FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22847

FusionGeneSummary for MTUS1_FGL1

check button Fusion gene summary
Fusion gene informationFusion gene name: MTUS1_FGL1
Fusion gene ID: 22847
HgeneTgene
Gene symbol

MTUS1

FGL1

Gene ID

57509

2267

Gene namemicrotubule associated scaffold protein 1fibrinogen like 1
SynonymsATBP|ATIP|ATIP3|ICIS|MP44|MTSG1HFREP1|HP-041|LFIRE-1|LFIRE1
Cytomap

8p22

8p22

Type of geneprotein-codingprotein-coding
Descriptionmicrotubule-associated tumor suppressor 1AT2 receptor-binding proteinAT2 receptor-interacting proteinAT2R binding proteinangiotensin-II type 2 receptor-interacting proteinerythroid differentiation-relatedmicrotubule associated tumor suppressor 1mitfibrinogen-like protein 1hepassocinhepatocellular carcinoma-related sequencehepatocyte-derived fibrinogen-related protein 1liver fibrinogen-related protein 1
Modification date2018052320180519
UniProtAcc

Q9ULD2

Q08830

Ensembl transtripts involved in fusion geneENST00000544260, ENST00000381869, 
ENST00000381861, ENST00000262102, 
ENST00000519263, ENST00000400046, 
ENST00000297488, ENST00000518713, 
ENST00000381862, 
ENST00000398056, 
ENST00000522444, ENST00000398054, 
ENST00000381840, ENST00000381841, 
ENST00000427924, ENST00000518650, 
Fusion gene scores* DoF score3 X 3 X 4=364 X 3 X 5=60
# samples 67
** MAII scorelog2(6/36*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/60*10)=0.222392421336448
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MTUS1 [Title/Abstract] AND FGL1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-RC-A6M6-01AMTUS1chr8

17570723

-FGL1chr8

17743080

-
TCGARVLUADTCGA-55-8508-01AMTUS1chr8

17570723

-FGL1chr8

17743080

-
TCGARVLUADTCGA-55-8094-01AMTUS1chr8

17570723

-FGL1chr8

17726513

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5CDS-5UTRENST00000544260ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000544260ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000544260ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000544260ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000544260ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000544260ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000544260ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381869ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381869ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381869ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381869ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381869ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381869ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381869ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381861ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381861ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381861ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381861ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381861ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381861ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000381861ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000262102ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000262102ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000262102ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000262102ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000262102ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000262102ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000262102ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000519263ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000519263ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000519263ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000519263ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000519263ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000519263ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17743080

-
5CDS-5UTRENST00000519263ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000400046ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000400046ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000400046ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000400046ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000400046ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000400046ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000400046ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000297488ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000297488ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000297488ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000297488ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000297488ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000297488ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000297488ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000518713ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000518713ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000518713ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000518713ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000518713ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000518713ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000518713ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000381862ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000381862ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000381862ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000381862ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000381862ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000381862ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17743080

-
intron-5UTRENST00000381862ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17743080

-
In-frameENST00000544260ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000544260ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000544260ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000544260ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000544260ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000544260ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000544260ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000381869ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000381869ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000381869ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000381869ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000381869ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000381869ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000381869ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000381861ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000381861ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000381861ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000381861ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000381861ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000381861ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000381861ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000262102ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000262102ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000262102ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000262102ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000262102ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000262102ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17726513

-
Frame-shitENST00000262102ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000519263ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000519263ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000519263ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000519263ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000519263ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000519263ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17726513

-
In-frameENST00000519263ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000400046ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000400046ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000400046ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000400046ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000400046ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000400046ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000400046ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000297488ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000297488ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000297488ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000297488ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000297488ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000297488ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000297488ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000518713ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000518713ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000518713ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000518713ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000518713ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000518713ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000518713ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000381862ENST00000398056MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000381862ENST00000522444MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000381862ENST00000398054MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000381862ENST00000381840MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000381862ENST00000381841MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000381862ENST00000427924MTUS1chr8

17570723

-FGL1chr8

17726513

-
intron-3CDSENST00000381862ENST00000518650MTUS1chr8

17570723

-FGL1chr8

17726513

-

Top

FusionProtFeatures for MTUS1_FGL1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MTUS1

Q9ULD2

FGL1

Q08830

Has hepatocyte mitogenic activity.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMTUS1chr8:17570723chr8:17726513ENST00000262102-615940_12318741271Coiled coilOntology_term=ECO:0000255
HgeneMTUS1chr8:17570723chr8:17726513ENST00000297488-110940_1231-98437Coiled coilOntology_term=ECO:0000255
HgeneMTUS1chr8:17570723chr8:17726513ENST00000381861-312940_1231121518Coiled coilOntology_term=ECO:0000255
HgeneMTUS1chr8:17570723chr8:17726513ENST00000381862-14940_1231-158771Coiled coilOntology_term=ECO:0000255
HgeneMTUS1chr8:17570723chr8:17726513ENST00000381869-514940_12318201217Coiled coilOntology_term=ECO:0000255
HgeneMTUS1chr8:17570723chr8:17726513ENST00000400046-19940_12310343Coiled coilOntology_term=ECO:0000255
HgeneMTUS1chr8:17570723chr8:17726513ENST00000519263-413940_12318201217Coiled coilOntology_term=ECO:0000255
HgeneMTUS1chr8:17570723chr8:17726513ENST00000544260-312940_123119416Coiled coilOntology_term=ECO:0000255
TgeneFGL1chr8:17570723chr8:17726513ENST00000381840-4823_61167313Coiled coilOntology_term=ECO:0000255
TgeneFGL1chr8:17570723chr8:17726513ENST00000381841-5923_61167313Coiled coilOntology_term=ECO:0000255
TgeneFGL1chr8:17570723chr8:17726513ENST00000398054-5923_61167313Coiled coilOntology_term=ECO:0000255
TgeneFGL1chr8:17570723chr8:17726513ENST00000398056-61023_61167313Coiled coilOntology_term=ECO:0000255
TgeneFGL1chr8:17570723chr8:17726513ENST00000427924-4823_61167313Coiled coilOntology_term=ECO:0000255
TgeneFGL1chr8:17570723chr8:17726513ENST00000518650-4823_61167313Coiled coilOntology_term=ECO:0000255
TgeneFGL1chr8:17570723chr8:17726513ENST00000522444-3723_61167313Coiled coilOntology_term=ECO:0000255
TgeneFGL1chr8:17570723chr8:17726513ENST00000381840-4874_306167313DomainFibrinogen C-terminal
TgeneFGL1chr8:17570723chr8:17726513ENST00000381841-5974_306167313DomainFibrinogen C-terminal
TgeneFGL1chr8:17570723chr8:17726513ENST00000398054-5974_306167313DomainFibrinogen C-terminal
TgeneFGL1chr8:17570723chr8:17726513ENST00000398056-61074_306167313DomainFibrinogen C-terminal
TgeneFGL1chr8:17570723chr8:17726513ENST00000427924-4874_306167313DomainFibrinogen C-terminal
TgeneFGL1chr8:17570723chr8:17726513ENST00000518650-4874_306167313DomainFibrinogen C-terminal
TgeneFGL1chr8:17570723chr8:17726513ENST00000522444-3774_306167313DomainFibrinogen C-terminal


Top

FusionGeneSequence for MTUS1_FGL1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000398056_chr8_17726513_-_165aa
MKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWD

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000522444_chr8_17726513_-_165aa
MKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWD

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000398054_chr8_17726513_-_165aa
MKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWD

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000381840_chr8_17726513_-_165aa
MKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWD

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000381841_chr8_17726513_-_165aa
MKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWD

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000427924_chr8_17726513_-_165aa
MKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWD

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000518650_chr8_17726513_-_165aa
MKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWD

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000398056_chr8_17726513_-_267aa
MTVPGGFRSCTETDISSKIFINSTLTPPAGSERHTDATLLTLLVVGSYSLCIIPLLATFTGKKTGNAAVIKTEEKPPKPAFQNGSSGSFT
LKPLVSRAHVHLMKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWW

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000522444_chr8_17726513_-_267aa
MTVPGGFRSCTETDISSKIFINSTLTPPAGSERHTDATLLTLLVVGSYSLCIIPLLATFTGKKTGNAAVIKTEEKPPKPAFQNGSSGSFT
LKPLVSRAHVHLMKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWW

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000398054_chr8_17726513_-_267aa
MTVPGGFRSCTETDISSKIFINSTLTPPAGSERHTDATLLTLLVVGSYSLCIIPLLATFTGKKTGNAAVIKTEEKPPKPAFQNGSSGSFT
LKPLVSRAHVHLMKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWW

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000381840_chr8_17726513_-_267aa
MTVPGGFRSCTETDISSKIFINSTLTPPAGSERHTDATLLTLLVVGSYSLCIIPLLATFTGKKTGNAAVIKTEEKPPKPAFQNGSSGSFT
LKPLVSRAHVHLMKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWW

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000381841_chr8_17726513_-_267aa
MTVPGGFRSCTETDISSKIFINSTLTPPAGSERHTDATLLTLLVVGSYSLCIIPLLATFTGKKTGNAAVIKTEEKPPKPAFQNGSSGSFT
LKPLVSRAHVHLMKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWW

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000427924_chr8_17726513_-_267aa
MTVPGGFRSCTETDISSKIFINSTLTPPAGSERHTDATLLTLLVVGSYSLCIIPLLATFTGKKTGNAAVIKTEEKPPKPAFQNGSSGSFT
LKPLVSRAHVHLMKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWW

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000518650_chr8_17726513_-_267aa
MTVPGGFRSCTETDISSKIFINSTLTPPAGSERHTDATLLTLLVVGSYSLCIIPLLATFTGKKTGNAAVIKTEEKPPKPAFQNGSSGSFT
LKPLVSRAHVHLMKTPPKGPSRKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWW

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000398056_chr8_17726513_-_966aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSAGNAAVIKTEEKPPKPAFQNGSSGSFTLKPLVSRAHVHLMKTPPKGPS
RKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNTEGN

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000522444_chr8_17726513_-_966aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSAGNAAVIKTEEKPPKPAFQNGSSGSFTLKPLVSRAHVHLMKTPPKGPS
RKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNTEGN

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000398054_chr8_17726513_-_966aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSAGNAAVIKTEEKPPKPAFQNGSSGSFTLKPLVSRAHVHLMKTPPKGPS
RKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNTEGN

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000381840_chr8_17726513_-_966aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSAGNAAVIKTEEKPPKPAFQNGSSGSFTLKPLVSRAHVHLMKTPPKGPS
RKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNTEGN

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000381841_chr8_17726513_-_966aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSAGNAAVIKTEEKPPKPAFQNGSSGSFTLKPLVSRAHVHLMKTPPKGPS
RKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNTEGN

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000427924_chr8_17726513_-_966aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSAGNAAVIKTEEKPPKPAFQNGSSGSFTLKPLVSRAHVHLMKTPPKGPS
RKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNTEGN

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000518650_chr8_17726513_-_966aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSAGNAAVIKTEEKPPKPAFQNGSSGSFTLKPLVSRAHVHLMKTPPKGPS
RKNLFTALNAEDYTLKIDLADFEKNSRTAQTKNFKVGDEKNFYELNIGETSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNTEGN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000398056_chr8_17726513_-_495nt
ATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGAT
TTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCT
GGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGAC
AGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGT
GTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTG

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000522444_chr8_17726513_-_495nt
ATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGAT
TTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCT
GGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGAC
AGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGT
GTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTG

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000398054_chr8_17726513_-_495nt
ATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGAT
TTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCT
GGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGAC
AGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGT
GTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTG

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000381840_chr8_17726513_-_495nt
ATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGAT
TTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCT
GGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGAC
AGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGT
GTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTG

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000381841_chr8_17726513_-_495nt
ATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGAT
TTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCT
GGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGAC
AGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGT
GTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTG

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000427924_chr8_17726513_-_495nt
ATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGAT
TTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCT
GGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGAC
AGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGT
GTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTG

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000518650_chr8_17726513_-_495nt
ATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGAT
TTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCT
GGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGAC
AGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGT
GTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTG

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000398056_chr8_17726513_-_801nt
ATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTGATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGT
TCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGGTCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACT
GGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTAT
TTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAAT
GCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAA
AAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGG
GCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGG
TGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTAC

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000522444_chr8_17726513_-_801nt
ATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTGATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGT
TCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGGTCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACT
GGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTAT
TTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAAT
GCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAA
AAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGG
GCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGG
TGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTAC

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000398054_chr8_17726513_-_801nt
ATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTGATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGT
TCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGGTCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACT
GGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTAT
TTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAAT
GCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAA
AAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGG
GCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGG
TGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTAC

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000381840_chr8_17726513_-_801nt
ATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTGATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGT
TCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGGTCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACT
GGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTAT
TTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAAT
GCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAA
AAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGG
GCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGG
TGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTAC

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000381841_chr8_17726513_-_801nt
ATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTGATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGT
TCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGGTCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACT
GGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTAT
TTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAAT
GCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAA
AAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGG
GCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGG
TGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTAC

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000427924_chr8_17726513_-_801nt
ATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTGATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGT
TCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGGTCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACT
GGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTAT
TTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAAT
GCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAA
AAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGG
GCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGG
TGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTAC

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000518650_chr8_17726513_-_801nt
ATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTGATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGT
TCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGGTCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACT
GGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTAT
TTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAAT
GCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAA
AAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGG
GCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGG
TGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTAC

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000398056_chr8_17726513_-_2898nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTT
CAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCG
AGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAA
TATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGG
AATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAAC
TGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCT
AAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTT

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000522444_chr8_17726513_-_2898nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTT
CAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCG
AGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAA
TATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGG
AATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAAC
TGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCT
AAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTT

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000398054_chr8_17726513_-_2898nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTT
CAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCG
AGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAA
TATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGG
AATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAAC
TGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCT
AAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTT

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000381840_chr8_17726513_-_2898nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTT
CAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCG
AGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAA
TATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGG
AATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAAC
TGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCT
AAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTT

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000381841_chr8_17726513_-_2898nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTT
CAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCG
AGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAA
TATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGG
AATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAAC
TGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCT
AAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTT

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000427924_chr8_17726513_-_2898nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTT
CAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCG
AGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAA
TATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGG
AATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAAC
TGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCT
AAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTT

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000518650_chr8_17726513_-_2898nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTT
CAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCG
AGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAA
TATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGG
AATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAAC
TGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCT
AAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000398056_chr8_17726513_-_978nt
TATGAGAGTAAGTAGCTGCATACCCTGGCACTTCAGGAATACTGGGATATGTGACTTGCAATTAAACAGGATTGTTACCAGCTTTACTGT
TGGAATTTTGAAGGTGTGGCACAAAATCAGGCTTGCATGTAAGAGGGAACTCTGAATTTGAAAAGCTGGTAATGCCGCTGTCATCAAATA
TGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTT
GATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGA
TTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTC
TGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGA
CAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGG
TGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGT
GGTTATGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAA
AGTGATTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTT

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000522444_chr8_17726513_-_969nt
TATGAGAGTAAGTAGCTGCATACCCTGGCACTTCAGGAATACTGGGATATGTGACTTGCAATTAAACAGGATTGTTACCAGCTTTACTGT
TGGAATTTTGAAGGTGTGGCACAAAATCAGGCTTGCATGTAAGAGGGAACTCTGAATTTGAAAAGCTGGTAATGCCGCTGTCATCAAATA
TGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTT
GATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGA
TTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTC
TGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGA
CAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGG
TGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGT
GGTTATGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAA
AGTGATTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTT

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000398054_chr8_17726513_-_965nt
TATGAGAGTAAGTAGCTGCATACCCTGGCACTTCAGGAATACTGGGATATGTGACTTGCAATTAAACAGGATTGTTACCAGCTTTACTGT
TGGAATTTTGAAGGTGTGGCACAAAATCAGGCTTGCATGTAAGAGGGAACTCTGAATTTGAAAAGCTGGTAATGCCGCTGTCATCAAATA
TGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTT
GATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGA
TTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTC
TGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGA
CAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGG
TGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGT
GGTTATGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAA
AGTGATTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTT

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000381840_chr8_17726513_-_965nt
TATGAGAGTAAGTAGCTGCATACCCTGGCACTTCAGGAATACTGGGATATGTGACTTGCAATTAAACAGGATTGTTACCAGCTTTACTGT
TGGAATTTTGAAGGTGTGGCACAAAATCAGGCTTGCATGTAAGAGGGAACTCTGAATTTGAAAAGCTGGTAATGCCGCTGTCATCAAATA
TGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTT
GATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGA
TTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTC
TGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGA
CAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGG
TGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGT
GGTTATGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAA
AGTGATTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTT

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000381841_chr8_17726513_-_965nt
TATGAGAGTAAGTAGCTGCATACCCTGGCACTTCAGGAATACTGGGATATGTGACTTGCAATTAAACAGGATTGTTACCAGCTTTACTGT
TGGAATTTTGAAGGTGTGGCACAAAATCAGGCTTGCATGTAAGAGGGAACTCTGAATTTGAAAAGCTGGTAATGCCGCTGTCATCAAATA
TGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTT
GATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGA
TTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTC
TGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGA
CAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGG
TGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGT
GGTTATGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAA
AGTGATTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTT

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000427924_chr8_17726513_-_965nt
TATGAGAGTAAGTAGCTGCATACCCTGGCACTTCAGGAATACTGGGATATGTGACTTGCAATTAAACAGGATTGTTACCAGCTTTACTGT
TGGAATTTTGAAGGTGTGGCACAAAATCAGGCTTGCATGTAAGAGGGAACTCTGAATTTGAAAAGCTGGTAATGCCGCTGTCATCAAATA
TGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTT
GATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGA
TTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTC
TGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGA
CAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGG
TGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGT
GGTTATGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAA
AGTGATTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTT

>In-frame_MTUS1_ENST00000544260_chr8_17570723_-_FGL1_ENST00000518650_chr8_17726513_-_774nt
TATGAGAGTAAGTAGCTGCATACCCTGGCACTTCAGGAATACTGGGATATGTGACTTGCAATTAAACAGGATTGTTACCAGCTTTACTGT
TGGAATTTTGAAGGTGTGGCACAAAATCAGGCTTGCATGTAAGAGGGAACTCTGAATTTGAAAAGCTGGTAATGCCGCTGTCATCAAATA
TGAGGAGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTT
GATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGA
TTTTGAAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTC
TGGAACAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGA
CAGAGATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGG
TGTATACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGT

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000398056_chr8_17726513_-_1333nt
AGTACTGTGTCTGATGCTCCTAAGGAGGCTGTAAAGTGCTTTTGTCCATTCCTTTTTGTCTTTTAACAAAGGGGTTTACCATACACCCAC
AGAGCCTGTCTAGTGGCGATGTGTTCCTGTTGCGGATTAAGCATTCAAATCAGTGAGTCTCTTTCTTAGTTTGATTTGCTAGCTGGTTTA
ATCTGTTTTGTGTAGTGCCTTGGAGCTTACGCATTTTTTTTTTTTTCCCTCCATTCGAATTCACTAAGAGCAAGCATGAGGGATATGAGA
GTGAACATGGCTGCAGTTTTTCCTGCTTAAGCTTGCTTTGATCCTTTTAAATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTG
ATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGTTCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGG
TCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACTGGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGG
AGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGA
AAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTG
AAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAA
CAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAG
ATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTAT
ACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTA
TGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGA
TTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTA

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000522444_chr8_17726513_-_1324nt
AGTACTGTGTCTGATGCTCCTAAGGAGGCTGTAAAGTGCTTTTGTCCATTCCTTTTTGTCTTTTAACAAAGGGGTTTACCATACACCCAC
AGAGCCTGTCTAGTGGCGATGTGTTCCTGTTGCGGATTAAGCATTCAAATCAGTGAGTCTCTTTCTTAGTTTGATTTGCTAGCTGGTTTA
ATCTGTTTTGTGTAGTGCCTTGGAGCTTACGCATTTTTTTTTTTTTCCCTCCATTCGAATTCACTAAGAGCAAGCATGAGGGATATGAGA
GTGAACATGGCTGCAGTTTTTCCTGCTTAAGCTTGCTTTGATCCTTTTAAATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTG
ATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGTTCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGG
TCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACTGGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGG
AGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGA
AAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTG
AAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAA
CAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAG
ATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTAT
ACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTA
TGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGA
TTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTA

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000398054_chr8_17726513_-_1320nt
AGTACTGTGTCTGATGCTCCTAAGGAGGCTGTAAAGTGCTTTTGTCCATTCCTTTTTGTCTTTTAACAAAGGGGTTTACCATACACCCAC
AGAGCCTGTCTAGTGGCGATGTGTTCCTGTTGCGGATTAAGCATTCAAATCAGTGAGTCTCTTTCTTAGTTTGATTTGCTAGCTGGTTTA
ATCTGTTTTGTGTAGTGCCTTGGAGCTTACGCATTTTTTTTTTTTTCCCTCCATTCGAATTCACTAAGAGCAAGCATGAGGGATATGAGA
GTGAACATGGCTGCAGTTTTTCCTGCTTAAGCTTGCTTTGATCCTTTTAAATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTG
ATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGTTCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGG
TCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACTGGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGG
AGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGA
AAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTG
AAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAA
CAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAG
ATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTAT
ACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTA
TGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGA
TTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTA

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000381840_chr8_17726513_-_1320nt
AGTACTGTGTCTGATGCTCCTAAGGAGGCTGTAAAGTGCTTTTGTCCATTCCTTTTTGTCTTTTAACAAAGGGGTTTACCATACACCCAC
AGAGCCTGTCTAGTGGCGATGTGTTCCTGTTGCGGATTAAGCATTCAAATCAGTGAGTCTCTTTCTTAGTTTGATTTGCTAGCTGGTTTA
ATCTGTTTTGTGTAGTGCCTTGGAGCTTACGCATTTTTTTTTTTTTCCCTCCATTCGAATTCACTAAGAGCAAGCATGAGGGATATGAGA
GTGAACATGGCTGCAGTTTTTCCTGCTTAAGCTTGCTTTGATCCTTTTAAATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTG
ATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGTTCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGG
TCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACTGGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGG
AGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGA
AAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTG
AAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAA
CAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAG
ATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTAT
ACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTA
TGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGA
TTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTA

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000381841_chr8_17726513_-_1320nt
AGTACTGTGTCTGATGCTCCTAAGGAGGCTGTAAAGTGCTTTTGTCCATTCCTTTTTGTCTTTTAACAAAGGGGTTTACCATACACCCAC
AGAGCCTGTCTAGTGGCGATGTGTTCCTGTTGCGGATTAAGCATTCAAATCAGTGAGTCTCTTTCTTAGTTTGATTTGCTAGCTGGTTTA
ATCTGTTTTGTGTAGTGCCTTGGAGCTTACGCATTTTTTTTTTTTTCCCTCCATTCGAATTCACTAAGAGCAAGCATGAGGGATATGAGA
GTGAACATGGCTGCAGTTTTTCCTGCTTAAGCTTGCTTTGATCCTTTTAAATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTG
ATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGTTCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGG
TCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACTGGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGG
AGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGA
AAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTG
AAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAA
CAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAG
ATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTAT
ACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTA
TGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGA
TTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTA

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000427924_chr8_17726513_-_1320nt
AGTACTGTGTCTGATGCTCCTAAGGAGGCTGTAAAGTGCTTTTGTCCATTCCTTTTTGTCTTTTAACAAAGGGGTTTACCATACACCCAC
AGAGCCTGTCTAGTGGCGATGTGTTCCTGTTGCGGATTAAGCATTCAAATCAGTGAGTCTCTTTCTTAGTTTGATTTGCTAGCTGGTTTA
ATCTGTTTTGTGTAGTGCCTTGGAGCTTACGCATTTTTTTTTTTTTCCCTCCATTCGAATTCACTAAGAGCAAGCATGAGGGATATGAGA
GTGAACATGGCTGCAGTTTTTCCTGCTTAAGCTTGCTTTGATCCTTTTAAATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTG
ATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGTTCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGG
TCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACTGGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGG
AGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGA
AAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTG
AAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAA
CAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAG
ATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTAT
ACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTA
TGAAAATTAGGCCAAATGATTTTATTCCAAATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGA
TTTGAAAAATACTCATTCTGAACATATCCATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTA

>In-frame_MTUS1_ENST00000381861_chr8_17570723_-_FGL1_ENST00000518650_chr8_17726513_-_1129nt
AGTACTGTGTCTGATGCTCCTAAGGAGGCTGTAAAGTGCTTTTGTCCATTCCTTTTTGTCTTTTAACAAAGGGGTTTACCATACACCCAC
AGAGCCTGTCTAGTGGCGATGTGTTCCTGTTGCGGATTAAGCATTCAAATCAGTGAGTCTCTTTCTTAGTTTGATTTGCTAGCTGGTTTA
ATCTGTTTTGTGTAGTGCCTTGGAGCTTACGCATTTTTTTTTTTTTCCCTCCATTCGAATTCACTAAGAGCAAGCATGAGGGATATGAGA
GTGAACATGGCTGCAGTTTTTCCTGCTTAAGCTTGCTTTGATCCTTTTAAATGACTGTACCAGGAGGATTTCGCAGTTGTACAGAAACTG
ATATTTCTTCAAAAATCTTTATCAATTCTACACTCACCCCACCGGCTGGTTCAGAGAGGCACTATGATGCTACCTTATTGACACTGCTGG
TCGTGGGATCGTACAGCCTTTGTATAATTCCTTTGTTAGCCACGTTTACTGGGAAAAAAACTGGTAATGCCGCTGTCATCAAATATGAGG
AGAAACCTCCAAAACCAGCATTTCAGAATGGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGA
AAACTCCTCCAAAAGGTCCTTCGAGAAAAAATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTG
AAAAAAATAGCCGTTATGCACAATATAAGAATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAA
CAGCTGGAGATTCCCTTGCGGGGAATTTTCATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAG
ATCATGACAACTATGAAGGGAACTGCGCAGAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTAT
ACTACAGCGGCCCCTACACGGCTAAAACAGACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTA

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000398056_chr8_17726513_-_3284nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAAT
GGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAA
AATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAG
AATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTT
CATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCA
GAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACA
GACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTTATTCCA
AATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGATTTGAAAAATACTCATTCTGAACATATCC
ATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTACTTAATGTGCTTTCAGTACAGCAGATATG

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000522444_chr8_17726513_-_3275nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAAT
GGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAA
AATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAG
AATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTT
CATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCA
GAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACA
GACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTTATTCCA
AATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGATTTGAAAAATACTCATTCTGAACATATCC
ATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTACTTAATGTGCTTTCAGTACAGCAGATATG

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000398054_chr8_17726513_-_3271nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAAT
GGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAA
AATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAG
AATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTT
CATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCA
GAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACA
GACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTTATTCCA
AATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGATTTGAAAAATACTCATTCTGAACATATCC
ATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTACTTAATGTGCTTTCAGTACAGCAGATATG

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000381840_chr8_17726513_-_3271nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAAT
GGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAA
AATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAG
AATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTT
CATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCA
GAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACA
GACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTTATTCCA
AATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGATTTGAAAAATACTCATTCTGAACATATCC
ATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTACTTAATGTGCTTTCAGTACAGCAGATATG

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000381841_chr8_17726513_-_3271nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAAT
GGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAA
AATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAG
AATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTT
CATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCA
GAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACA
GACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTTATTCCA
AATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGATTTGAAAAATACTCATTCTGAACATATCC
ATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTACTTAATGTGCTTTCAGTACAGCAGATATG

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000427924_chr8_17726513_-_3271nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAAT
GGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAA
AATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAG
AATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTT
CATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCA
GAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACA
GACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTTATTCCA
AATGTAATTTAATTGCTGCTGTTGGGCTTTCGTTTCTGCAATTCAGCTTTGTTTAAAGTGATTTGAAAAATACTCATTCTGAACATATCC
ATGCGCAATCATGATAACTGTTGTGAGTAGTGCTTTTCATTCTTCTCACTTGCCTTTGTTACTTAATGTGCTTTCAGTACAGCAGATATG

>In-frame_MTUS1_ENST00000519263_chr8_17570723_-_FGL1_ENST00000518650_chr8_17726513_-_3080nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGCTGGTAATGCCGCTGTCATCAAATATGAGGAGAAACCTCCAAAACCAGCATTTCAGAAT
GGTTCCTCAGGATCCTTTTATTTGAAGCCTTTGGTATCCAGGGCTCATGTTCACTTGATGAAAACTCCTCCAAAAGGTCCTTCGAGAAAA
AATTTATTTACAGCTCTTAATGCAGAAGACTACACTTTAAAAATCGACCTTGCAGATTTTGAAAAAAATAGCCGTTATGCACAATATAAG
AATTTCAAAGTTGGAGATGAAAAGAATTTCTACGAGTTGAATATTGGGGAATATTCTGGAACAGCTGGAGATTCCCTTGCGGGGAATTTT
CATCCTGAGGTGCAGTGGTGGGCTAGTCACCAAAGAATGAAATTCAGCACGTGGGACAGAGATCATGACAACTATGAAGGGAACTGCGCA
GAAGAAGATCAGTCTGGCTGGTGGTTTAACAGGTGTCACTCTGCAAACCTGAATGGTGTATACTACAGCGGCCCCTACACGGCTAAAACA
GACAATGGGATTGTCTGGTACACCTGGCATGGGTGGTGGTATTCTCTGAAATCTGTGGTTATGAAAATTAGGCCAAATGATTTTATTCCA


Top

FusionGenePPI for MTUS1_FGL1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MTUS1AGTR2, MMS19, ORC4, FHL3, CEP104, SPICE1, NINL, DCTN1, DYNLT1, LCA5, POC1A, CLTC, KIF11, MAGEA10, SMC1A, CDC14A, MTUS2, CLUHFGL1VKORC1, BCL2L11, EPPK1, LSG1, ALDH5A1, NAA35, PXDN, AARS2, CARKD, RAVER1, TBC1D10A, PPIL2, MAP1S, UBR1, CWF19L2, AMMECR1L, COL14A1, DDB2, SORL1, GTF2H2, CMAS, TLE3, TLE1, NSUN2, FBXO38, MLLT4, ARHGEF2, OGFOD1, PPP1R1A, TSR3, DCAF16, NDUFS6, NUCB1, MAPRE2, C1orf198, TUT1, TUBE1, LOH12CR1, DNM1L, PLAT, PTPN23, COL4A2, FAM172A, ERCC3, ETHE1, DPYSL5, GOLM1, ZADH2, UBA5, GTF2H3, NIPSNAP3A, MMADHC, GTF2H1, TFIP11, TUBD1, LCMT2, CENPC, TCF25, SPATS2L, C16orf59, SLTM, C17orf59, PLEKHA7, ATXN2, RBM6, TRIP6, ANKLE2, RIPK1, EPS8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MTUS1_FGL1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MTUS1_FGL1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMTUS1C2239176Liver carcinoma1UNIPROT