATGACCCATCCAGTCCACAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTAC
CAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTT
ACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAA
CAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACT
GAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGAT
GATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACA
ATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAAT
CACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCA
CTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCA

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_9485nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTT
GGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCA
AAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACT
TGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACA
GGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCC
ATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCA
TGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAG
GCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGT
CTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGT
GATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCA
GCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCC
AAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAG
AGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTC
GGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCC
TACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTAC
TATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCC
CGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCC
TCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTC
TTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTAC
CGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACA
ATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGA
AGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGA
TATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAAT
ATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCA
CTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACT
CTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGC
CTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGA
ACACAAAGGCTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCAC
AAAAGAAACACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTA
AATTGAGGGGATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAA
GACAAATCATGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATT
TATTTAAAATTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAAT
CCATGTCACAAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAAT
CAGGGTGCTGAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAG
ACACATTTTGCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTA
CGTGCCTTGCCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTG
CATTTATTATCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTT
AGACAGTTATACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTT
CAGTATTTTGGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAAT
TATGCAATACCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATG
TATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAG
ATGGACAGGGGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCA
GTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCC
CACCTGGGTTGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGA
CTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGC
AAAAATATTTGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAA
CACATTAGACCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTA
CCTGTGACTTACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAAT
GTATTTGGACTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACT
GAGAACCAGAGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTT
TAAGGAATGGTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTC
ACCGCCCAGTCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTG
GCCCCCTTCCCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGC
TTATGGGCTGGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTC
AAAAGTAAGTCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGG
TGAACAAATGAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTT
ACACACTGTGGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTT
CCTTTTTGAGATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTAT
ATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAG
GGCATGAGTAGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGC
CTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAA
GACATGGCAAAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTG
AAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAG
AATTTTTTTTAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGTAA
ACAAGAATATTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTA
GGAGTTATTTCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGAAG
GTTATTTTGTTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGG
CCTTTAGCAAAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACAGT
GCTATGTCTCACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAG
GGACATCTTCAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAAGT
TATCCCATATTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATA
GTTTACATGTTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACTTT
TTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGA
AAGCTGCCTTCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGCAG
TTGGGGGGTAACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTG
TACTGTGTCCGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTGCA
ATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTG
CAATTCAAATGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGCAT
GATACAGTACCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTT
TGACAGAATGGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTTTT
TTTTTTTAAGAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGA
AACAAACAAAAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGAGT
TCAGTTGTAAATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCA
TAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAGAG
CTGCCCCCACCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGA
GTAGTCAGTTATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGAAC
CTTGTATTTTAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACA
GTTACTTAATTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAGGA
TAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGA
TTGTTACTGTTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAACTG

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_9480nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTT
GGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCA
AAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACT
TGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACA
GGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCC
ATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCA
TGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAG
GCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGT
CTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGT
GATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCA
GCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCC
AAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAG
AGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTC
GGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCC
TACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTAC
TATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCC
CGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCC
TCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTC
TTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTAC
CGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACA
ATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGA
AGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGA
TATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAAT
ATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCA
CTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACT
CTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGC
CTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGA
ACACAAAGGCTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCAC
AAAAGAAACACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTA
AATTGAGGGGATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAA
GACAAATCATGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATT
TATTTAAAATTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAAT
CCATGTCACAAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAAT
CAGGGTGCTGAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAG
ACACATTTTGCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTA
CGTGCCTTGCCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTG
CATTTATTATCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTT
AGACAGTTATACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTT
CAGTATTTTGGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAAT
TATGCAATACCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATG
TATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAG
ATGGACAGGGGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCA
GTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCC
CACCTGGGTTGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGA
CTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGC
AAAAATATTTGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAA
CACATTAGACCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTA
CCTGTGACTTACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAAT
GTATTTGGACTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACT
GAGAACCAGAGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTT
TAAGGAATGGTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTC
ACCGCCCAGTCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTG
GCCCCCTTCCCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGC
TTATGGGCTGGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTC
AAAAGTAAGTCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGG
TGAACAAATGAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTT
ACACACTGTGGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTT
CCTTTTTGAGATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTAT
ATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAG
GGCATGAGTAGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGC
CTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAA
GACATGGCAAAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTG
AAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAG
AATTTTTTTTAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGTAA
ACAAGAATATTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTA
GGAGTTATTTCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGAAG
GTTATTTTGTTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGG
CCTTTAGCAAAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACAGT
GCTATGTCTCACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAG
GGACATCTTCAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAAGT
TATCCCATATTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATA
GTTTACATGTTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACTTT
TTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGA
AAGCTGCCTTCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGCAG
TTGGGGGGTAACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTG
TACTGTGTCCGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTGCA
ATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTG
CAATTCAAATGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGCAT
GATACAGTACCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTT
TGACAGAATGGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTTTT
TTTTTTTAAGAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGA
AACAAACAAAAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGAGT
TCAGTTGTAAATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCA
TAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAGAG
CTGCCCCCACCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGA
GTAGTCAGTTATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGAAC
CTTGTATTTTAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACA
GTTACTTAATTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAGGA
TAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGA
TTGTTACTGTTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAACTG

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3981nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTT
GGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCA
AAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACT
TGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACA
GGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCC
ATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCA
TGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAG
GCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGT
CTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGT
GATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCA
GCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCC
AAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAG
AGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTC
GGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCC
TACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTAC
TATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCC
CGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCC
TCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTC
TTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGC
ACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGC
CTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGTCCTGGTACCTGGGCTA
GCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCC
TTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAA
GACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATT
CCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTAC
ATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTA
GTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGG
TGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTA
GTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATG

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_4067nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTT
GGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCA
AAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACT
TGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACA
GGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCC
ATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCA
TGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAG
GCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGT
CTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGT
GATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCA
GCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCC
AAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAG
AGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTC
GGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCC
TACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTAC
TATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCC
CGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCC
TCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTC
TTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGC
ACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGC
CTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTG
GACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAG
CTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCT
TCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAG
ACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTC
CCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACA
TGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAG
TTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGT
GCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAG
TTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGA

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_4066nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTT
GGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCA
AAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACT
TGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACA
GGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCC
ATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCA
TGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAG
GCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGT
CTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGT
GATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCA
GCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCC
AAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAG
AGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTC
GGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCC
TACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTAC
TATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCC
CGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCC
TCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTC
TTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGC
ACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGC
TTCACCTACAGCAACCACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACA
TCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTAC
TTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGG
TTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTT
TAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGC
AATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGC
AGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGA
TGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAA
CGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAA
AATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGT

>In-frame_MYB_ENST00000316528_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3814nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTA
CCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCAC
TCCATCTCTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGA
TAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTT
GGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCA
AAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACT
TGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACA
GGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCC
ATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCA
TGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAG
GCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGT
CTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGT
GATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCA
GCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCC
AAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAG
AGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTC
GGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCC
TACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTAC
TATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCC
CGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCC
TCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTC
TTATGACCCATCCAGTCCACAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAG
TGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACC
GGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAA
TAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAA
GAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGAT
ATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATA
TATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCAC
TATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTC
TGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCC

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_9476nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTG
GCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCT
GCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAA
GAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCC
TTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAA
TACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCA
AGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGA
TGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGA
GGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCG
AATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGC
CAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAA
TCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTT
CAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCA
TATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAA
TGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAG
AACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAA
TCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGA
CTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAA
GCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACC
TGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCC
ATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCC
ATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATG
TCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAA
GAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAG
ATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACT
GATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAA
CTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTG
GTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCT
AAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAG
TGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGG
CTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCACAAAAGAAAC
ACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGG
GATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAAGACAAATCA
TGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAA
TTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAATCCATGTCAC
AAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAATCAGGGTGCT
GAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAGACACATTTT
GCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTACGTGCCTTG
CCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTGCATTTATTA
TCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTTAGACAGTTA
TACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTTCAGTATTTT
GGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAATTATGCAATA
CCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATGTATGCTTTT
TTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAGATGGACAGG
GGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCT
GAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCCCACCTGGGT
TGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGACTTGGCTTA
AAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGCAAAAATATT
TGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAACACATTAGA
CCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTACCTGTGACT
TACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAATGTATTTGGA
CTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACTGAGAACCAG
AGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTTTAAGGAATG
GTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAG
TCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTC
CCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGCTTATGGGCT
GGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAG
TCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGGTGAACAAAT
GAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTTACACACTGT
GGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGA
GATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTATATTCTGACG
AAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGT
AGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGCCTCTGAAGC
GTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAAGACATGGCA
AAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTGAAGCTGCAA
GTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAGAATTTTTTT
TAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGTAAACAAGAATA
TTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTAGGAGTTATT
TCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGAAGGTTATTTTG
TTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGGCCTTTAGCA
AAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACAGTGCTATGTCT
CACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAGGGACATCTT
CAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAAGTTATCCCATA
TTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATAGTTTACATG
TTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACTTTTTTTTTTTT
TTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCCT
TCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGCAGTTGGGGGGT
AACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTGTACTGTGTC
CGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTGCAATTTTTTCT
TCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTGCAATTCAAA
TGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGCATGATACAGTA
CCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTTTGACAGAAT
GGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTTTTTTTTTTTAA
GAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGAAACAAACAA
AAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGAGTTCAGTTGTA
AATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCATAGGTTTCT
CAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAGAGCTGCCCCCA
CCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGAGTAGTCAGT
TATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGAACCTTGTATTT
TAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACAGTTACTTAA
TTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAGGATAACGTTCT
TTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGATTGTTACTG
TTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAACTGTTTAAACAA

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_9471nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTG
GCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCT
GCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAA
GAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCC
TTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAA
TACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCA
AGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGA
TGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGA
GGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCG
AATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGC
CAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAA
TCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTT
CAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCA
TATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAA
TGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAG
AACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAA
TCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGA
CTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAA
GCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACC
TGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCC
ATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCC
ATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATG
TCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAA
GAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAG
ATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACT
GATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAA
CTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTG
GTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCT
AAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAG
TGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGG
CTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCACAAAAGAAAC
ACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGG
GATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAAGACAAATCA
TGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAA
TTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAATCCATGTCAC
AAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAATCAGGGTGCT
GAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAGACACATTTT
GCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTACGTGCCTTG
CCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTGCATTTATTA
TCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTTAGACAGTTA
TACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTTCAGTATTTT
GGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAATTATGCAATA
CCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATGTATGCTTTT
TTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAGATGGACAGG
GGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCT
GAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCCCACCTGGGT
TGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGACTTGGCTTA
AAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGCAAAAATATT
TGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAACACATTAGA
CCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTACCTGTGACT
TACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAATGTATTTGGA
CTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACTGAGAACCAG
AGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTTTAAGGAATG
GTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAG
TCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTC
CCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGCTTATGGGCT
GGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAG
TCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGGTGAACAAAT
GAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTTACACACTGT
GGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGA
GATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTATATTCTGACG
AAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGT
AGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGCCTCTGAAGC
GTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAAGACATGGCA
AAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTGAAGCTGCAA
GTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAGAATTTTTTT
TAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGTAAACAAGAATA
TTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTAGGAGTTATT
TCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGAAGGTTATTTTG
TTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGGCCTTTAGCA
AAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACAGTGCTATGTCT
CACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAGGGACATCTT
CAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAAGTTATCCCATA
TTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATAGTTTACATG
TTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACTTTTTTTTTTTT
TTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCCT
TCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGCAGTTGGGGGGT
AACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTGTACTGTGTC
CGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTGCAATTTTTTCT
TCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTGCAATTCAAA
TGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGCATGATACAGTA
CCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTTTGACAGAAT
GGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTTTTTTTTTTTAA
GAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGAAACAAACAA
AAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGAGTTCAGTTGTA
AATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCATAGGTTTCT
CAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAGAGCTGCCCCCA
CCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGAGTAGTCAGT
TATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGAACCTTGTATTT
TAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACAGTTACTTAA
TTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAGGATAACGTTCT
TTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGATTGTTACTG
TTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAACTGTTTAAACAA

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3972nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTG
GCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCT
GCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAA
GAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCC
TTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAA
TACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCA
AGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGA
TGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGA
GGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCG
AATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGC
CAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAA
TCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTT
CAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCA
TATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAA
TGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAG
AACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAA
TCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGA
CTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAA
GCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACC
TGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCC
ATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCC
ATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCC
CCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCAC
ATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGTCCTGGTACCTGGGCTAGCTTGGTTC
CTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAG
AAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACA
AAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGG
TTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCC
GCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTG
GTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTG
ACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGT
ACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAA

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_4058nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTG
GCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCT
GCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAA
GAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCC
TTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAA
TACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCA
AGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGA
TGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGA
GGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCG
AATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGC
CAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAA
TCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTT
CAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCA
TATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAA
TGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAG
AACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAA
TCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGA
CTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAA
GCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACC
TGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCC
ATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCC
ATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCC
CCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCAC
ATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAA
TCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCC
TTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGA
AACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAA
AACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGT
TGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCG
CTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGG
TTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGA
CAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTA
CAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAG

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_4057nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTG
GCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCT
GCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAA
GAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCC
TTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAA
TACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCA
AGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGA
TGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGA
GGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCG
AATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGC
CAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAA
TCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTT
CAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCA
TATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAA
TGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAG
AACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAA
TCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGA
CTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAA
GCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACC
TGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCC
ATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCC
ATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCC
CCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTAC
AGCAACCACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACA
GCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAG
TCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACAT
AATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAA
AAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGC
ACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGC
AACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAAT
ATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTA
GGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGA
AATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCT

>In-frame_MYB_ENST00000442647_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3805nt
AATATCAACCTGTTTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCG
GAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGA
GCCCCGCGCCCGCCGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCA
TGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCT
GGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAA
AGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACG
TTGGTCTGTTATTGCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAA
AACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCC
TGGACGAACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAA
AGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGC
CACTGGCCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGC
GTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCG
AATAAAGGAATTAGAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGACACAGAACCACACATGCAGCTACCCCGGGTG
GCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCT
GCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAA
GAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCC
TTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAA
TACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCA
AGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGA
TGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGA
GGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCG
AATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGC
CAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAA
TCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTT
CAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCA
TATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAA
TGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAG
AACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAA
TCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGA
CTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAA
GCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACC
TGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCC
ATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCC
ATCCAGTCCACAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATAC
ATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGT
CCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAG
AAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGA
TAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTG
ATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAAC
TGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGG
TTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTA
AAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGT

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_9472nt
TTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCGGAGCGCCGCTGCG
CAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGAGCCCCGCGCCCGC
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCAC
AGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCA
GCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAAC
CTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCT
TTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACT
GTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAA
ATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAA
TCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCA
CTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATG
TCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAA
CTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCC
GACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAA
GGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATC
ACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGAT
CCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACG
CCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTT
CAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTT
TACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCT
GAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGA
GTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCG
AGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCC
AGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCA
AAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAA
TTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAA
TAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATG
GTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGA
CTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTA
TCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAA
GTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTG
TAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGGCTCT
ATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCACAAAAGAAACACTT
AACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGGGATT
AAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAAGACAAATCATGTG
CTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAATTAC
TGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAATCCATGTCACAAGG
GTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAATCAGGGTGCTGAAA
ACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAGACACATTTTGCCT
CTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTACGTGCCTTGCCTT
GAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTGCATTTATTATCAT
TTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTTAGACAGTTATACC
TTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTTCAGTATTTTGGTG
TTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAATTATGCAATACCAA
GTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATGTATGCTTTTTTGT
TTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAGATGGACAGGGGAT
TTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCTGAGA
TGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCCCACCTGGGTTGCA
AGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGACTTGGCTTAAAAA
GGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGCAAAAATATTTGTT
GAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAACACATTAGACCTG
TTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTACCTGTGACTTACT
ACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAATGTATTTGGACTGA
TAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACTGAGAACCAGAGCA
GAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTTTAAGGAATGGTAC
CTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAGTCCC
ATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTCCCCT
AGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGCTTATGGGCTGGAG
AATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAGTCCA
ATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGGTGAACAAATGAAC
CTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTTACACACTGTGGGT
ATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGAGATA
AAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTATATTCTGACGAAGG
GCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGTAGGG
AGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGCCTCTGAAGCGTGT
TACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAAGACATGGCAAAAA
TCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTGAAGCTGCAAGTAG
CGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAGAATTTTTTTTAAA
TTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGTAAACAAGAATATTCC
TTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTAGGAGTTATTTCAC
AGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGAAGGTTATTTTGTTGT
ATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGGCCTTTAGCAAAAG
TTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACAGTGCTATGTCTCACA
TAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAGGGACATCTTCAGC
GGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAAGTTATCCCATATTCA
GTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATAGTTTACATGTTCC
TGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACTTTTTTTTTTTTTTTT
TTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCCTTCTT
CATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGCAGTTGGGGGGTAACA
TGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTGTACTGTGTCCGTG
CCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTGCAATTTTTTCTTCAA
TGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTGCAATTCAAATGTA
TGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGCATGATACAGTACCAG
GAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTTTGACAGAATGGTT
TTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTTTTTTTTTTTAAGAAG
TATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGAAACAAACAAAAAA
AAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGAGTTCAGTTGTAAATA
TGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCATAGGTTTCTCAAA
GCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAGAGCTGCCCCCACCTC
AATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGAGTAGTCAGTTATT
GCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGAACCTTGTATTTTAAT
TAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACAGTTACTTAATTTC
TAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAGGATAACGTTCTTTGG
GTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGATTGTTACTGTTAT
ATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAACTGTTTAAACAATAAA

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_9467nt
TTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCGGAGCGCCGCTGCG
CAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGAGCCCCGCGCCCGC
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCAC
AGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCA
GCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAAC
CTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCT
TTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACT
GTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAA
ATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAA
TCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCA
CTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATG
TCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAA
CTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCC
GACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAA
GGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATC
ACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGAT
CCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACG
CCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTT
CAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTT
TACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCT
GAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGA
GTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCG
AGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCC
AGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCA
AAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAA
TTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAA
TAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATG
GTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGA
CTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTA
TCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAA
GTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTG
TAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGGCTCT
ATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCACAAAAGAAACACTT
AACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGGGATT
AAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAAGACAAATCATGTG
CTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAATTAC
TGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAATCCATGTCACAAGG
GTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAATCAGGGTGCTGAAA
ACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAGACACATTTTGCCT
CTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTACGTGCCTTGCCTT
GAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTGCATTTATTATCAT
TTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTTAGACAGTTATACC
TTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTTCAGTATTTTGGTG
TTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAATTATGCAATACCAA
GTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATGTATGCTTTTTTGT
TTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAGATGGACAGGGGAT
TTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCTGAGA
TGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCCCACCTGGGTTGCA
AGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGACTTGGCTTAAAAA
GGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGCAAAAATATTTGTT
GAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAACACATTAGACCTG
TTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTACCTGTGACTTACT
ACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAATGTATTTGGACTGA
TAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACTGAGAACCAGAGCA
GAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTTTAAGGAATGGTAC
CTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAGTCCC
ATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTCCCCT
AGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGCTTATGGGCTGGAG
AATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAGTCCA
ATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGGTGAACAAATGAAC
CTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTTACACACTGTGGGT
ATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGAGATA
AAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTATATTCTGACGAAGG
GCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGTAGGG
AGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGCCTCTGAAGCGTGT
TACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAAGACATGGCAAAAA
TCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTGAAGCTGCAAGTAG
CGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAGAATTTTTTTTAAA
TTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGTAAACAAGAATATTCC
TTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTAGGAGTTATTTCAC
AGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGAAGGTTATTTTGTTGT
ATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGGCCTTTAGCAAAAG
TTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACAGTGCTATGTCTCACA
TAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAGGGACATCTTCAGC
GGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAAGTTATCCCATATTCA
GTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATAGTTTACATGTTCC
TGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACTTTTTTTTTTTTTTTT
TTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCCTTCTT
CATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGCAGTTGGGGGGTAACA
TGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTGTACTGTGTCCGTG
CCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTGCAATTTTTTCTTCAA
TGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTGCAATTCAAATGTA
TGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGCATGATACAGTACCAG
GAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTTTGACAGAATGGTT
TTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTTTTTTTTTTTAAGAAG
TATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGAAACAAACAAAAAA
AAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGAGTTCAGTTGTAAATA
TGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCATAGGTTTCTCAAA
GCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAGAGCTGCCCCCACCTC
AATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGAGTAGTCAGTTATT
GCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGAACCTTGTATTTTAAT
TAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACAGTTACTTAATTTC
TAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAGGATAACGTTCTTTGG
GTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGATTGTTACTGTTAT
ATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAACTGTTTAAACAATAAA

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3968nt
TTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCGGAGCGCCGCTGCG
CAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGAGCCCCGCGCCCGC
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCAC
AGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCA
GCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAAC
CTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCT
TTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACT
GTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAA
ATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAA
TCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCA
CTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATG
TCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAA
CTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCC
GACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAA
GGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATC
ACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGAT
CCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACG
CCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTT
CAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTT
TACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCT
GAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGA
GTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCG
AGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCC
AGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCAT
CCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCT
CAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTT
CCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAAC
AAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAAC
AACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGA
AACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTG
GGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTT
AGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAG
AGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAG
ATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAA

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_4054nt
TTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCGGAGCGCCGCTGCG
CAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGAGCCCCGCGCCCGC
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCAC
AGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCA
GCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAAC
CTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCT
TTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACT
GTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAA
ATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAA
TCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCA
CTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATG
TCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAA
CTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCC
GACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAA
GGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATC
ACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGAT
CCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACG
CCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTT
CAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTT
TACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCT
GAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGA
GTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCG
AGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCC
AGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCAT
CCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCT
CAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAA
AACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTC
CAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACA
AGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACA
ACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAA
ACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGG
GAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTA
GTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGA
GCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGA
TTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAA

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_4053nt
TTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCGGAGCGCCGCTGCG
CAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGAGCCCCGCGCCCGC
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCAC
AGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCA
GCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAAC
CTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCT
TTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACT
GTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAA
ATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAA
TCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCA
CTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATG
TCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAA
CTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCC
GACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAA
GGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATC
ACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGAT
CCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACG
CCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTT
CAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTT
TACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCT
GAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGA
GTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCG
AGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCC
AGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCAT
CCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCA
ACCACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTG
AGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCT
GGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATT
GGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAA
AGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTT
ACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACG
TAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTT
GCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAG
GCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATC
TCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAA

>In-frame_MYB_ENST00000367814_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3801nt
TTCCTCCTCCTCCTTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGGTGCGGAGCGCCGCTGCG
CAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCGGCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGAGCCCCGCGCCCGC
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCAC
AGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCA
GCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAAC
CTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCT
TTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACT
GTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAA
ATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAA
TCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCA
CTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATG
TCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAA
CTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCC
GACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAA
GGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATC
ACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGAT
CCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACG
CCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTT
CAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTT
TACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCT
GAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGA
GTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCG
AGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCC
AGTCCACAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTG
GGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAA
AATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAAT
TTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAAT
AGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGG
TAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGAC
TTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTAT
CTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAG
TTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGT

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_9037nt
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGAC
TTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACT
CAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCA
CTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAA
CAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCAC
CCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAG
CATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCC
AGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGT
GTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATG
GTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTC
CAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGT
CCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTA
AGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAAC
TCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGT
CCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACT
ACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCAT
CCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTT
CCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCT
TCTTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTT
ACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAA
CAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACT
GAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGAT
GATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACA
ATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAAT
CACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCA
CTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCA
GCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTT
GAACACAAAGGCTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCC
ACAAAAGAAACACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTC
TAAATTGAGGGGATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATC
AAGACAAATCATGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTA
TTTATTTAAAATTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAA
ATCCATGTCACAAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTA
ATCAGGGTGCTGAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGC
AGACACATTTTGCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACAT
TACGTGCCTTGCCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGC
TGCATTTATTATCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTT
TTAGACAGTTATACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATT
TTCAGTATTTTGGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGA
ATTATGCAATACCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAA
TGTATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAG
AGATGGACAGGGGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAG
CAGTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTT
CCCACCTGGGTTGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCA
GACTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTG
GCAAAAATATTTGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAA
AACACATTAGACCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATT
TACCTGTGACTTACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGA
ATGTATTTGGACTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAA
CTGAGAACCAGAGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTT
TTTAAGGAATGGTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCC
TCACCGCCCAGTCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCC
TGGCCCCCTTCCCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAAT
GCTTATGGGCTGGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGT
TCAAAAGTAAGTCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTA
GGTGAACAAATGAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAG
TTACACACTGTGGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCT
TTCCTTTTTGAGATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGT
ATATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCA
AGGGCATGAGTAGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGT
GCCTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATA
AAGACATGGCAAAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTG
TGAAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTA
AGAATTTTTTTTAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGT
AAACAAGAATATTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGT
TAGGAGTTATTTCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGA
AGGTTATTTTGTTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATAC
GGCCTTTAGCAAAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACA
GTGCTATGTCTCACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCAC
AGGGACATCTTCAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAA
GTTATCCCATATTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATA
TAGTTTACATGTTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACT
TTTTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCT
GAAAGCTGCCTTCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGC
AGTTGGGGGGTAACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTT
TGTACTGTGTCCGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTG
CAATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGT
TGCAATTCAAATGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGC
ATGATACAGTACCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATT
TTTGACAGAATGGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTT
TTTTTTTTTAAGAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAA
GAAACAAACAAAAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGA
GTTCAGTTGTAAATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGG
CATAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAG
AGCTGCCCCCACCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGAC
GAGTAGTCAGTTATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGA
ACCTTGTATTTTAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGA
CAGTTACTTAATTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAG
GATAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGT
GATTGTTACTGTTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAAC

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_9032nt
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGAC
TTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACT
CAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCA
CTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAA
CAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCAC
CCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAG
CATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCC
AGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGT
GTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATG
GTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTC
CAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGT
CCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTA
AGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAAC
TCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGT
CCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACT
ACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCAT
CCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTT
CCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCT
TCTTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTT
ACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAA
CAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACT
GAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGAT
GATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACA
ATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAAT
CACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCA
CTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCA
GCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTT
GAACACAAAGGCTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCC
ACAAAAGAAACACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTC
TAAATTGAGGGGATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATC
AAGACAAATCATGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTA
TTTATTTAAAATTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAA
ATCCATGTCACAAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTA
ATCAGGGTGCTGAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGC
AGACACATTTTGCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACAT
TACGTGCCTTGCCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGC
TGCATTTATTATCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTT
TTAGACAGTTATACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATT
TTCAGTATTTTGGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGA
ATTATGCAATACCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAA
TGTATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAG
AGATGGACAGGGGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAG
CAGTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTT
CCCACCTGGGTTGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCA
GACTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTG
GCAAAAATATTTGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAA
AACACATTAGACCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATT
TACCTGTGACTTACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGA
ATGTATTTGGACTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAA
CTGAGAACCAGAGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTT
TTTAAGGAATGGTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCC
TCACCGCCCAGTCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCC
TGGCCCCCTTCCCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAAT
GCTTATGGGCTGGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGT
TCAAAAGTAAGTCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTA
GGTGAACAAATGAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAG
TTACACACTGTGGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCT
TTCCTTTTTGAGATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGT
ATATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCA
AGGGCATGAGTAGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGT
GCCTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATA
AAGACATGGCAAAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTG
TGAAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTA
AGAATTTTTTTTAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGT
AAACAAGAATATTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGT
TAGGAGTTATTTCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGA
AGGTTATTTTGTTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATAC
GGCCTTTAGCAAAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACA
GTGCTATGTCTCACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCAC
AGGGACATCTTCAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAA
GTTATCCCATATTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATA
TAGTTTACATGTTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACT
TTTTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCT
GAAAGCTGCCTTCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGC
AGTTGGGGGGTAACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTT
TGTACTGTGTCCGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTG
CAATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGT
TGCAATTCAAATGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGC
ATGATACAGTACCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATT
TTTGACAGAATGGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTT
TTTTTTTTTAAGAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAA
GAAACAAACAAAAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGA
GTTCAGTTGTAAATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGG
CATAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAG
AGCTGCCCCCACCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGAC
GAGTAGTCAGTTATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGA
ACCTTGTATTTTAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGA
CAGTTACTTAATTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAG
GATAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGT
GATTGTTACTGTTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAAC

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3533nt
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGAC
TTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACT
CAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCA
CTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAA
CAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCAC
CCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAG
CATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCC
AGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGT
GTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATG
GTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTC
CAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGT
CCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTA
AGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAAC
TCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGT
CCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACT
ACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCAT
CCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTT
CCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCT
TCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTG
GCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACA
GCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGTCCTGGTACCTGGGC
TAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTT
CCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGG
AAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAA
TTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTT
ACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGC
TAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGA
GGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTT
TAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAA

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3619nt
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGAC
TTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACT
CAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCA
CTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAA
CAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCAC
CCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAG
CATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCC
AGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGT
GTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATG
GTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTC
CAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGT
CCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTA
AGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAAC
TCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGT
CCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACT
ACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCAT
CCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTT
CCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCT
TCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTG
GCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACA
GCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGAC
TGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCT
AGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTC
CTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGA
AGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAAT
TCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTA
CATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCT
AGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAG
GTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTT
AGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAAT

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3618nt
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGAC
TTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACT
CAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCA
CTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAA
CAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCAC
CCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAG
CATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCC
AGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGT
GTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATG
GTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTC
CAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGT
CCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTA
AGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAAC
TCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGT
CCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACT
ACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCAT
CCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTT
CCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCT
TCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTG
GCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCA
GCTTCACCTACAGCAACCACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTA
CATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATT
ACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTAC
GGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTT
TTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCA
GCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATC
GCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTA
GATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACC
AACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAA
AAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCA

>In-frame_MYB_ENST00000525369_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3366nt
CGCGCCATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGG
CTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAAT
GGAACAGATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCT
GAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATT
GCCAAGCACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACA
GAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGAT
AATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCA
GCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCC
ACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAAT
ATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTA
GAATTGCTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTCTTAAACACTTCCAGTAACCATGAAAACTCAGAC
TTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACT
CAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCA
CTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAA
CAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCAC
CCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAG
CATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCC
AGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGT
GTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATG
GTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTC
CAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGT
CCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTA
AGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAAC
TCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGT
CCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACT
ACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCAT
CCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTT
CCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCT
TCTTATGACCCATCCAGTCCACAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACC
AGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTA
CCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAAC
AATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTG
AAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATG
ATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAA
TATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATC
ACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCAC
TCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAG

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_9601nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCA
AGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAG
CAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAAC
ACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAAC
TGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGA
AATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGT
ATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGC
CATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATT
TATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAA
AAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGGCTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGT
AAAAATTAATATAATATTTTCCCCACAAAAGAAACACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATT
ATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGGGATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTG
AGGGCATTAAAAAGGCATTAAATCAAGACAAATCATGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTG
CAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAATTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCA
TTATAGAGACAAAGAGGCAGGCAAATCCATGTCACAAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAA
CGCACTCTTGAGAAAACAAATGTAATCAGGGTGCTGAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATT
GACAGATCCATAGTGTGCATGGGCAGACACATTTTGCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATT
TGCACGAAGATATAATGTCCACATTACGTGCCTTGCCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAA
GTGACATCACTACACTTGTTTTGCTGCATTTATTATCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGA
AAAATGTGTGACATCATGGATTTTTTAGACAGTTATACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAA
AAATTGTAATCGACCAGCAATATTTTCAGTATTTTGGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGG
GGGAGGGGTTTCAAATTTATACGAATTATGCAATACCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAG
TACACAGATTTAAAAAAAAAATAATGTATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGT
GATGAGGTCCTTTTGTGTACTGAGAGATGGACAGGGGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTA
ACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACT
TACACAGGTTCCCCTCTCTAACTTCCCACCTGGGTTGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAA
ACACAACAAATTCTCCTGGAGGCAGACTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTG
GAGAGTGAGCCTGTCTCATATTTGGCAAAAATATTTGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAAC
ACATGAATATTCTTTCTCCTAGAAAACACATTAGACCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCA
TTTCATTAATGATAGGATATGATTTACCTGTGACTTACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGAT
TGAACAGAGGGTTGCTATTGTTGAATGTATTTGGACTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTT
TTCATTTTATCTCCCCTTTTAAAACTGAGAACCAGAGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAA
CCCATTAGATGCTGATGGGATTTTTTTAAGGAATGGTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGA
GGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAGTCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACAT
GGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTCCCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATT
TAATAATGAATACTTTAGAACAATGCTTATGGGCTGGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCA
CAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAGTCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGC
TCTTCATGTATCTTTGACCTATTAGGTGAACAAATGAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCC
AGTGAGCAGTTCTAGCTAACCAAGTTACACACTGTGGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTT
TATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGAGATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGG
CCTCCTCCTCGTGTACCAGGAAGTATATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAG
CTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGTAGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCT
GCCCTGCCACCCACCACTCACAGTGCCTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAA
AGGCAGTGAAGGAGACTGTACATAAAGACATGGCAAAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCA
TTAAAAAATATGTGAATGAATCTGTGAAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAA
TTTGTACACTGTATAGTTTTGTTAAGAATTTTTTTTAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACT
ATATGTTGTTTCCATTTTTAAAGTAAACAAGAATATTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGT
ATTAAAAAGAAAATCTGTCCATGTTAGGAGTTATTTCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAA
ATGGAGAAAAGTTATATTTTATGAAGGTTATTTTGTTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCAC
CACTGTCTTTTTATTAGTATATACGGCCTTTAGCAAAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATT
CAGGATAGGCAGAAAACTAAAACAGTGCTATGTCTCACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATA
AGGACTCAACGAAAGAGATTGCACAGGGACATCTTCAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGT
GTGAAATGATGAAGGCTGCAGAAAGTTATCCCATATTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGAT
AGGCCCCAAGCATGACATTCAATATAGTTTACATGTTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAA
GAAATTGGGTTTCTATAGAAAACTTTTTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAAT
GTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCCTTCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAAT
TGTGTGGGTGGAGTGGAGCCCTGCAGTTGGGGGGTAACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCC
AAACTCATTGCCATGACAACTCTTTGTACTGTGTCCGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGAC
GGTCAATTTTTACATTTTTTGTTGCAATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTT
AATACTCTAGAAATATCTGTGTGTTGCAATTCAAATGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAG
ACTAAGCCCTTGATGACTTATTGCATGATACAGTACCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTA
AAGCCAGTCTTGTATTACTGTATTTTTGACAGAATGGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAG
AAGGAAGTCTTTTTTTTTCTTTTTTTTTTTTTTAAGAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGA
TAAAAGTTGATGCAAAACAAGAAAGAAACAAACAAAAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCT
GTTCAATTTCACAGTCTCTGTTGAGTTCAGTTGTAAATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAA
TGTGAGGGGTAACTACATCCCAGGCATAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATA
TAGAACTTTTAGCATCCTGGGAAGAGCTGCCCCCACCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGAT
ACATTTAGTACAACTGTAGGTGACGAGTAGTCAGTTATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTT
GTCCTCATGGGCCATAAATACAGAACCTTGTATTTTAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCT
TTAGCAGTAGGATGTATTATACGACAGTTACTTAATTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGA
AGGTTTTATTGTGCCCGGTTGGAGGATAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGG
TGTAAATCAAGCTTGACTTAATGTGATTGTTACTGTTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAG

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_9596nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCA
AGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAG
CAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAAC
ACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAAC
TGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGA
AATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGT
ATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGC
CATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATT
TATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAA
AAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGGCTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGT
AAAAATTAATATAATATTTTCCCCACAAAAGAAACACTTAACAGAGGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATT
ATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGGGATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTG
AGGGCATTAAAAAGGCATTAAATCAAGACAAATCATGTGCTTGAGAAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTG
CAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAATTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCA
TTATAGAGACAAAGAGGCAGGCAAATCCATGTCACAAGGGTAAAGCTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAA
CGCACTCTTGAGAAAACAAATGTAATCAGGGTGCTGAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATT
GACAGATCCATAGTGTGCATGGGCAGACACATTTTGCCTCTATGTCTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATT
TGCACGAAGATATAATGTCCACATTACGTGCCTTGCCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAA
GTGACATCACTACACTTGTTTTGCTGCATTTATTATCATTTTAAATCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGA
AAAATGTGTGACATCATGGATTTTTTAGACAGTTATACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAA
AAATTGTAATCGACCAGCAATATTTTCAGTATTTTGGTGTTTTTTTCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGG
GGGAGGGGTTTCAAATTTATACGAATTATGCAATACCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAG
TACACAGATTTAAAAAAAAAATAATGTATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGT
GATGAGGTCCTTTTGTGTACTGAGAGATGGACAGGGGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTA
ACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACT
TACACAGGTTCCCCTCTCTAACTTCCCACCTGGGTTGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAA
ACACAACAAATTCTCCTGGAGGCAGACTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTG
GAGAGTGAGCCTGTCTCATATTTGGCAAAAATATTTGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAAC
ACATGAATATTCTTTCTCCTAGAAAACACATTAGACCTGTTGGAGGGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCA
TTTCATTAATGATAGGATATGATTTACCTGTGACTTACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGAT
TGAACAGAGGGTTGCTATTGTTGAATGTATTTGGACTGATAGATTAAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTT
TTCATTTTATCTCCCCTTTTAAAACTGAGAACCAGAGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAA
CCCATTAGATGCTGATGGGATTTTTTTAAGGAATGGTACCTTAACTATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGA
GGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAGTCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACAT
GGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTCCCCTAGGCCATGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATT
TAATAATGAATACTTTAGAACAATGCTTATGGGCTGGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCA
CAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAGTCCAATCATTTCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGC
TCTTCATGTATCTTTGACCTATTAGGTGAACAAATGAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCC
AGTGAGCAGTTCTAGCTAACCAAGTTACACACTGTGGGTATTCCTGCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTT
TATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGAGATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGG
CCTCCTCCTCGTGTACCAGGAAGTATATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAG
CTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGTAGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCT
GCCCTGCCACCCACCACTCACAGTGCCTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAA
AGGCAGTGAAGGAGACTGTACATAAAGACATGGCAAAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCA
TTAAAAAATATGTGAATGAATCTGTGAAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAA
TTTGTACACTGTATAGTTTTGTTAAGAATTTTTTTTAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACT
ATATGTTGTTTCCATTTTTAAAGTAAACAAGAATATTCCTTGTTTAGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGT
ATTAAAAAGAAAATCTGTCCATGTTAGGAGTTATTTCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAA
ATGGAGAAAAGTTATATTTTATGAAGGTTATTTTGTTGTATTTAGTATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCAC
CACTGTCTTTTTATTAGTATATACGGCCTTTAGCAAAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATT
CAGGATAGGCAGAAAACTAAAACAGTGCTATGTCTCACATAACGTGTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATA
AGGACTCAACGAAAGAGATTGCACAGGGACATCTTCAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGT
GTGAAATGATGAAGGCTGCAGAAAGTTATCCCATATTCAGTGTACAGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGAT
AGGCCCCAAGCATGACATTCAATATAGTTTACATGTTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAA
GAAATTGGGTTTCTATAGAAAACTTTTTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAAT
GTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCCTTCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAAT
TGTGTGGGTGGAGTGGAGCCCTGCAGTTGGGGGGTAACATGGACCACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCC
AAACTCATTGCCATGACAACTCTTTGTACTGTGTCCGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGAC
GGTCAATTTTTACATTTTTTGTTGCAATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTT
AATACTCTAGAAATATCTGTGTGTTGCAATTCAAATGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAG
ACTAAGCCCTTGATGACTTATTGCATGATACAGTACCAGGAACAACAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTA
AAGCCAGTCTTGTATTACTGTATTTTTGACAGAATGGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAG
AAGGAAGTCTTTTTTTTTCTTTTTTTTTTTTTTAAGAAGTATGGCTTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGA
TAAAAGTTGATGCAAAACAAGAAAGAAACAAACAAAAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCT
GTTCAATTTCACAGTCTCTGTTGAGTTCAGTTGTAAATATGTTTCAAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAA
TGTGAGGGGTAACTACATCCCAGGCATAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATA
TAGAACTTTTAGCATCCTGGGAAGAGCTGCCCCCACCTCAATGATATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGAT
ACATTTAGTACAACTGTAGGTGACGAGTAGTCAGTTATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTT
GTCCTCATGGGCCATAAATACAGAACCTTGTATTTTAATTAAATTTTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCT
TTAGCAGTAGGATGTATTATACGACAGTTACTTAATTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGA
AGGTTTTATTGTGCCCGGTTGGAGGATAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGG
TGTAAATCAAGCTTGACTTAATGTGATTGTTACTGTTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAG

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_4097nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTG
CCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATC
ACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACAT
CAGCAACAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGG
TTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTT
TAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGC
AATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGC
AGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGA
TGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAA
CGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAA
AATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGT

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_4183nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTG
CCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATC
ACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACAT
CAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACT
TGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGT
TTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTT
AAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCA
ATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCA
GCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGAT
GCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAAC
GAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAA
ATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTT

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_4182nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTG
CCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATGACAGATACTAAACCCATC
ACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTA
AGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGT
ACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATC
TTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACAC
AACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAA
CTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCG
ATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGA
CAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGA
ATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAG
CACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACC

>In-frame_MYB_ENST00000534121_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3930nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGATTCTTCATCATGG
TGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCACCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGA
GAGGGCAATGGGACTAAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTTGACCCACCCAAGGTC
TTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGAAAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGC
TCCTTCATATTTGCTGACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCGCAGTTCTTAAACACT
TCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTT
CATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGA
ACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTA
GAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAA
ATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCT
CGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCT
GAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTG
ACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAA
GTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACAT
TGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAG
CAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGA
GTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGC
CAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCC
ATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGA
GATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTG
AGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTG
CCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAG
GATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCTGAGGATTTGTGACTGGACCATGAATCAAAAC
GGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAA
GTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGC
AACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACA
CAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACT
GTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAA
ATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTA
TTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCC
ATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTT

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_9181nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCC
TGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAAT
TGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAA
AAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACT
TACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAAC
GTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATT
TGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGA
GGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAAT
CTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAA
AAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGGCTCTATGGAAGAAATGCCTCTATGT
AGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCACAAAAGAAACACTTAACAGAGGCAAGTGCAATTTA
TAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGGGATTAAAAAGAATTTAAAATAATTT
TGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAAGACAAATCATGTGCTTGAGAAAAATAAAATTAAT
GAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAATTACTGGTTGCATCAAGAACCCATA
GGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAATCCATGTCACAAGGGTAAAGCTTACAGTTTACAAA
CTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAATCAGGGTGCTGAAAACTTGCATGGTGCTTTCAGAC
ATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAGACACATTTTGCCTCTATGTCTCTTAAAATTTTAA
TTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTACGTGCCTTGCCTTGAAATCTAAAAAACAAAAAAC
AAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTGCATTTATTATCATTTTAAATCTTTACCATTTTTA
TGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTTAGACAGTTATACCTTTATCTCACATTTATAAAGC
ATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTTCAGTATTTTGGTGTTTTTTTCTATTAACCTTTCA
TGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAATTATGCAATACCAAGTTTTGCCTATGTAGGTAGTG
CTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATGTATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGA
CCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAGATGGACAGGGGATTTTTTTTAATATACATATATA
TATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGA
CTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCCCACCTGGGTTGCAAGCTGAACTCATTACTGGTTT
TCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGACTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATA
GTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGCAAAAATATTTGTTGAAATGTCCACATAGGGGATG
TTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAACACATTAGACCTGTTGGAGGGAGTCTCCCGTATT
CCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTACCTGTGACTTACTACTTCAAATGGATGGCAGTGC
ACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAATGTATTTGGACTGATAGATTAAAATCAAAGTTCAA
TTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACTGAGAACCAGAGCAGAAGGGAAATATAGAATTTTA
AGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTTTAAGGAATGGTACCTTAACTATATATTTGATTTC
GTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAGTCCCATTGAGTGTATTCATTACTAG
AAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTCCCCTAGGCCATGGCCTAATAAAATA
AACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGCTTATGGGCTGGAGAATTGTATTTGATTAGCCCAT
TCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAGTCCAATCATTTCTGTGATACTCGCC
CTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGGTGAACAAATGAACCTCACAGGACACACAGTATTT
TTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTTACACACTGTGGGTATTCCTGCCTGCCTCTTGAAT
ACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGAGATAAAACTATTAAAAGTACTACTA
TATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTATATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTG
CACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGTAGGGAGTGGTGTCTCCAACCATCAG
TTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGCCTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGC
ATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAAGACATGGCAAAAATCTTAATTATAGCAATATAGT
TATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTGAAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTC
TTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAGAATTTTTTTTAAATTAAAATTCCCATGTTTGTAA
AGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGTAAACAAGAATATTCCTTGTTTAGAGACTGGACTTGA
GTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTAGGAGTTATTTCACAGATTCCTGTGCTTGAAAAGC
ATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGAAGGTTATTTTGTTGTATTTAGTATTGGAAAAGTTGG
TTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGGCCTTTAGCAAAAGTTTTTGTGATTGTTACGTGAT
GGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACAGTGCTATGTCTCACATAACGTGTCCTCAGGGAGCAG
AATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAGGGACATCTTCAGCGGTGTGACAGCAGGACATGTT
CTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAAGTTATCCCATATTCAGTGTACAGTATTCATTTTTAA
TGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATAGTTTACATGTTCCTGTCAAGGTCTTTTGTTAACA
TTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACTTTTTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTC
AAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCCTTCTTCATATTTTGCACTTTCTGGTA
GTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGCAGTTGGGGGGTAACATGGACCACTGATTTTGCCCTT
TGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTGTACTGTGTCCGTGCCACAGATCTGTTGGTCACAT
TGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTGCAATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTT
TTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTGCAATTCAAATGTATGTTGAGATTGTGAAAAGCGC
TTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGCATGATACAGTACCAGGAACAACAGGTGGCCTAAATA
CATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTTTGACAGAATGGTTTTGAAAACTGTGCTACAGGGA
CTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTTTTTTTTTTTAAGAAGTATGGCTTTTTATGCATCCTT
CATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGAAACAAACAAAAAAAAAAAACCAGCAAAATGTTTA
CCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGAGTTCAGTTGTAAATATGTTTCAAATGACATTTTCTT
GGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCATAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTC
ATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAGAGCTGCCCCCACCTCAATGATATTTCTCTGAGAACA
ACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGAGTAGTCAGTTATTGCTTGCTAGCTACACACCAGG
GTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGAACCTTGTATTTTAATTAAATTTTTTTACAAAAGGAG
GCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACAGTTACTTAATTTCTAGAGTTCAGGCCTCTGGGAT
CAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAGGATAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAA
TGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGATTGTTACTGTTATATCCAGCCTATACTGCTAGCA
GCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAACTGTTTAAACAATAAAATGAGCTATGCTACAGACTCT

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_9176nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCC
TGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAAT
TGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAA
AAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACT
TACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAAC
GTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATT
TGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGA
GGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAAT
CTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAA
AAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGGCTCTATGGAAGAAATGCCTCTATGT
AGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCACAAAAGAAACACTTAACAGAGGCAAGTGCAATTTA
TAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGGGATTAAAAAGAATTTAAAATAATTT
TGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAAGACAAATCATGTGCTTGAGAAAAATAAAATTAAT
GAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAATTACTGGTTGCATCAAGAACCCATA
GGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAATCCATGTCACAAGGGTAAAGCTTACAGTTTACAAA
CTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAATCAGGGTGCTGAAAACTTGCATGGTGCTTTCAGAC
ATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAGACACATTTTGCCTCTATGTCTCTTAAAATTTTAA
TTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTACGTGCCTTGCCTTGAAATCTAAAAAACAAAAAAC
AAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTGCATTTATTATCATTTTAAATCTTTACCATTTTTA
TGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTTAGACAGTTATACCTTTATCTCACATTTATAAAGC
ATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTTCAGTATTTTGGTGTTTTTTTCTATTAACCTTTCA
TGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAATTATGCAATACCAAGTTTTGCCTATGTAGGTAGTG
CTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATGTATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGA
CCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAGATGGACAGGGGATTTTTTTTAATATACATATATA
TATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGA
CTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCCCACCTGGGTTGCAAGCTGAACTCATTACTGGTTT
TCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGACTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATA
GTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGCAAAAATATTTGTTGAAATGTCCACATAGGGGATG
TTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAACACATTAGACCTGTTGGAGGGAGTCTCCCGTATT
CCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTACCTGTGACTTACTACTTCAAATGGATGGCAGTGC
ACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAATGTATTTGGACTGATAGATTAAAATCAAAGTTCAA
TTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACTGAGAACCAGAGCAGAAGGGAAATATAGAATTTTA
AGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTTTAAGGAATGGTACCTTAACTATATATTTGATTTC
GTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAGTCCCATTGAGTGTATTCATTACTAG
AAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTCCCCTAGGCCATGGCCTAATAAAATA
AACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGCTTATGGGCTGGAGAATTGTATTTGATTAGCCCAT
TCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAGTCCAATCATTTCTGTGATACTCGCC
CTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGGTGAACAAATGAACCTCACAGGACACACAGTATTT
TTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTTACACACTGTGGGTATTCCTGCCTGCCTCTTGAAT
ACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGAGATAAAACTATTAAAAGTACTACTA
TATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTATATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTG
CACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGTAGGGAGTGGTGTCTCCAACCATCAG
TTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGCCTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGC
ATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAAGACATGGCAAAAATCTTAATTATAGCAATATAGT
TATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTGAAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTC
TTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAGAATTTTTTTTAAATTAAAATTCCCATGTTTGTAA
AGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGTAAACAAGAATATTCCTTGTTTAGAGACTGGACTTGA
GTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTAGGAGTTATTTCACAGATTCCTGTGCTTGAAAAGC
ATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGAAGGTTATTTTGTTGTATTTAGTATTGGAAAAGTTGG
TTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGGCCTTTAGCAAAAGTTTTTGTGATTGTTACGTGAT
GGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACAGTGCTATGTCTCACATAACGTGTCCTCAGGGAGCAG
AATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAGGGACATCTTCAGCGGTGTGACAGCAGGACATGTT
CTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAAGTTATCCCATATTCAGTGTACAGTATTCATTTTTAA
TGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATAGTTTACATGTTCCTGTCAAGGTCTTTTGTTAACA
TTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACTTTTTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTC
AAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCCTTCTTCATATTTTGCACTTTCTGGTA
GTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGCAGTTGGGGGGTAACATGGACCACTGATTTTGCCCTT
TGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTGTACTGTGTCCGTGCCACAGATCTGTTGGTCACAT
TGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTGCAATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTT
TTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTGCAATTCAAATGTATGTTGAGATTGTGAAAAGCGC
TTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGCATGATACAGTACCAGGAACAACAGGTGGCCTAAATA
CATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTTTGACAGAATGGTTTTGAAAACTGTGCTACAGGGA
CTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTTTTTTTTTTTAAGAAGTATGGCTTTTTATGCATCCTT
CATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGAAACAAACAAAAAAAAAAAACCAGCAAAATGTTTA
CCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGAGTTCAGTTGTAAATATGTTTCAAATGACATTTTCTT
GGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCATAGGTTTCTCAAAGCTGCAGTAGATTATGTCTTC
ATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAGAGCTGCCCCCACCTCAATGATATTTCTCTGAGAACA
ACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGAGTAGTCAGTTATTGCTTGCTAGCTACACACCAGG
GTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGAACCTTGTATTTTAATTAAATTTTTTTACAAAAGGAG
GCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACAGTTACTTAATTTCTAGAGTTCAGGCCTCTGGGAT
CAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAGGATAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAA
TGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGATTGTTACTGTTATATCCAGCCTATACTGCTAGCA

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000380953_chr9_14307519_-_3677nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCT
AACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTG
ACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGA
CTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACC
CATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAA
ACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAA
GAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGG
GTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCT
ATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCA
TGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTA
TAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTT

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000397575_chr9_14307519_-_3763nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCT
AACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTG
ACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGCCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGA
CTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCC
AGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCC
ATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAA
CACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAG
AAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGG
TCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTA
TGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCAT
GGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTAT
AAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTA

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000397581_chr9_14307519_-_3762nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCCT
AACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTCACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTG
ACCCTGAGCATGACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACCACCTACACAGCCTCAGGC
ACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATG
AATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGTACCTGGGCTAGCTTGGTT
CCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCA
GAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGAC
AAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAG
GTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTC
CGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATT
GGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGT
GACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAG

>In-frame_MYB_ENST00000533624_chr6_135521553_+_NFIB_ENST00000397579_chr9_14307519_-_3510nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCAC
ACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGGCTCCCTACCT
GAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACA
CTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCACCCCCCTCATT
GGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTTAGAACCCCAGCTATC
AAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAG
ATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTT
CAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCA
ATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCA
GTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAG
GAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGG
AGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACC
GATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTT
GATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGT
TACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGGGAACTGGA
GTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCA
CCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCA
GCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCT
GCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCACACAGTGTCATCTCA
ACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACA
ATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGCTG
AGGATTTGTGACTGGACCATGAATCAAAACGGCAGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCT
GGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTACGGTTTGAACATAATT
GGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAA
AGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACCAGCAATTGCAGCACTT
ACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACG
TAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCTAGATGCCTTAATATTT
GCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAG
GCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAAAAAAATATATGAAATC
TCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAA

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000380934_chr9_14307519_-_9286nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTA
CGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTT
TTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACC
AGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGAT
CGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCT
AGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCAC
CAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAA
AAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCC
AGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGGCTCTATGGAA
GAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCACAAAAGAAACACTTAACAGA
GGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGGGATTAAAAAG
AATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAAGACAAATCATGTGCTTGAG
AAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAATTACTGGTTG
CATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAATCCATGTCACAAGGGTAAAG
CTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAATCAGGGTGCTGAAAACTTGC
ATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAGACACATTTTGCCTCTATGT
CTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTACGTGCCTTGCCTTGAAATC
TAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTGCATTTATTATCATTTTAAA
TCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTTAGACAGTTATACCTTTATC
TCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTTCAGTATTTTGGTGTTTTTT
TCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAATTATGCAATACCAAGTTTTG
CCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATGTATGCTTTTTTGTTTGTTT
GTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAGATGGACAGGGGATTTTTTT
TAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCTGAGATGGGCC
TGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCCCACCTGGGTTGCAAGCTGA
ACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGACTTGGCTTAAAAAGGCAGA
CTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGCAAAAATATTTGTTGAAATG
TCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAACACATTAGACCTGTTGGAG
GGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTACCTGTGACTTACTACTTCA
AATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAATGTATTTGGACTGATAGATT
AAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACTGAGAACCAGAGCAGAAGGG
AAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTTTAAGGAATGGTACCTTAAC
TATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAGTCCCATTGAG
TGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTCCCCTAGGCCA
TGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGCTTATGGGCTGGAGAATTGT
ATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAGTCCAATCATT
TCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGGTGAACAAATGAACCTCACA
GGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTTACACACTGTGGGTATTCCT
GCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGAGATAAAACTA
TTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTATATTCTGACGAAGGGCCCCA
CTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGTAGGGAGTGGT
GTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGCCTCTGAAGCGTGTTACCCC
TGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAAGACATGGCAAAAATCTTAA
TTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTGAAGCTGCAAGTAGCGAGAA
GAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAGAATTTTTTTTAAATTAAAA
TTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATATGTTGTTTCCATTTTTAAAGTAAACAAGAATATTCCTTGTTT
AGAGACTGGACTTGAGTTAAAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTAGGAGTTATTTCACAGATTC
CTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGGAGAAAAGTTATATTTTATGAAGGTTATTTTGTTGTATTTAG
TATTGGAAAAGTTGGTTTCCAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGGCCTTTAGCAAAAGTTTTTG
TGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGGATAGGCAGAAAACTAAAACAGTGCTATGTCTCACATAACGT
GTCCTCAGGGAGCAGAATCTTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAGGGACATCTTCAGCGGTGTG
ACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGAAATGATGAAGGCTGCAGAAAGTTATCCCATATTCAGTGTAC
AGTATTCATTTTTAATGAAACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATAGTTTACATGTTCCTGTCAA
GGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAATTGGGTTTCTATAGAAAACTTTTTTTTTTTTTTTTTTTTTA
ATGTGCAGGCTATTCAAGTTCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCCTTCTTCATATT
TTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTGTGGGTGGAGTGGAGCCCTGCAGTTGGGGGGTAACATGGACC
ACTGATTTTGCCCTTTGACCCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTGTACTGTGTCCGTGCCACAG
ATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTCAATTTTTACATTTTTTGTTGCAATTTTTTCTTCAATGGTTG
TAAGTAGTTTTTTTTTTTTTTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTGCAATTCAAATGTATGTTGA
GATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTAAGCCCTTGATGACTTATTGCATGATACAGTACCAGGAACAA
CAGGTGGCCTAAATACATGAAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTTTGACAGAATGGTTTTGAAA
ACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGGAAGTCTTTTTTTTTCTTTTTTTTTTTTTTAAGAAGTATGGC
TTTTTATGCATCCTTCATCGAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGAAACAAACAAAAAAAAAAAA
CCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTCAATTTCACAGTCTCTGTTGAGTTCAGTTGTAAATATGTTTC
AAATGACATTTTCTTGGGAAAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCATAGGTTTCTCAAAGCTGCA
GTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGAACTTTTAGCATCCTGGGAAGAGCTGCCCCCACCTCAATGAT
ATTTCTCTGAGAACAACTTTTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGAGTAGTCAGTTATTGCTTGC
TAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCCTCATGGGCCATAAATACAGAACCTTGTATTTTAATTAAATT
TTTTTACAAAAGGAGGCACATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACAGTTACTTAATTTCTAGAGT
TCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGTTTTATTGTGCCCGGTTGGAGGATAACGTTCTTTGGGTACTT
TTTGTGGGTTGCAAATGAACTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGATTGTTACTGTTATATCCAG
CCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGATATATTTCCTATGCAAAAACTGTTTAAACAATAAAATGAGC

>In-frame_MYB_ENST00000534044_chr6_135521553_+_NFIB_ENST00000380959_chr9_14307519_-_9281nt
ATGGCCCGAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGGGCTGCTT
CCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACA
GATGACTGGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTC
ATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAGTGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAG
CACTTAAAGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTAAGAAAACCTCCTGGACAGAAGAG
GAAGACAGAATTATTTACCAGGCACACAAGAGACTGGGGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCT
ATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTG
GCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTT
AACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTC
AATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTG
CTCCTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCAACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACC
ACCATTGCCGACCACACCAGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGAT
CCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTA
GAATTTGCAGAAACACTCCAATTTATAGATTCTTTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACT
TCCACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAAAACTCAAAAGGAAAATACTGTTTTT
AGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAA
TACGGTCCCCTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGATGAATCTGGA
ATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAACAAGAGGATGAATTTCACCCATTCATCGAGGCACTTCTT
CCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCAAAG
GATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGC
AAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAG
AAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGCATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACAGTA
TCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCC
AAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATA
ACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGTCAATCTTCAGAGG
TCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCC
TCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAG
CCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTTGCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTAC
TTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCA
CAAACCAGCCAGTCCTGGTACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAATGTCCAAAATTA
CGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAACTGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTT
TTTTAAATAAAAAAAAAGGAAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAAGATAATAGACC
AGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTAATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGAT
CGCAGCCCCTGCAACGTAGCCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTAACTGACTTTCT
AGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTCTTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCAC
CAACGAAGGCTAGGAGGCGGCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTCTAAAAGTTAAA
AAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATTAAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCC
AGTTTGAAATCTTAAAAAAAGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGAACACAAAGGCTCTATGGAA
GAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAAATTAATATAATATTTTCCCCACAAAAGAAACACTTAACAGA
GGCAAGTGCAATTTATAAATTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGGGGATTAAAAAG
AATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGGCATTAAAAAGGCATTAAATCAAGACAAATCATGTGCTTGAG
AAAAATAAAATTAATGAAAACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATTTATTTAAAATTACTGGTTG
CATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTATAGAGACAAAGAGGCAGGCAAATCCATGTCACAAGGGTAAAG
CTTACAGTTTACAAACTGGGAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAATCAGGGTGCTGAAAACTTGC
ATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACAGATCCATAGTGTGCATGGGCAGACACATTTTGCCTCTATGT
CTCTTAAAATTTTAATTAAAAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTACGTGCCTTGCCTTGAAATC
TAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGACATCACTACACTTGTTTTGCTGCATTTATTATCATTTTAAA
TCTTTACCATTTTTATGACAAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTTAGACAGTTATACCTTTATC
TCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAATTGTAATCGACCAGCAATATTTTCAGTATTTTGGTGTTTTTT
TCTATTAACCTTTCATGTTTTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAATTATGCAATACCAAGTTTTG
CCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACACAGATTTAAAAAAAAAATAATGTATGCTTTTTTGTTTGTTT
GTTTGTTTTAATTGACCAAAGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAGATGGACAGGGGATTTTTTT
TAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACACTTTGCAGTGTAGCTGTGAAGCAGTGCACCCTGAGATGGGCC
TGGGCTGCAAAGCGACTGTTCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCCCACCTGGGTTGCAAGCTGA
ACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACACAACAAATTCTCCTGGAGGCAGACTTGGCTTAAAAAGGCAGA
CTTGGCTTGGTGATAGTTTTTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGCAAAAATATTTGTTGAAATG
TCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACATGAATATTCTTTCTCCTAGAAAACACATTAGACCTGTTGGAG
GGAGTCTCCCGTATTCCTTTTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTACCTGTGACTTACTACTTCA
AATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAACAGAGGGTTGCTATTGTTGAATGTATTTGGACTGATAGATT
AAAATCAAAGTTCAATTTTTAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACTGAGAACCAGAGCAGAAGGG
AAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCATTAGATGCTGATGGGATTTTTTTAAGGAATGGTACCTTAAC
TATATATTTGATTTCGTTTCCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCAGTCCCATTGAG
TGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTAGGCTGTCTTAAGGAGTCCCCTGGCCCCCTTCCCCTAGGCCA
TGGCCTAATAAAATAAACTGTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGCTTATGGGCTGGAGAATTGT
ATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGCGGGATCCTAGCAGTGCAAGTTCAAAAGTAAGTCCAATCATT
TCTGTGATACTCGCCCTGGTAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGGTGAACAAATGAACCTCACA
GGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTGAGCAGTTCTAGCTAACCAAGTTACACACTGTGGGTATTCCT
GCCTGCCTCTTGAATACAAAGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTTCCTTTTTGAGATAAAACTA
TTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTCCTCCTCGTGTACCAGGAAGTATATTCTGACGAAGGGCCCCA
CTTTTGCAGGTCTTGCACGCCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAGGGCATGAGTAGGGAGTGGT
GTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCCTGCCACCCACCACTCACAGTGCCTCTGAAGCGTGTTACCCC
TGGAGTGACGTGAGCATTTGAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAAGACATGGCAAAAATCTTAA
TTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAAAAAATATGTGAATGAATCTGTGAAGCTGCAAGTAGCGAGAA
GAGCGAAAGGTCTTCTTAATGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAGAATTTTTTTTAAATTAAAA
TTCCCATGTTTGTAAAGCTAACTTTTTAACAATT